F415998

General Info

Members Datasets Scaffolds Average Seq Length
344 197 344 93

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10525731|Ga0207669_105257311
Length 115
Sequence VTAAHGLSHAQCDTDAVEPVTANSPRFVLDPTAERIPAERARLARPASLDGVSVGLLDISKPRGNVFLDRLEQRLTEIGANVKRYQKPTFTKPAPVDLRHEIATQCDLVIEALAD

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.21
Nodule 0
Rhizoplane 4.07
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1054430 3300002155 Unclassified 579
2 Ga0065714_10172494 3300005288 Bacteria 998
3 Ga0065712_10010112 3300005290 Bacteria 3211
4 Ga0065715_10096259 3300005293 Bacteria 3914
5 Ga0065707_10002574 3300005295 Bacteria 4691
6 Ga0070690_101715730 3300005330 Bacteria 511
7 Ga0070670_100163684 3300005331 Bacteria 1928
8 Ga0070677_10084124 3300005333 Unclassified 1368
9 Ga0068868_100301540 3300005338 Bacteria 1361
10 Ga0068868_100844995 3300005338 Bacteria 829
11 Ga0070689_100656203 3300005340 Bacteria 913
12 Ga0070689_100674702 3300005340 Unclassified 901
13 Ga0070661_101108215 3300005344 Bacteria 660
14 Ga0070668_100099544 3300005347 Bacteria 2302
15 Ga0070668_100401939 3300005347 Bacteria 1170
16 Ga0070669_100135093 3300005353 Bacteria 1896
17 Ga0070675_100443877 3300005354 Bacteria 1163
18 Ga0070675_102077357 3300005354 Bacteria 524
19 Ga0070671_100091418 3300005355 Bacteria 2549
20 Ga0070671_101315416 3300005355 Bacteria 638
21 Ga0070674_100317058 3300005356 Unclassified 1249
22 Ga0070674_100784410 3300005356 Bacteria 821
23 Ga0070674_101923580 3300005356 Bacteria 538
24 Ga0070673_101308817 3300005364 Bacteria 681
25 Ga0070688_100035721 3300005365 Bacteria 3020
26 Ga0070659_100158770 3300005366 Bacteria 1848
27 Ga0070667_101045297 3300005367 Bacteria 763
28 Ga0070705_100892763 3300005440 Bacteria 714
29 Ga0070700_100763821 3300005441 Bacteria 775
30 Ga0070700_101089345 3300005441 Unclassified 662
31 Ga0070694_101123119 3300005444 Bacteria 656
32 Ga0070708_100211053 3300005445 Unclassified 1819
33 Ga0070678_100156752 3300005456 Bacteria 1840
34 Ga0070678_101165110 3300005456 Bacteria 714
35 Ga0070662_100830219 3300005457 Bacteria 786
36 Ga0068867_100845390 3300005459 Unclassified 820
37 Ga0070685_10414462 3300005466 Unclassified 936
38 Ga0070698_100035183 3300005471 Bacteria 5180
39 Ga0070699_100767445 3300005518 Bacteria 882
40 Ga0070672_100302026 3300005543 Bacteria 1357
41 Ga0070672_100557257 3300005543 Bacteria 995
42 Ga0070672_101027240 3300005543 Bacteria 731
43 Ga0070686_100058941 3300005544 Bacteria 2472
44 Ga0070696_100243309 3300005546 Bacteria 1358
45 Ga0070664_101004734 3300005564 Unclassified 784
46 Ga0070664_101045714 3300005564 Unclassified 768
47 Ga0068857_100262982 3300005577 Bacteria 1584
48 Ga0068854_100443290 3300005578 Bacteria 1083
49 Ga0070702_101569564 3300005615 Bacteria 544
50 Ga0068852_101477075 3300005616 Bacteria 702
51 Ga0068859_101421047 3300005617 Bacteria 765
52 Ga0068859_102025141 3300005617 Bacteria 636
53 Ga0068864_100269257 3300005618 Bacteria 1587
54 Ga0068861_100028314 3300005719 Bacteria 4087
55 Ga0068861_100066350 3300005719 Bacteria 2782
56 Ga0068870_10025250 3300005840 Bacteria 2948
57 Ga0068870_10094150 3300005840 Bacteria 1681
58 Ga0068870_10290970 3300005840 Unclassified 1027
59 Ga0068863_100500232 3300005841 Bacteria 1197
60 Ga0068858_101697007 3300005842 Bacteria 624
61 Ga0068862_100662553 3300005844 Unclassified 1008
62 Ga0068862_101054766 3300005844 Bacteria 806
63 Ga0075365_10009780 3300006038 Bacteria 5541
64 Ga0075365_10035247 3300006038 Bacteria 3236
65 Ga0075365_10086613 3300006038 Bacteria 2129
66 Ga0075365_10223080 3300006038 Bacteria 1322
67 Ga0075368_10407524 3300006042 Bacteria 598
68 Ga0075363_100014415 3300006048 Bacteria 3862
69 Ga0075363_100064720 3300006048 Bacteria 1976
70 Ga0075363_100965639 3300006048 Bacteria 524
71 Ga0075364_10000990 3300006051 Bacteria 15049
72 Ga0075364_10021526 3300006051 Bacteria 4065
73 Ga0075364_10111348 3300006051 Bacteria 1827
74 Ga0075364_10345631 3300006051 Bacteria 1014
75 Ga0075364_10374608 3300006051 Bacteria 971
76 Ga0075362_10031850 3300006177 Bacteria 2285
77 Ga0075362_10718271 3300006177 Bacteria 522
78 Ga0075367_10035367 3300006178 Bacteria 2891
79 Ga0075367_10039556 3300006178 Bacteria 2750
80 Ga0075367_10212886 3300006178 Bacteria 1208
81 Ga0075367_10607604 3300006178 Bacteria 695
82 Ga0097621_101755504 3300006237 Unclassified 591
83 Ga0097621_101969464 3300006237 Bacteria 558
84 Ga0075370_10080829 3300006353 Bacteria 1868
85 Ga0075370_10374155 3300006353 Bacteria 853
86 Ga0075370_10412850 3300006353 Bacteria 811
87 Ga0068871_102344673 3300006358 Unclassified 509
88 Ga0075428_101096833 3300006844 Bacteria 841
89 Ga0075430_100133923 3300006846 Bacteria 2065
90 Ga0075431_101204046 3300006847 Bacteria 720
91 Ga0075433_10006496 3300006852 Bacteria 9244
92 Ga0075434_100002675 3300006871 Bacteria 15739
93 Ga0068865_100472556 3300006881 Bacteria 1040
94 Ga0097620_101420946 3300006931 Bacteria 765
