F415985

General Info

Members Datasets Scaffolds Average Seq Length
344 223 688 207

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10322290|Ga0207647_103222901
Length 239
Sequence VIIGVALFEGAEELDWAGPWEVLAAWSKQWPDDGVRVLTLASEAGTITCAKGLQVVPEETWESAPPLDVLVYPGGRGTRRELADEAVLDWIRGLAGGGTVVASVCTGSLVLAAAGLLDGKPATTHWQSLEVLPTLGREIEVRPDDRYVDNGNVLTAAGVSAGIDMALHLVGVEAGPVVAQGVQLGIEYDPQPPFRAGSPETAPAHVVEGLRARMRARMDRDAATAGQRRRSGFARPEAT

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2643221647 Streptomyces sp. Root369 Isolate Unclassified
218 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
219 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
220 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
221 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
222 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
223 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0.58
Rhizoplane 9.3
Rhizosphere 84.88
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10322290 3300025904 Bacteria 877
2 JGI25406J46586_10002050 3300003203 Bacteria 9510
3 Ga0070676_10167497 3300005328 Bacteria 1419
4 Ga0070683_100137599 3300005329 Bacteria 2313
5 Ga0070683_100187439 3300005329 Bacteria 1964
6 Ga0070683_100713227 3300005329 Bacteria 961
7 Ga0070666_10338803 3300005335 Bacteria 1075
8 Ga0070680_100139746 3300005336 Bacteria 2030
9 Ga0070682_100008911 3300005337 Bacteria 5666
10 Ga0070668_100026089 3300005347 Bacteria 4432
11 Ga0070674_100021499 3300005356 Bacteria 4144
12 Ga0070673_100125675 3300005364 Bacteria 2145
13 Ga0070659_100023030 3300005366 Bacteria 4762
14 Ga0070709_10003358 3300005434 Bacteria 8604
15 Ga0070713_100000055 3300005436 Bacteria 70759
16 Ga0070713_100000878 3300005436 Bacteria 19274
17 Ga0070713_100047114 3300005436 Bacteria 3541
18 Ga0070713_100333497 3300005436 Bacteria 1404
19 Ga0070700_100287510 3300005441 Bacteria 1195
20 Ga0070694_100091318 3300005444 Bacteria 2137
21 Ga0070678_100038972 3300005456 Bacteria 3349
22 Ga0070662_100033588 3300005457 Bacteria 3613
23 Ga0070706_100050263 3300005467 Bacteria 3847
24 Ga0070706_100056650 3300005467 Bacteria 3616
25 Ga0070707_100352316 3300005468 Bacteria 1430
26 Ga0070699_100045837 3300005518 Bacteria 3783
27 Ga0070679_100290386 3300005530 Bacteria 1587
28 Ga0070697_100453643 3300005536 Bacteria 1117
29 Ga0070672_100438698 3300005543 Bacteria 1123
30 Ga0070686_100023820 3300005544 Bacteria 3664
31 Ga0070695_100242266 3300005545 Bacteria 1309
32 Ga0070693_100041152 3300005547 Bacteria 2598
33 Ga0070704_100030209 3300005549 Bacteria 3629
34 Ga0068855_100087185 3300005563 Bacteria 3608
35 Ga0070664_100167499 3300005564 Bacteria 1947
36 Ga0068854_100142523 3300005578 Bacteria 1840
37 Ga0068852_100202302 3300005616 Bacteria 1880
38 Ga0068859_100317003 3300005617 Bacteria 1653
39 Ga0068864_100241837 3300005618 Bacteria 1673
40 Ga0068866_10117642 3300005718 Bacteria 1493
41 Ga0068870_10276586 3300005840 Bacteria 1051
42 Ga0068860_100321588 3300005843 Bacteria 1519
43 Ga0068862_100194040 3300005844 Bacteria 1828
44 Ga0081455_10012539 3300005937 Bacteria 8457
45 Ga0081455_10040985 3300005937 Bacteria 4079
46 Ga0081455_10230382 3300005937 Bacteria 1367