95 Ga0097620_102024866 3300006931 Bacteria 636
96 Ga0075435_100006090 3300007076 Bacteria 8498
97 Ga0111539_10151991 3300009094 Bacteria 2710
98 Ga0111539_10614843 3300009094 Bacteria 1265
99 Ga0111539_11620626 3300009094 Bacteria 750
100 Ga0111539_12664861 3300009094 Bacteria 579
101 Ga0105245_10331176 3300009098 Bacteria 1503
102 Ga0105245_13097287 3300009098 Bacteria 515
103 Ga0114129_10057124 3300009147 Bacteria 5464
104 Ga0114129_10407184 3300009147 Bacteria 1792
105 Ga0114129_11517475 3300009147 Bacteria 823
106 Ga0114129_11762107 3300009147 Bacteria 754
107 Ga0105243_11904992 3300009148 Bacteria 627
108 Ga0105243_12229974 3300009148 Unclassified 585
109 Ga0105243_12828123 3300009148 Bacteria 526
110 Ga0105242_11509831 3300009176 Bacteria 703
111 Ga0105242_11940738 3300009176 Bacteria 630
112 Ga0105242_12140748 3300009176 Bacteria 604
113 Ga0105237_11585488 3300009545 Bacteria 662
114 Ga0105249_10273608 3300009553 Bacteria 1683
115 Ga0105249_12005005 3300009553 Bacteria 651
116 Ga0105246_10470841 3300011119 Bacteria 1060
117 Ga0105246_10809764 3300011119 Bacteria 832
118 Ga0157374_12353437 3300013296 Bacteria 560
119 Ga0157378_12871656 3300013297 Unclassified 534
120 Ga0157378_13202471 3300013297 Bacteria 508
121 Ga0157375_10086125 3300013308 Bacteria 3192
122 Ga0157375_10415105 3300013308 Bacteria 1512
123 Ga0157375_10899783 3300013308 Bacteria 1029
124 Ga0157375_13521923 3300013308 Bacteria 521
125 Ga0163163_11475272 3300014325 Unclassified 742
126 Ga0157380_10138274 3300014326 Unclassified 2088
127 Ga0157380_12705938 3300014326 Bacteria 562
128 Ga0157379_11229082 3300014968 Bacteria 721
129 Ga0157376_11022496 3300014969 Bacteria 850
130 Ga0157376_12041131 3300014969 Bacteria 611
131 Ga0163161_10060316 3300017792 Bacteria 2761
132 Ga0163161_11009477 3300017792 Bacteria 711
133 Ga0207682_10028783 3300025893 Bacteria 2219
134 Ga0207642_10074994 3300025899 Bacteria 1623
135 Ga0207688_10161511 3300025901 Bacteria 1328
136 Ga0207645_10293012 3300025907 Unclassified 1082
137 Ga0207645_10351651 3300025907 Bacteria 986
138 Ga0207643_10034149 3300025908 Bacteria 2849
139 Ga0207643_10344471 3300025908 Bacteria 935
140 Ga0207681_10114656 3300025923 Bacteria 1966
141 Ga0207650_10036319 3300025925 Bacteria 3584
142 Ga0207659_10054580 3300025926 Bacteria 2854
143 Ga0207659_10104915 3300025926 Bacteria 2138
144 Ga0207659_10560285 3300025926 Bacteria 972
145 Ga0207687_11020099 3300025927 Bacteria 710
146 Ga0207687_11128434 3300025927 Bacteria 673
147 Ga0207644_10635324 3300025931 Unclassified 888
148 Ga0207690_10315371 3300025932 Bacteria 1227
149 Ga0207690_10475561 3300025932 Unclassified 1008
150 Ga0207706_10033809 3300025933 Bacteria 4550
151 Ga0207706_10843132 3300025933 Unclassified 777
152 Ga0207686_11768789 3300025934 Unclassified 511
153 Ga0207670_10915078 3300025936 Unclassified 735
154 Ga0207669_10039937 3300025937 Bacteria 2717
155 Ga0207669_10525731 3300025937 Bacteria 951
156 Ga0207669_10781756 3300025937 Bacteria 790
157 Ga0207669_11452967 3300025937 Bacteria 584
158 Ga0207669_11520924 3300025937 Bacteria 571
159 Ga0207704_10298529 3300025938 Unclassified 1233
160 Ga0207665_11698976 3300025939 Bacteria 500
161 Ga0207691_10040746 3300025940 Unclassified 4290
162 Ga0207691_10562524 3300025940 Bacteria 966
163 Ga0207691_10563340 3300025940 Bacteria 966
164 Ga0207689_10019405 3300025942 Bacteria 5731
165 Ga0207679_11728688 3300025945 Unclassified 572
166 Ga0207651_10413027 3300025960 Bacteria 1150
167 Ga0207712_10100735 3300025961 Bacteria 2147
168 Ga0207712_10542420 3300025961 Bacteria 999
169 Ga0207668_10064662 3300025972 Bacteria 2586
170 Ga0207668_10089214 3300025972 Bacteria 2260
171 Ga0207658_11182103 3300025986 Bacteria 699
172 Ga0207677_11484770 3300026023 Bacteria 626
173 Ga0207703_11013860 3300026035 Bacteria 797
174 Ga0207678_11791457 3300026067 Unclassified 538
175 Ga0207708_10040186 3300026075 Bacteria 3566
176 Ga0207708_11148118 3300026075 Bacteria 678
177 Ga0207641_10490413 3300026088 Bacteria 1192
178 Ga0207648_10676617 3300026089 Unclassified 955
179 Ga0207676_10409070 3300026095 Bacteria 1270
180 Ga0207674_10174137 3300026116 Bacteria 2104
181 Ga0207674_11386771 3300026116 Bacteria 672
182 Ga0207675_100007094 3300026118 Bacteria 10589
183 Ga0207683_10039352 3300026121 Bacteria 4124
184 Ga0207683_10076922 3300026121 Bacteria 2955
185 Ga0207683_10504830 3300026121 Bacteria 1117
186 Ga0207428_10443955 3300027907 Bacteria 946
187 Ga0268265_10045424 3300028380 Bacteria 3278
188 Ga0268265_10159031 3300028380 Bacteria 1916
189 Ga0307517_10277342 3300028786 Bacteria 959
190 Ga0307513_10251220 3300031456 Bacteria 1565
191 Ga0307408_100263838 3300031548 Bacteria 1427
192 Ga0316576_10000682 3300031727 Bacteria 16622
193 Ga0316576_10106524 3300031727 Bacteria 2099
194 Ga0316576_10475133 3300031727 Bacteria 921
195 Ga0316578_10419745 3300031728 Unclassified 792
196 Ga0316574_0049111 3300035398 Bacteria 2623