47 Ga0081538_10005699 3300005981 Bacteria 11139
48 Ga0081539_10000645 3300005985 Bacteria 70301
49 Ga0075363_100016952 3300006048 Bacteria 3605
50 Ga0075363_100202000 3300006048 Bacteria 1136
51 Ga0075364_10208519 3300006051 Bacteria 1325
52 Ga0070716_100031316 3300006173 Bacteria 2892
53 Ga0070712_101054748 3300006175 Bacteria 704
54 Ga0075428_100054474 3300006844 Bacteria 4383
55 Ga0075428_100219089 3300006844 Bacteria 2055
56 Ga0075430_100109858 3300006846 Bacteria 2300
57 Ga0075430_100143356 3300006846 Unclassified 1989
58 Ga0075431_100014659 3300006847 Bacteria 7931
59 Ga0075431_100048073 3300006847 Bacteria 4400
60 Ga0075431_100222676 3300006847 Bacteria 1924
61 Ga0075433_10001932 3300006852 Bacteria 15583
62 Ga0075433_10597834 3300006852 Bacteria 969
63 Ga0075434_100104669 3300006871 Bacteria 2840
64 Ga0075434_100213787 3300006871 Bacteria 1948
65 Ga0075429_100030736 3300006880 Bacteria 4665
66 Ga0068865_100299504 3300006881 Bacteria 1286
67 Ga0097620_100317039 3300006931 Bacteria 1653
68 Ga0099826_10225542 3300006948 Bacteria 1006
69 Ga0075435_100037890 3300007076 Bacteria 3842
70 Ga0075435_100436232 3300007076 Bacteria 1129
71 Ga0105240_10730656 3300009093 Bacteria 1078
72 Ga0111539_10002147 3300009094 Bacteria 26379
73 Ga0111539_10474214 3300009094 Bacteria 1457
74 Ga0111539_10690060 3300009094 Bacteria 1189
75 Ga0105245_10029219 3300009098 Bacteria 4869
76 Ga0105245_10553656 3300009098 Bacteria 1172
77 Ga0114129_10112611 3300009147 Bacteria 3752
78 Ga0114129_10332153 3300009147 Bacteria 2018
79 Ga0114129_10639563 3300009147 Bacteria 1374
80 Ga0114129_10769133 3300009147 Bacteria 1231
81 Ga0114129_11748897 3300009147 Bacteria 757
82 Ga0105243_10098894 3300009148 Bacteria 2418
83 Ga0105243_10152912 3300009148 Bacteria 1981
84 Ga0105243_10266490 3300009148 Bacteria 1536
85 Ga0105243_10466065 3300009148 Bacteria 1189
86 Ga0105241_10461205 3300009174 Bacteria 1126
87 Ga0105242_10054994 3300009176 Bacteria 3256
88 Ga0105242_10406195 3300009176 Bacteria 1272
89 Ga0105249_10289991 3300009553 Bacteria 1637
90 Ga0105239_10672453 3300010375 Bacteria 1183
91 Ga0105239_11081432 3300010375 Bacteria 923
92 Ga0105246_10761846 3300011119 Bacteria 855
93 Ga0157369_10030238 3300013105 Bacteria 5974
94 Ga0157374_10510246 3300013296 Bacteria 1208
95 Ga0157378_10455708 3300013297 Bacteria 1270
96 Ga0157372_11246649 3300013307 Bacteria 859
97 Ga0163163_10023423 3300014325 Bacteria 5861
98 Ga0157376_10247068 3300014969 Bacteria 1665
99 Ga0213876_10066531 3300021384 Bacteria 1902
100 Ga0207692_10279967 3300025898 Bacteria 1009
101 Ga0207685_10134447 3300025905 Bacteria 1102
102 Ga0207699_10000334 3300025906 Bacteria 24992
103 Ga0207645_10203180 3300025907 Bacteria 1304
104 Ga0207684_10026875 3300025910 Bacteria 4908
105 Ga0207693_10047137 3300025915 Bacteria 3387
106 Ga0207663_10036507 3300025916 Bacteria 2957
107 Ga0207663_10063209 3300025916 Bacteria 2356
108 Ga0207663_10258717 3300025916 Bacteria 1284
109 Ga0207662_10025667 3300025918 Bacteria 3394
110 Ga0207662_10208837 3300025918 Bacteria 1267
111 Ga0207657_10041341 3300025919 Bacteria 4077
112 Ga0207646_10111773 3300025922 Bacteria 2452
113 Ga0207646_10466521 3300025922 Bacteria 1139
114 Ga0207687_10146718 3300025927 Bacteria 1796
115 Ga0207687_10261501 3300025927 Bacteria 1380
116 Ga0207700_10000009 3300025928 Bacteria 314953
117 Ga0207700_10001320 3300025928 Bacteria 14082
118 Ga0207700_10242008 3300025928 Bacteria 1538
119 Ga0207664_10087110 3300025929 Bacteria 2552
120 Ga0207664_10145817 3300025929 Bacteria 2007
121 Ga0207686_10159599 3300025934 Bacteria 1579
122 Ga0207709_10308773 3300025935 Bacteria 1179
123 Ga0207665_10022073 3300025939 Bacteria 4185
124 Ga0207665_10156534 3300025939 Bacteria 1636
125 Ga0207691_10030653 3300025940 Bacteria 5023
126 Ga0207661_10431206 3300025944 Bacteria 1198
127 Ga0207667_10453980 3300025949 Bacteria 1302
128 Ga0207651_11029015 3300025960 Bacteria 737
129 Ga0207640_10172530 3300025981 Bacteria 1613
130 Ga0207677_10975671 3300026023 Bacteria 767
131 Ga0207678_10052570 3300026067 Bacteria 3513
132 Ga0207702_10002729 3300026078 Bacteria 16549
133 Ga0207702_10021685 3300026078 Bacteria 5319
134 Ga0207648_10027601 3300026089 Bacteria 5039
135 Ga0207676_10281700 3300026095 Bacteria 1510
136 Ga0207675_100096668 3300026118 Bacteria 2781
137 Ga0207675_100359681 3300026118 Bacteria 1428
138 Ga0207683_10117687 3300026121 Bacteria 2383
139 Ga0207683_10295063 3300026121 Bacteria 1483
140 Ga0207428_10050352 3300027907 Bacteria 3333
141 Ga0268264_10316767 3300028381 Bacteria 1474
142 Ga0268264_10488053 3300028381 Bacteria 1199
143 Ga0307516_10477362 3300031730 Bacteria 902
144 Ga0307416_100355273 3300032002 Bacteria 1485
145 Ga0307415_100123089 3300032126 Bacteria 1949
146 Ga0373938_0010439 3300034957 Bacteria 1708
147 Ga0373941_0160737 3300035115 Bacteria 831
148 Ga0373941_0195752 3300035115 Bacteria 766
149 Ga0373960_0013434 3300035121 Bacteria 2055
150 Ga0373942_0038736 3300035207 Bacteria 1294
151 Ga0316574_0325442 3300035398 Bacteria 975
152 Ga0373935_0318321 3300035692 Bacteria 1103
153 Ga0373947_0145924 3300035725 Bacteria 1521
154 Ga0395898_0134443 3300037466 Bacteria 2368
155 Ga0395901_0227586 3300038443 Bacteria 1948
156 Ga0395901_0387368 3300038443 Bacteria 1438
157 Ga0436365_0037749 3300039437 Bacteria 2463
158 Ga0436361_0095039 3300039447 Bacteria 1504
159 Ga0436363_0982464 3300039450 Bacteria 1339
160 Ga0436363_1471005 3300039450 Bacteria 1069
161 Ga0451791_0068502 3300041451 Bacteria 701
162 Ga0451843_0844740 3300041509 Bacteria 1509
163 Ga0439458_0012562 3300042157 Bacteria 1902
164 Ga0439458_0026091 3300042157 Bacteria 1373
165 Ga0450893_0039540 3300042532 Bacteria 861
166 Ga0466963_0143963 3300044694 Bacteria 1653
167 Ga0466964_0007824 3300044706 Bacteria 4001
168 Ga0466958_0015126 3300045836 Bacteria 4416
169 Ga0466967_0012952 3300045976 Bacteria 6415
170 Ga0495629_0066133 3300046459 Bacteria 2523
171 Ga0495653_0165821 3300046463 Bacteria 1529
172 Ga0495605_0366258 3300046474 Bacteria 603
173 Ga0495584_0153687 3300046491 Bacteria 1169
174 Ga0495594_0380215 3300046499 Bacteria 804
175 Ga0495596_0018925 3300046500 Bacteria 2835
176 Ga0495596_0191069 3300046500 Bacteria 796
177 Ga0495607_0114148 3300046501 Bacteria 1428
178 Ga0495608_0011746 3300046511 Bacteria 6091