197 Ga0316574_0110985 3300035398 Bacteria 1758
198 Ga0316574_0674244 3300035398 Bacteria 635
199 Ga0316582_0489628 3300036647 Bacteria 848
200 Ga0316584_0576219 3300036712 Bacteria 783
201 Ga0316584_1008970 3300036712 Bacteria 556
202 Ga0436365_1155438 3300039437 Unclassified 673
203 Ga0451787_798141 3300041441 Bacteria 748
204 Ga0451791_0396519 3300041451 Bacteria 597
205 Ga0451791_0466067 3300041451 Bacteria 2114
206 Ga0451800_0441588 3300041459 Bacteria 689
207 Ga0451804_0317026 3300041463 Bacteria 1182
208 Ga0451837_1157946 3300041494 Bacteria 2429
209 Ga0451841_0572970 3300041498 Bacteria 781
210 Ga0451843_1329850 3300041509 Bacteria 824
211 Ga0451855_0355147 3300041511 Bacteria 527
212 Ga0451853_0769242 3300041512 Unclassified 721
213 Ga0450923_015160 3300042125 Bacteria 1438
214 Ga0450918_044918 3300042531 Bacteria 798
215 Ga0451577_0046641 3300042876 Bacteria 3876
216 Ga0453684_0469051 3300044712 Bacteria 1398
217 Ga0495603_0254074 3300046455 Bacteria 1012
218 Ga0495629_0327377 3300046459 Bacteria 1047
219 Ga0495653_0629784 3300046463 Bacteria 657
220 Ga0495633_0283316 3300046558 Unclassified 754
221 Ga0495656_0607667 3300046615 Unclassified 585
222 Ga0495658_0262480 3300046683 Bacteria 1087
223 Ga0495670_0203885 3300046691 Bacteria 1048
224 Ga0495636_0551402 3300047318 Bacteria 561
225 Ga0495676_0558317 3300047321 Bacteria 748
226 Ga0495680_0892568 3300047322 Bacteria 575
227 Ga0496108_0845082 3300048911 Bacteria 788
228 Ga0496108_1541781 3300048911 Bacteria 552
229 Ga0496109_0280945 3300048912 Bacteria 1569
230 Ga0496109_1821055 3300048912 Bacteria 542
231 Ga0496111_0268569 3300048914 Bacteria 1265
232 Ga0496111_0554182 3300048914 Bacteria 844
233 Ga0496111_0802166 3300048914 Bacteria 681
234 Ga0496113_0255751 3300048916 Bacteria 1399
235 Ga0496114_1470558 3300048917 Bacteria 569
236 Ga0501031_0022110 3300049568 Bacteria 4144
237 Ga0501031_0252476 3300049568 Bacteria 1146
238 Ga0501031_0464827 3300049568 Bacteria 817
239 Ga0501031_0790253 3300049568 Bacteria 609
240 Ga0501033_0571455 3300049570 Bacteria 777
241 Ga0501036_0030557 3300049572 Bacteria 4549
242 Ga0501036_0085530 3300049572 Bacteria 2666
243 Ga0501036_0390504 3300049572 Bacteria 1161
244 Ga0501036_0409866 3300049572 Bacteria 1130
245 Ga0501037_0291804 3300049573 Bacteria 1134
246 Ga0501037_0623302 3300049573 Bacteria 723
247 Ga0501038_0092521 3300049574 Bacteria 2532
248 Ga0501039_0167069 3300049575 Bacteria 1730
249 Ga0501039_0781504 3300049575 Bacteria 745
250 Ga0501040_0006157 3300049576 Bacteria 7783
251 Ga0501040_0026431 3300049576 Bacteria 3904
252 Ga0501041_0025694 3300049577 Bacteria 3540
253 Ga0501041_0269573 3300049577 Bacteria 1071
254 Ga0501041_0432542 3300049577 Bacteria 835
255 Ga0501042_0042677 3300049578 Bacteria 3229
256 Ga0501042_0378933 3300049578 Bacteria 1024
257 Ga0501042_0808867 3300049578 Bacteria 682
258 Ga0501043_0162325 3300049579 Bacteria 1746
259 Ga0501043_0599262 3300049579 Bacteria 814
260 Ga0501043_0916631 3300049579 Bacteria 628
261 Ga0501046_0211562 3300049580 Bacteria 1439
262 Ga0501048_0050289 3300049582 Bacteria 2968
263 Ga0501048_0187586 3300049582 Bacteria 1465
264 Ga0501048_0205728 3300049582 Bacteria 1396
265 Ga0501048_0211727 3300049582 Bacteria 1375
266 Ga0501048_0596064 3300049582 Bacteria 793
267 Ga0501067_0263816 3300049583 Bacteria 959
268 Ga0501068_0233897 3300049584 Bacteria 1169
269 Ga0501068_0412820 3300049584 Bacteria 871
270 Ga0501069_0262218 3300049585 Bacteria 1009
271 Ga0501069_0775706 3300049585 Bacteria 580
272 Ga0501070_0964116 3300049586 Bacteria 663
273 Ga0501071_0035128 3300049587 Bacteria 3570
274 Ga0501071_0089909 3300049587 Bacteria 2254
275 Ga0501071_0418411 3300049587 Bacteria 1024
276 Ga0501072_0025029 3300049588 Bacteria 4647
277 Ga0501072_0139359 3300049588 Bacteria 1934
278 Ga0501072_0433678 3300049588 Bacteria 1041
279 Ga0501072_0699787 3300049588 Bacteria 796
280 Ga0501074_0102510 3300049590 Bacteria 2049
281 Ga0501074_0453665 3300049590 Bacteria 909
282 Ga0501074_0986119 3300049590 Bacteria 592
283 Ga0501075_0012553 3300049591 Bacteria 6025
284 Ga0501075_0030071 3300049591 Bacteria 4020
285 Ga0501075_0047640 3300049591 Bacteria 3221
286 Ga0501075_0291057 3300049591 Bacteria 1244
287 Ga0501075_0976200 3300049591 Bacteria 644
288 Ga0501075_1037095 3300049591 Bacteria 623
289 Ga0501076_0032672 3300049592 Bacteria 4062
290 Ga0501076_0224002 3300049592 Bacteria 1537
291 Ga0501076_0420678 3300049592 Bacteria 1099
292 Ga0501076_0569280 3300049592 Bacteria 934
293 Ga0501077_0178960 3300049593 Bacteria 1348
294 Ga0501079_0103208 3300049741 Bacteria 2212
295 Ga0501079_0186087 3300049741 Bacteria 1621
296 Ga0501079_0297638 3300049741 Bacteria 1262
297 Ga0501081_0021639 3300049743 Bacteria 4292
298 Ga0501081_0068716 3300049743 Bacteria 2467
299 Ga0501083_0778072 3300049744 Bacteria 623
300 Ga0501035_0068222 3300049822 Bacteria 3154
301 Ga0501044_0431030 3300049823 Bacteria 1228
302 Ga0501044_0693008 3300049823 Bacteria 905
303 Ga0501045_0089830 3300049824 Bacteria 2269
304 Ga0501045_0313225 3300049824 Bacteria 1168
305 nmdc:mga03683_10386_c1 3300050489 Bacteria 3338
306 nmdc:mga03n38_620159_c1 3300050490 Bacteria 618
307 nmdc:mga03n38_82849_c1 3300050490 Bacteria 1511
308 nmdc:mga00v17_254044_c1 3300050491 Bacteria 1140
309 nmdc:mga00v17_3348_c1 3300050491 Bacteria 8274
310 nmdc:mga00v17_7547_c1 3300050491 Bacteria 5807
311 nmdc:mga0yw44_20712_c1 3300050492 Bacteria 3655
312 nmdc:mga0yw44_2805_c1 3300050492 Bacteria 7550
313 nmdc:mga0yw44_380338_c1 3300050492 Bacteria 953
314 nmdc:mga0yw44_486250_c1 3300050492 Bacteria 837
315 nmdc:mga0yw44_62531_c1 3300050492 Bacteria 2287
316 nmdc:mga0yw44_935776_c1 3300050492 Bacteria 587
317 nmdc:mga06z11_216883_c1 3300050494 Bacteria 1117
318 nmdc:mga06z11_381555_c1 3300050494 Bacteria 847
319 nmdc:mga06z11_565696_c1 3300050494 Bacteria 691
320 nmdc:mga06z11_906510_c1 3300050494 Bacteria 537
321 nmdc:mga07m45_82376_c1 3300050496 Bacteria 1837
322 nmdc:mga07m45_842276_c1 3300050496 Unclassified 525
323 nmdc:mga05p37_390775_c1 3300050507 Bacteria 1627
324 nmdc:mga05p37_45487_c1 3300050507 Bacteria 5398
325 nmdc:mga05p37_753874_c1 3300050507 Bacteria 1072
326 nmdc:mga0qj67_159810_c1 3300050509 Bacteria 1829
327 nmdc:mga06r32_1941760_c1 3300050510 Bacteria 523
328 nmdc:mga08y16_137750_c1 3300050511 Bacteria 2537
329 nmdc:mga08y16_268240_c1 3300050511 Bacteria 1762
330 nmdc:mga0n895_39313_c1 3300050512 Bacteria 4590
331 nmdc:mga0rr50_2834_c1 3300050513 Bacteria 9860
332 nmdc:mga0a205_32995_c1 3300050515 Bacteria 4965
333 nmdc:mga0sz30_168357_c1 3300050516 Bacteria 971
334 Ga0500568_0223681 3300053139 Bacteria 687
335 Ga0501084_0057011 3300054114 Bacteria 3269
336 Ga0501084_0422376 3300054114 Bacteria 1127
337 Ga0501082_0037614 3300060353 Bacteria 4173
338 Ga0501082_0079670 3300060353 Bacteria 2826
339 Ga0501082_1749576 3300060353 Bacteria 542
340 Ga0530510_0008853 3300061734 Bacteria 7045
341 Ga0530510_0023112 3300061734 Bacteria 4428
342 Ga0530510_0091093 3300061734 Bacteria 2225
343 Ga0530510_0175478 3300061734 Bacteria 1588
344 Ga0530510_1285073 3300061734 Bacteria 561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0355147 Ga0451855_0355147_67_363 91
2 3300005330 Ga0070690_101715730 Ga0070690_1017157302 92
3 3300005340 Ga0070689_100656203 Ga0070689_1006562032 92
4 3300005347 Ga0070668_100099544 Ga0070668_1000995442 92
5 3300005355 Ga0070671_101315416 Ga0070671_1013154162 92
6 3300005356 Ga0070674_101923580 Ga0070674_1019235802 92
7 3300005364 Ga0070673_101308817 Ga0070673_1013088172 92
8 3300005441 Ga0070700_100763821 Ga0070700_1007638211 92
9 3300005456 Ga0070678_100156752 Ga0070678_1001567522 92
10 3300005543 Ga0070672_101027240 Ga0070672_1010272402 92
11 3300005564 Ga0070664_101045714 Ga0070664_1010457142 92
12 3300005616 Ga0068852_101477075 Ga0068852_1014770752 92
13 3300005617 Ga0068859_102025141 Ga0068859_1020251412 92
14 3300005719 Ga0068861_100066350 Ga0068861_1000663504 92
15 3300005842 Ga0068858_101697007 Ga0068858_1016970072 92
16 3300005844 Ga0068862_101054766 Ga0068862_1010547662 92
17 3300006038 Ga0075365_10009780 Ga0075365_100097806 92
18 3300006038 Ga0075365_10035247 Ga0075365_100352473 92
19 3300006038 Ga0075365_10086613 Ga0075365_100866134 92
20 3300006042 Ga0075368_10407524 Ga0075368_104075242 92
21 3300006048 Ga0075363_100014415 Ga0075363_1000144155 92
22 3300006048 Ga0075363_100064720 Ga0075363_1000647202 92
23 3300006048 Ga0075363_100965639 Ga0075363_1009656392 92
24 3300006051 Ga0075364_10000990 Ga0075364_1000099011 92
25 3300006051 Ga0075364_10021526 Ga0075364_100215265 92
26 3300006051 Ga0075364_10111348 Ga0075364_101113482 92
27 3300006051 Ga0075364_10345631 Ga0075364_103456312 92
28 3300006051 Ga0075364_10374608 Ga0075364_103746082 92
29 3300006177 Ga0075362_10031850 Ga0075362_100318502 92
30 3300006177 Ga0075362_10718271 Ga0075362_107182711 92
31 3300006178 Ga0075367_10035367 Ga0075367_100353674 92
32 3300006178 Ga0075367_10039556 Ga0075367_100395564 92
33 3300006178 Ga0075367_10212886 Ga0075367_102128861 92
34 3300006178 Ga0075367_10607604 Ga0075367_106076042 92
35 3300006237 Ga0097621_101969464 Ga0097621_1019694642 92
36 3300006353 Ga0075370_10080829 Ga0075370_100808292 92
37 3300006353 Ga0075370_10374155 Ga0075370_103741553 92
38 3300006353 Ga0075370_10412850 Ga0075370_104128503 92
39 3300006931 Ga0097620_102024866 Ga0097620_1020248662 92
40 3300009098 Ga0105245_10331176 Ga0105245_103311763 92
41 3300009147 Ga0114129_11517475 Ga0114129_115174752 92
42 3300009148 Ga0105243_11904992 Ga0105243_119049922 92
43 3300009176 Ga0105242_11940738 Ga0105242_119407382 92
44 3300009176 Ga0105242_12140748 Ga0105242_121407482 92
45 3300009545 Ga0105237_11585488 Ga0105237_115854882 92
46 3300009553 Ga0105249_12005005 Ga0105249_120050051 92
47 3300013296 Ga0157374_12353437 Ga0157374_123534372 92