179 Ga0495618_0089797 3300046514 Bacteria 1965
180 Ga0495630_0036493 3300046517 Bacteria 3675
181 Ga0495631_0128750 3300046518 Bacteria 1088
182 Ga0495644_0004420 3300046523 Bacteria 5521
183 Ga0495642_0047590 3300046528 Bacteria 1757
184 Ga0495652_0387724 3300046529 Bacteria 992
185 Ga0495640_0123812 3300046533 Bacteria 1678
186 Ga0495597_0153918 3300046542 Bacteria 942
187 Ga0495656_0080211 3300046615 Bacteria 1471
188 Ga0495668_0206721 3300046616 Bacteria 1075
189 Ga0495634_0000379 3300046642 Bacteria 43465
190 Ga0495625_0273634 3300046660 Bacteria 1089
191 Ga0495659_0072320 3300046664 Bacteria 1294
192 Ga0495661_0182998 3300046665 Bacteria 1109
193 Ga0495599_0352786 3300046678 Bacteria 882
194 Ga0495613_0007161 3300046689 Bacteria 8307
195 Ga0495613_0128441 3300046689 Bacteria 1816
196 Ga0495670_0176646 3300046691 Bacteria 1126
197 Ga0495670_0351142 3300046691 Bacteria 794
198 Ga0495649_0040944 3300046694 Bacteria 2535
199 Ga0495676_0093857 3300047321 Bacteria 2237
200 Ga0495683_0109144 3300047323 Bacteria 1323
201 Ga0495687_065392 3300047443 Bacteria 1481
202 Ga0495685_102508 3300047447 Bacteria 944
203 Ga0495673_0002430 3300047469 Bacteria 13118
204 Ga0495681_0035366 3300047470 Bacteria 2481
205 Ga0495684_0182231 3300047471 Bacteria 1556
206 Ga0495686_0020173 3300047472 Bacteria 4447
207 Ga0496100_0216859 3300048903 Bacteria 1402
208 Ga0496101_0026259 3300048904 Bacteria 4048
209 Ga0496101_0386369 3300048904 Bacteria 1101
210 Ga0496102_0042251 3300048905 Bacteria 4131
211 Ga0496102_0158111 3300048905 Bacteria 2131
212 Ga0496102_0337509 3300048905 Bacteria 1419
213 Ga0496104_0002196 3300048907 Bacteria 16893
214 Ga0496104_0115850 3300048907 Bacteria 2571
215 Ga0496105_0000283 3300048908 Bacteria 33429
216 Ga0496105_0104899 3300048908 Bacteria 2333
217 Ga0496106_0262552 3300048909 Bacteria 1382
218 Ga0496106_0478867 3300048909 Bacteria 1000
219 Ga0496107_0123250 3300048910 Bacteria 1910
220 Ga0496108_0002220 3300048911 Bacteria 15544
221 Ga0496108_0320755 3300048911 Bacteria 1351
222 Ga0496108_0591136 3300048911 Bacteria 967
223 Ga0496109_0000785 3300048912 Bacteria 26419
224 Ga0496109_0316617 3300048912 Bacteria 1472
225 Ga0496109_0690685 3300048912 Bacteria 958
226 Ga0496110_0000555 3300048913 Bacteria 25491
227 Ga0496110_0003936 3300048913 Bacteria 11429
228 Ga0496111_0000703 3300048914 Bacteria 17719
229 Ga0496111_0008947 3300048914 Bacteria 6660
230 Ga0496112_0000415 3300048915 Bacteria 28101
231 Ga0496112_0008487 3300048915 Bacteria 9208
232 Ga0496112_0031095 3300048915 Bacteria 5174
233 Ga0496113_0000335 3300048916 Bacteria 22374
234 Ga0496114_0192123 3300048917 Bacteria 1786
235 Ga0496114_1121961 3300048917 Bacteria 672
236 Ga0496115_0002620 3300048918 Bacteria 12908
237 Ga0496115_0183286 3300048918 Bacteria 1730
238 Ga0501031_0334109 3300049568 Bacteria 981
239 Ga0501032_0009056 3300049569 Bacteria 7232
240 Ga0501034_0000495 3300049571 Bacteria 63904
241 Ga0501034_0001234 3300049571 Bacteria 34758
242 Ga0501034_0074617 3300049571 Bacteria 3399
243 Ga0501034_0184961 3300049571 Bacteria 2047
244 Ga0501034_0237573 3300049571 Bacteria 1769
245 Ga0501034_0305123 3300049571 Bacteria 1528