48 3300013297 Ga0157378_13202471 Ga0157378_132024712 92
49 3300013308 Ga0157375_10415105 Ga0157375_104151052 92
50 3300013308 Ga0157375_10899783 Ga0157375_108997832 92
51 3300013308 Ga0157375_13521923 Ga0157375_135219231 92
52 3300014968 Ga0157379_11229082 Ga0157379_112290821 92
53 3300014969 Ga0157376_11022496 Ga0157376_110224963 92
54 3300014969 Ga0157376_12041131 Ga0157376_120411311 92
55 3300025908 Ga0207643_10344471 Ga0207643_103444712 92
56 3300025926 Ga0207659_10560285 Ga0207659_105602851 92
57 3300025927 Ga0207687_11020099 Ga0207687_110200991 92
58 3300025934 Ga0207686_11768789 Ga0207686_117687891 92
59 3300025937 Ga0207669_11452967 Ga0207669_114529672 92
60 3300025939 Ga0207665_11698976 Ga0207665_116989761 92
61 3300025940 Ga0207691_10563340 Ga0207691_105633402 92
62 3300025961 Ga0207712_10100735 Ga0207712_101007351 92
63 3300025972 Ga0207668_10089214 Ga0207668_100892144 92
64 3300026035 Ga0207703_11013860 Ga0207703_110138602 92
65 3300026075 Ga0207708_11148118 Ga0207708_111481182 92
66 3300026116 Ga0207674_11386771 Ga0207674_113867712 92
67 3300026118 Ga0207675_100007094 Ga0207675_1000070949 92
68 3300026121 Ga0207683_10039352 Ga0207683_100393525 92
69 3300028380 Ga0268265_10159031 Ga0268265_101590313 92
70 3300028786 Ga0307517_10277342 Ga0307517_102773422 92
71 3300031456 Ga0307513_10251220 Ga0307513_102512202 92
72 3300031727 Ga0316576_10106524 Ga0316576_101065242 92
73 3300031727 Ga0316576_10475133 Ga0316576_104751332 92
74 3300035398 Ga0316574_0049111 Ga0316574_0049111_439_717 92
75 3300035398 Ga0316574_0110985 Ga0316574_0110985_1070_1348 92
76 3300035398 Ga0316574_0674244 Ga0316574_0674244_317_595 92
77 3300036647 Ga0316582_0489628 Ga0316582_0489628_252_530 92
78 3300036712 Ga0316584_1008970 Ga0316584_1008970_70_351 92
79 3300041441 Ga0451787_798141 Ga0451787_798141_53_331 92
80 3300041451 Ga0451791_0396519 Ga0451791_0396519_48_326 92
81 3300041451 Ga0451791_0466067 Ga0451791_0466067_1516_1794 92
82 3300041459 Ga0451800_0441588 Ga0451800_0441588_92_370 92
83 3300041463 Ga0451804_0317026 Ga0451804_0317026_60_338 92
84 3300041494 Ga0451837_1157946 Ga0451837_1157946_1754_2032 92
85 3300041498 Ga0451841_0572970 Ga0451841_0572970_292_570 92
86 3300041509 Ga0451843_1329850 Ga0451843_1329850_318_596 92
87 3300042125 Ga0450923_015160 Ga0450923_015160_491_772 92
88 3300042531 Ga0450918_044918 Ga0450918_044918_140_418 92
89 3300042876 Ga0451577_0046641 Ga0451577_0046641_489_767 92
90 3300044712 Ga0453684_0469051 Ga0453684_0469051_68_346 92
91 3300046459 Ga0495629_0327377 Ga0495629_0327377_317_595 92
92 3300046463 Ga0495653_0629784 Ga0495653_0629784_292_570 92
93 3300046683 Ga0495658_0262480 Ga0495658_0262480_417_695 92
94 3300047321 Ga0495676_0558317 Ga0495676_0558317_352_630 92
95 3300048911 Ga0496108_0845082 Ga0496108_0845082_393_671 92
96 3300048912 Ga0496109_1821055 Ga0496109_1821055_164_442 92
97 3300048914 Ga0496111_0268569 Ga0496111_0268569_430_708 92
98 3300048914 Ga0496111_0554182 Ga0496111_0554182_488_766 92
99 3300049568 Ga0501031_0022110 Ga0501031_0022110_1306_1584 92
100 3300049568 Ga0501031_0464827 Ga0501031_0464827_134_412 92
101 3300049570 Ga0501033_0571455 Ga0501033_0571455_386_664 92
102 3300049572 Ga0501036_0030557 Ga0501036_0030557_3683_3961 92
103 3300049572 Ga0501036_0085530 Ga0501036_0085530_612_890 92
104 3300049573 Ga0501037_0291804 Ga0501037_0291804_410_688 92
105 3300049574 Ga0501038_0092521 Ga0501038_0092521_87_365 92
106 3300049575 Ga0501039_0781504 Ga0501039_0781504_157_435 92
107 3300049576 Ga0501040_0006157 Ga0501040_0006157_2626_2904 92
108 3300049576 Ga0501040_0026431 Ga0501040_0026431_3554_3832 92
109 3300049577 Ga0501041_0025694 Ga0501041_0025694_1241_1519 92
110 3300049577 Ga0501041_0269573 Ga0501041_0269573_73_351 92
111 3300049577 Ga0501041_0432542 Ga0501041_0432542_421_699 92
112 3300049578 Ga0501042_0042677 Ga0501042_0042677_1055_1333 92
113 3300049579 Ga0501043_0162325 Ga0501043_0162325_1128_1406 92
114 3300049579 Ga0501043_0599262 Ga0501043_0599262_64_342 92
115 3300049580 Ga0501046_0211562 Ga0501046_0211562_10_288 92
116 3300049582 Ga0501048_0050289 Ga0501048_0050289_2432_2710 92
117 3300049582 Ga0501048_0187586 Ga0501048_0187586_805_1083 92
118 3300049582 Ga0501048_0205728 Ga0501048_0205728_684_962 92
119 3300049583 Ga0501067_0263816 Ga0501067_0263816_195_473 92
120 3300049584 Ga0501068_0233897 Ga0501068_0233897_91_369 92
121 3300049584 Ga0501068_0412820 Ga0501068_0412820_369_647 92
122 3300049585 Ga0501069_0262218 Ga0501069_0262218_188_466 92
123 3300049585 Ga0501069_0775706 Ga0501069_0775706_252_530 92
124 3300049587 Ga0501071_0035128 Ga0501071_0035128_654_932 92
125 3300049588 Ga0501072_0025029 Ga0501072_0025029_2117_2395 92
126 3300049588 Ga0501072_0139359 Ga0501072_0139359_1163_1441 92
127 3300049588 Ga0501072_0433678 Ga0501072_0433678_546_824 92
128 3300049590 Ga0501074_0102510 Ga0501074_0102510_1005_1283 92
129 3300049590 Ga0501074_0453665 Ga0501074_0453665_255_533 92
130 3300049591 Ga0501075_0012553 Ga0501075_0012553_1143_1421 92
131 3300049591 Ga0501075_0030071 Ga0501075_0030071_1691_1969 92
132 3300049591 Ga0501075_0291057 Ga0501075_0291057_747_1025 92
133 3300049592 Ga0501076_0032672 Ga0501076_0032672_2516_2794 92
134 3300049592 Ga0501076_0224002 Ga0501076_0224002_377_655 92
135 3300049593 Ga0501077_0178960 Ga0501077_0178960_241_519 92
136 3300049741 Ga0501079_0186087 Ga0501079_0186087_604_882 92
137 3300049741 Ga0501079_0297638 Ga0501079_0297638_961_1239 92
138 3300049743 Ga0501081_0021639 Ga0501081_0021639_1704_1982 92
139 3300049743 Ga0501081_0068716 Ga0501081_0068716_1515_1793 92
140 3300049822 Ga0501035_0068222 Ga0501035_0068222_594_872 92
141 3300049823 Ga0501044_0431030 Ga0501044_0431030_745_1023 92
142 3300049823 Ga0501044_0693008 Ga0501044_0693008_323_601 92
143 3300049824 Ga0501045_0089830 Ga0501045_0089830_1343_1621 92
144 3300050489 nmdc:mga03683_10386_c1 nmdc:mga03683_10386_c1_1684_1962 92
145 3300050490 nmdc:mga03n38_620159_c1 nmdc:mga03n38_620159_c1_272_550 92
146 3300050490 nmdc:mga03n38_82849_c1 nmdc:mga03n38_82849_c1_69_347 92
147 3300050491 nmdc:mga00v17_254044_c1 nmdc:mga00v17_254044_c1_443_721 92
148 3300050491 nmdc:mga00v17_3348_c1 nmdc:mga00v17_3348_c1_6696_6974 92
149 3300050491 nmdc:mga00v17_7547_c1 nmdc:mga00v17_7547_c1_2682_2960 92
150 3300050492 nmdc:mga0yw44_20712_c1 nmdc:mga0yw44_20712_c1_2987_3265 92
151 3300050492 nmdc:mga0yw44_2805_c1 nmdc:mga0yw44_2805_c1_4873_5151 92
152 3300050492 nmdc:mga0yw44_62531_c1 nmdc:mga0yw44_62531_c1_654_932 92
153 3300050492 nmdc:mga0yw44_935776_c1 nmdc:mga0yw44_935776_c1_29_307 92
154 3300050494 nmdc:mga06z11_216883_c1 nmdc:mga06z11_216883_c1_509_787 92
155 3300050494 nmdc:mga06z11_381555_c1 nmdc:mga06z11_381555_c1_401_679 92
156 3300050494 nmdc:mga06z11_565696_c1 nmdc:mga06z11_565696_c1_126_404 92
157 3300050494 nmdc:mga06z11_906510_c1 nmdc:mga06z11_906510_c1_133_411 92
158 3300050496 nmdc:mga07m45_82376_c1 nmdc:mga07m45_82376_c1_158_436 92
159 3300050496 nmdc:mga07m45_842276_c1 nmdc:mga07m45_842276_c1_220_498 92
160 3300050507 nmdc:mga05p37_753874_c1 nmdc:mga05p37_753874_c1_248_526 92
161 3300050516 nmdc:mga0sz30_168357_c1 nmdc:mga0sz30_168357_c1_639_917 92
162 3300053139 Ga0500568_0223681 Ga0500568_0223681_333_611 92
163 3300054114 Ga0501084_0057011 Ga0501084_0057011_1327_1605 92
164 3300054114 Ga0501084_0422376 Ga0501084_0422376_609_887 92
165 3300060353 Ga0501082_0037614 Ga0501082_0037614_1758_2036 92
166 3300060353 Ga0501082_0079670 Ga0501082_0079670_302_580 92
167 3300060353 Ga0501082_1749576 Ga0501082_1749576_95_373 92
168 3300061734 Ga0530510_0008853 Ga0530510_0008853_1004_1282 92
169 3300061734 Ga0530510_0023112 Ga0530510_0023112_568_846 92
170 3300061734 Ga0530510_0091093 Ga0530510_0091093_1413_1691 92
171 3300061734 Ga0530510_0175478 Ga0530510_0175478_887_1165 92
172 3300005338 Ga0068868_100844995 Ga0068868_1008449951 93
173 3300005354 Ga0070675_102077357 Ga0070675_1020773571 93
174 3300005445 Ga0070708_100211053 Ga0070708_1002110532 93
175 3300005471 Ga0070698_100035183 Ga0070698_1000351833 93
176 3300005518 Ga0070699_100767445 Ga0070699_1007674453 93
177 3300005543 Ga0070672_100302026 Ga0070672_1003020262 93
178 3300005546 Ga0070696_100243309 Ga0070696_1002433092 93
179 3300006038 Ga0075365_10223080 Ga0075365_102230801 93
180 3300006844 Ga0075428_101096833 Ga0075428_1010968333 93
181 3300006852 Ga0075433_10006496 Ga0075433_100064962 93
182 3300006871 Ga0075434_100002675 Ga0075434_10000267512 93
183 3300007076 Ga0075435_100006090 Ga0075435_1000060902 93
184 3300009094 Ga0111539_10151991 Ga0111539_101519912 93
185 3300009098 Ga0105245_13097287 Ga0105245_130972871 93
186 3300009147 Ga0114129_10057124 Ga0114129_100571244 93
187 3300009147 Ga0114129_10407184 Ga0114129_104071842 93
188 3300009147 Ga0114129_11762107 Ga0114129_117621072 93
189 3300009148 Ga0105243_12828123 Ga0105243_128281232 93
190 3300011119 Ga0105246_10470841 Ga0105246_104708412 93
191 3300014326 Ga0157380_12705938 Ga0157380_127059382 93
192 3300025937 Ga0207669_10525731 Ga0207669_105257311 93
193 3300025937 Ga0207669_11520924 Ga0207669_115209241 93
194 3300025940 Ga0207691_10562524 Ga0207691_105625242 93
195 3300026023 Ga0207677_11484770 Ga0207677_114847702 93
196 3300026121 Ga0207683_10504830 Ga0207683_105048301 93
197 3300027907 Ga0207428_10443955 Ga0207428_104439551 93
198 3300031727 Ga0316576_10000682 Ga0316576_1000068212 93
199 3300031728 Ga0316578_10419745 Ga0316578_104197452 93
200 3300036712 Ga0316584_0576219 Ga0316584_0576219_47_331 93
201 3300039437 Ga0436365_1155438 Ga0436365_1155438_182_466 93
202 3300041512 Ga0451853_0769242 Ga0451853_0769242_279_578 93
203 3300047318 Ga0495636_0551402 Ga0495636_0551402_242_535 93
204 3300047322 Ga0495680_0892568 Ga0495680_0892568_149_484 93
205 3300048911 Ga0496108_1541781 Ga0496108_1541781_255_536 93
206 3300048912 Ga0496109_0280945 Ga0496109_0280945_262_600 93
207 3300048914 Ga0496111_0802166 Ga0496111_0802166_96_434 93