246 Ga0501036_0190231 3300049572 Bacteria 1727
247 Ga0501036_0323592 3300049572 Bacteria 1288
248 Ga0501036_0756089 3300049572 Bacteria 802
249 Ga0501037_0020963 3300049573 Bacteria 4828
250 Ga0501037_0050663 3300049573 Bacteria 3038
251 Ga0501038_0001995 3300049574 Bacteria 18851
252 Ga0501038_0051735 3300049574 Bacteria 3543
253 Ga0501038_0113354 3300049574 Bacteria 2244
254 Ga0501043_0027945 3300049579 Bacteria 4428
255 Ga0501043_0048384 3300049579 Bacteria 3343
256 Ga0501043_0195886 3300049579 Bacteria 1570
257 Ga0501043_0748440 3300049579 Bacteria 711
258 Ga0501047_0051391 3300049581 Bacteria 3982
259 Ga0501047_0164172 3300049581 Bacteria 2092
260 Ga0501047_0265283 3300049581 Bacteria 1564
261 Ga0501048_0045691 3300049582 Bacteria 3128
262 Ga0501048_0086872 3300049582 Bacteria 2206
263 Ga0501048_0672074 3300049582 Bacteria 744
264 Ga0501067_0055024 3300049583 Bacteria 2205
265 Ga0501067_0123207 3300049583 Bacteria 1443
266 Ga0501068_0001477 3300049584 Bacteria 12509
267 Ga0501068_0011355 3300049584 Bacteria 5025
268 Ga0501068_0065823 3300049584 Bacteria 2207
269 Ga0501069_0002747 3300049585 Bacteria 8992
270 Ga0501069_0112585 3300049585 Bacteria 1551
271 Ga0501070_0001421 3300049586 Bacteria 21443
272 Ga0501070_0028406 3300049586 Bacteria 4691
273 Ga0501070_0047198 3300049586 Bacteria 3580
274 Ga0501070_0444393 3300049586 Bacteria 1046
275 Ga0501072_0024714 3300049588 Bacteria 4676
276 Ga0501072_0141910 3300049588 Bacteria 1915
277 Ga0501072_0375935 3300049588 Bacteria 1127
278 Ga0501073_0002311 3300049589 Bacteria 14266
279 Ga0501073_0014290 3300049589 Bacteria 5766
280 Ga0501074_0053719 3300049590 Bacteria 2905
281 Ga0501074_0076446 3300049590 Bacteria 2403
282 Ga0501074_0084663 3300049590 Bacteria 2273
283 Ga0501074_0242298 3300049590 Bacteria 1282
284 Ga0501075_0052790 3300049591 Bacteria 3057
285 Ga0501075_0641748 3300049591 Bacteria 810
286 Ga0501076_0104734 3300049592 Bacteria 2283
287 Ga0501079_0033225 3300049741 Bacteria 3968
288 Ga0501079_0083152 3300049741 Bacteria 2476
289 Ga0501080_0003976 3300049742 Bacteria 13088
290 Ga0501080_0014285 3300049742 Bacteria 7313
291 Ga0501080_0021701 3300049742 Bacteria 5946
292 Ga0501080_0102265 3300049742 Bacteria 2658
293 Ga0501080_0105553 3300049742 Bacteria 2612
294 Ga0501080_0193906 3300049742 Bacteria 1866
295 Ga0501081_0059069 3300049743 Bacteria 2654
296 Ga0501083_0004698 3300049744 Bacteria 9646
297 Ga0501083_0064259 3300049744 Bacteria 2446
298 Ga0501083_0099507 3300049744 Bacteria 1918
299 Ga0501035_0038204 3300049822 Bacteria 4347
300 Ga0501035_0207112 3300049822 Bacteria 1679
301 Ga0501044_0046621 3300049823 Bacteria 4486
302 Ga0501044_0080985 3300049823 Bacteria 3287
303 Ga0501044_0202740 3300049823 Bacteria 1941
304 Ga0501045_0098031 3300049824 Bacteria 2169
305 nmdc:mga03n38_174464_c1 3300050490 Bacteria 1097
306 nmdc:mga03n38_68248_c2 3300050490 Bacteria 1257
307 nmdc:mga0yw44_247273_c1 3300050492 Bacteria 1186
308 nmdc:mga05p37_243470_c1 3300050507 Bacteria 2161
309 nmdc:mga05p37_397187_c1 3300050507 Bacteria 1611
310 nmdc:mga05p37_78588_c1 3300050507 Bacteria 4063
311 nmdc:mga09592_103973_c1 3300050508 Bacteria 2434