208 3300048916 Ga0496113_0255751 Ga0496113_0255751_591_929 93
209 3300048917 Ga0496114_1470558 Ga0496114_1470558_47_385 93
210 3300049568 Ga0501031_0790253 Ga0501031_0790253_27_311 93
211 3300049572 Ga0501036_0409866 Ga0501036_0409866_292_576 93
212 3300049575 Ga0501039_0167069 Ga0501039_0167069_1099_1383 93
213 3300049578 Ga0501042_0378933 Ga0501042_0378933_79_363 93
214 3300049582 Ga0501048_0211727 Ga0501048_0211727_118_402 93
215 3300049586 Ga0501070_0964116 Ga0501070_0964116_226_510 93
216 3300049587 Ga0501071_0418411 Ga0501071_0418411_704_988 93
217 3300049588 Ga0501072_0699787 Ga0501072_0699787_307_591 93
218 3300049591 Ga0501075_0047640 Ga0501075_0047640_576_860 93
219 3300049591 Ga0501075_0976200 Ga0501075_0976200_186_470 93
220 3300049592 Ga0501076_0420678 Ga0501076_0420678_21_305 93
221 3300049741 Ga0501079_0103208 Ga0501079_0103208_703_987 93
222 3300050492 nmdc:mga0yw44_380338_c1 nmdc:mga0yw44_380338_c1_389_670 93
223 3300050492 nmdc:mga0yw44_486250_c1 nmdc:mga0yw44_486250_c1_28_309 93
224 3300050507 nmdc:mga05p37_390775_c1 nmdc:mga05p37_390775_c1_1250_1534 93
225 3300050507 nmdc:mga05p37_45487_c1 nmdc:mga05p37_45487_c1_523_807 93
226 3300050511 nmdc:mga08y16_137750_c1 nmdc:mga08y16_137750_c1_1488_1772 93
227 3300050512 nmdc:mga0n895_39313_c1 nmdc:mga0n895_39313_c1_3624_3908 93
228 3300050513 nmdc:mga0rr50_2834_c1 nmdc:mga0rr50_2834_c1_2359_2643 93
229 3300050515 nmdc:mga0a205_32995_c1 nmdc:mga0a205_32995_c1_1077_1361 93
230 3300061734 Ga0530510_1285073 Ga0530510_1285073_218_502 93
231 3300002155 JGI24033J26618_1054430 JGI24033J26618_10544301 94
232 3300005288 Ga0065714_10172494 Ga0065714_101724942 94
233 3300005290 Ga0065712_10010112 Ga0065712_100101124 94
234 3300005293 Ga0065715_10096259 Ga0065715_100962594 94
235 3300005295 Ga0065707_10002574 Ga0065707_100025744 94
236 3300005331 Ga0070670_100163684 Ga0070670_1001636842 94
237 3300005333 Ga0070677_10084124 Ga0070677_100841243 94
238 3300005338 Ga0068868_100301540 Ga0068868_1003015403 94
239 3300005340 Ga0070689_100674702 Ga0070689_1006747022 94
240 3300005344 Ga0070661_101108215 Ga0070661_1011082151 94
241 3300005347 Ga0070668_100401939 Ga0070668_1004019391 94
242 3300005353 Ga0070669_100135093 Ga0070669_1001350932 94
243 3300005354 Ga0070675_100443877 Ga0070675_1004438771 94
244 3300005355 Ga0070671_100091418 Ga0070671_1000914184 94
245 3300005356 Ga0070674_100317058 Ga0070674_1003170581 94
246 3300005356 Ga0070674_100784410 Ga0070674_1007844102 94
247 3300005365 Ga0070688_100035721 Ga0070688_1000357212 94
248 3300005366 Ga0070659_100158770 Ga0070659_1001587702 94
249 3300005367 Ga0070667_101045297 Ga0070667_1010452972 94
250 3300005440 Ga0070705_100892763 Ga0070705_1008927632 94
251 3300005441 Ga0070700_101089345 Ga0070700_1010893452 94
252 3300005444 Ga0070694_101123119 Ga0070694_1011231192 94
253 3300005456 Ga0070678_101165110 Ga0070678_1011651102 94
254 3300005457 Ga0070662_100830219 Ga0070662_1008302191 94
255 3300005459 Ga0068867_100845390 Ga0068867_1008453901 94
256 3300005466 Ga0070685_10414462 Ga0070685_104144623 94
257 3300005543 Ga0070672_100557257 Ga0070672_1005572572 94
258 3300005544 Ga0070686_100058941 Ga0070686_1000589414 94
259 3300005564 Ga0070664_101004734 Ga0070664_1010047342 94
260 3300005577 Ga0068857_100262982 Ga0068857_1002629822 94
261 3300005578 Ga0068854_100443290 Ga0068854_1004432902 94
262 3300005615 Ga0070702_101569564 Ga0070702_1015695642 94
263 3300005617 Ga0068859_101421047 Ga0068859_1014210472 94
264 3300005618 Ga0068864_100269257 Ga0068864_1002692572 94
265 3300005719 Ga0068861_100028314 Ga0068861_1000283143 94
266 3300005840 Ga0068870_10025250 Ga0068870_100252503 94
267 3300005840 Ga0068870_10094150 Ga0068870_100941502 94
268 3300005840 Ga0068870_10290970 Ga0068870_102909703 94
269 3300005841 Ga0068863_100500232 Ga0068863_1005002322 94
270 3300005844 Ga0068862_100662553 Ga0068862_1006625532 94
271 3300006237 Ga0097621_101755504 Ga0097621_1017555042 94
272 3300006358 Ga0068871_102344673 Ga0068871_1023446732 94
273 3300006846 Ga0075430_100133923 Ga0075430_1001339232 94
274 3300006847 Ga0075431_101204046 Ga0075431_1012040462 94
275 3300006881 Ga0068865_100472556 Ga0068865_1004725562 94
276 3300006931 Ga0097620_101420946 Ga0097620_1014209462 94
277 3300009094 Ga0111539_10614843 Ga0111539_106148432 94
278 3300009094 Ga0111539_11620626 Ga0111539_116206262 94
279 3300009094 Ga0111539_12664861 Ga0111539_126648611 94
280 3300009148 Ga0105243_12229974 Ga0105243_122299742 94
281 3300009176 Ga0105242_11509831 Ga0105242_115098312 94
282 3300009553 Ga0105249_10273608 Ga0105249_102736082 94
283 3300011119 Ga0105246_10809764 Ga0105246_108097642 94
284 3300013297 Ga0157378_12871656 Ga0157378_128716562 94
285 3300013308 Ga0157375_10086125 Ga0157375_100861253 94
286 3300014325 Ga0163163_11475272 Ga0163163_114752721 94
287 3300014326 Ga0157380_10138274 Ga0157380_101382743 94
288 3300017792 Ga0163161_10060316 Ga0163161_100603163 94
289 3300017792 Ga0163161_11009477 Ga0163161_110094772 94
290 3300025893 Ga0207682_10028783 Ga0207682_100287832 94
291 3300025899 Ga0207642_10074994 Ga0207642_100749943 94
292 3300025901 Ga0207688_10161511 Ga0207688_101615112 94
293 3300025907 Ga0207645_10293012 Ga0207645_102930121 94
294 3300025907 Ga0207645_10351651 Ga0207645_103516512 94
295 3300025908 Ga0207643_10034149 Ga0207643_100341492 94
296 3300025923 Ga0207681_10114656 Ga0207681_101146563 94
297 3300025925 Ga0207650_10036319 Ga0207650_100363193 94
298 3300025926 Ga0207659_10054580 Ga0207659_100545803 94
299 3300025926 Ga0207659_10104915 Ga0207659_101049151 94
300 3300025927 Ga0207687_11128434 Ga0207687_111284342 94
301 3300025931 Ga0207644_10635324 Ga0207644_106353243 94
302 3300025932 Ga0207690_10315371 Ga0207690_103153712 94
303 3300025932 Ga0207690_10475561 Ga0207690_104755613 94
304 3300025933 Ga0207706_10033809 Ga0207706_100338095 94
305 3300025933 Ga0207706_10843132 Ga0207706_108431321 94
306 3300025936 Ga0207670_10915078 Ga0207670_109150782 94
307 3300025937 Ga0207669_10039937 Ga0207669_100399373 94
308 3300025937 Ga0207669_10781756 Ga0207669_107817562 94
309 3300025938 Ga0207704_10298529 Ga0207704_102985293 94
310 3300025940 Ga0207691_10040746 Ga0207691_100407463 94
311 3300025942 Ga0207689_10019405 Ga0207689_100194056 94
312 3300025945 Ga0207679_11728688 Ga0207679_117286882 94
313 3300025960 Ga0207651_10413027 Ga0207651_104130272 94
314 3300025961 Ga0207712_10542420 Ga0207712_105424202 94
315 3300025972 Ga0207668_10064662 Ga0207668_100646623 94
316 3300025986 Ga0207658_11182103 Ga0207658_111821031 94
317 3300026067 Ga0207678_11791457 Ga0207678_117914572 94
318 3300026075 Ga0207708_10040186 Ga0207708_100401862 94
319 3300026088 Ga0207641_10490413 Ga0207641_104904132 94
320 3300026089 Ga0207648_10676617 Ga0207648_106766173 94
321 3300026095 Ga0207676_10409070 Ga0207676_104090702 94
322 3300026116 Ga0207674_10174137 Ga0207674_101741372 94
323 3300026121 Ga0207683_10076922 Ga0207683_100769223 94
324 3300028380 Ga0268265_10045424 Ga0268265_100454242 94
325 3300031548 Ga0307408_100263838 Ga0307408_1002638383 94
326 3300046455 Ga0495603_0254074 Ga0495603_0254074_326_610 94
327 3300046558 Ga0495633_0283316 Ga0495633_0283316_336_620 94
328 3300046615 Ga0495656_0607667 Ga0495656_0607667_231_515 94
329 3300046691 Ga0495670_0203885 Ga0495670_0203885_223_507 94
330 3300049568 Ga0501031_0252476 Ga0501031_0252476_271_564 94
331 3300049572 Ga0501036_0390504 Ga0501036_0390504_456_749 94
332 3300049573 Ga0501037_0623302 Ga0501037_0623302_309_602 94
333 3300049578 Ga0501042_0808867 Ga0501042_0808867_322_615 94
334 3300049579 Ga0501043_0916631 Ga0501043_0916631_34_327 94
335 3300049582 Ga0501048_0596064 Ga0501048_0596064_225_518 94
336 3300049587 Ga0501071_0089909 Ga0501071_0089909_616_909 94
337 3300049590 Ga0501074_0986119 Ga0501074_0986119_29_322 94
338 3300049591 Ga0501075_1037095 Ga0501075_1037095_150_443 94
339 3300049592 Ga0501076_0569280 Ga0501076_0569280_386_679 94
340 3300049744 Ga0501083_0778072 Ga0501083_0778072_43_336 94
341 3300049824 Ga0501045_0313225 Ga0501045_0313225_369_662 94
342 3300050509 nmdc:mga0qj67_159810_c1 nmdc:mga0qj67_159810_c1_181_465 94
343 3300050510 nmdc:mga06r32_1941760_c1 nmdc:mga06r32_1941760_c1_150_434 94
344 3300050511 nmdc:mga08y16_268240_c1 nmdc:mga08y16_268240_c1_797_1081 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24696

27

115

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xty-assembly1.cif.gz_E cryoem structure of human cmg bound to and-1 (cmga) 0.8639 30 67
2iob-assembly1.cif.gz_A e. coli bifunctional glutathionylspermidine synthetase/amidase apo protein 0.8294 32 65
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.7849 30 88
3ipc-assembly1.cif.gz_A structure of atu2422-gaba f77a mutant receptor in complex with leucine 0.7846 30 88
3hut-assembly1.cif.gz_A crystal structure of a putative branched-chain amino acid abc transporter from rhodospirillum rubrum 0.7835 29 93
ID Description Score Start End Superfamily
af_P9WIT7_5_140_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.7967 30 65 3.40.50.1370
3hutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7872 29 90 3.40.50.2300
3ipcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7846 30 88 3.40.50.2300
3lkbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7823 30 90 3.40.50.2300
5f56A02 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core); 0.782 30 94 3.90.1640.30
ID Description Score Start End GO Terms
AF-A0A381ZZW8-F1-model_v4 Uncharacterized protein 0.8965 31 94
AF-A0A7X3X3E9-F1-model_v4 Uncharacterized protein 0.8831 16 94
AF-A0A382FJ24-F1-model_v4 Uncharacterized protein 0.8759 22 94
AF-A0A7X3X3E9-F1-model_v4 Uncharacterized protein 0.873 16 94
AF-A0A2E7RAI4-F1-model_v4 Uncharacterized protein 0.8651 8 94

Feature Viewer

pLDDT pTM Quality
82.36 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map