312 nmdc:mga09592_624835_c1 3300050508 Bacteria 921
313 nmdc:mga0qj67_84391_c1 3300050509 Bacteria 2547
314 nmdc:mga06r32_354900_c1 3300050510 Bacteria 1451
315 nmdc:mga08y16_1473831_c1 3300050511 Bacteria 642
316 nmdc:mga08y16_49593_c1 3300050511 Bacteria 4394
317 nmdc:mga08y16_655419_c1 3300050511 Bacteria 1053
318 nmdc:mga0rr50_255076_c1 3300050513 Unclassified 1458
319 nmdc:mga0rr50_523093_c1 3300050513 Bacteria 1009
320 nmdc:mga08x19_12509_c1 3300050514 Bacteria 5115
321 nmdc:mga0a205_388110_c1 3300050515 Bacteria 1261
322 nmdc:mga0a205_5636_c1 3300050515 Bacteria 11281
323 Ga0495655_0008240 3300053083 Bacteria 1972
324 Ga0495595_0033037 3300053084 Bacteria 2333
325 Ga0500641_0016052 3300053096 Bacteria 2785
326 Ga0500628_048109 3300053129 Bacteria 1002
327 Ga0500568_0000094 3300053139 Bacteria 83123
328 Ga0501084_0000834 3300054114 Bacteria 23762
329 Ga0501084_0115870 3300054114 Bacteria 2252
330 Ga0501084_0644371 3300054114 Bacteria 894
331 Ga0501082_0093667 3300060353 Bacteria 2596
332 Ga0501082_0361100 3300060353 Bacteria 1267
333 Ga0530510_0014621 3300061734 Bacteria 5540
334 Ga0530510_0101248 3300061734 Bacteria 2106
335 Ga0530510_0256014 3300061734 Bacteria 1305
336 Ga0530510_0471809 3300061734 Bacteria 950
337 Ga0530510_0576415 3300061734 Bacteria 855
338 2644263821 2643221647 Bacteria 10741251
339 2785373143 2784746768 Bacteria 10036182
340 2808914982 2808606375 Bacteria 9466072
341 2954382539 2954380949 Bacteria 10050426
342 2954693340 2954691527 Bacteria 10720516
343 2954708433 2954701450 Bacteria 10834262
344 8055159609 8055157932 Bacteria 6429399
345 Ga0207647_10322290
346 JGI25406J46586_10002050
347 Ga0070676_10167497
348 Ga0070683_100137599
349 Ga0070683_100187439
350 Ga0070683_100713227
351 Ga0070666_10338803
352 Ga0070680_100139746
353 Ga0070682_100008911
354 Ga0070668_100026089
355 Ga0070674_100021499
356 Ga0070673_100125675
357 Ga0070659_100023030
358 Ga0070709_10003358
359 Ga0070713_100000055
360 Ga0070713_100000878
361 Ga0070713_100047114
362 Ga0070713_100333497
363 Ga0070700_100287510
364 Ga0070694_100091318
365 Ga0070678_100038972
366 Ga0070662_100033588
367 Ga0070706_100050263
368 Ga0070706_100056650
369 Ga0070707_100352316
370 Ga0070699_100045837
371 Ga0070679_100290386
372 Ga0070697_100453643
373 Ga0070672_100438698
374 Ga0070686_100023820
375 Ga0070695_100242266
376 Ga0070693_100041152
377 Ga0070704_100030209
378 Ga0068855_100087185
379 Ga0070664_100167499
380 Ga0068854_100142523
381 Ga0068852_100202302
382 Ga0068859_100317003
383 Ga0068864_100241837
384 Ga0068866_10117642
385 Ga0068870_10276586
386 Ga0068860_100321588
387 Ga0068862_100194040
388 Ga0081455_10012539
389 Ga0081455_10040985
390 Ga0081455_10230382
391 Ga0081538_10005699
392 Ga0081539_10000645
393 Ga0075363_100016952
394 Ga0075363_100202000
395 Ga0075364_10208519
396 Ga0070716_100031316
397 Ga0070712_101054748
398 Ga0075428_100054474
399 Ga0075428_100219089
400 Ga0075430_100109858
401 Ga0075430_100143356
402 Ga0075431_100014659
403 Ga0075431_100048073
404 Ga0075431_100222676
405 Ga0075433_10001932
406 Ga0075433_10597834
407 Ga0075434_100104669
408 Ga0075434_100213787
409 Ga0075429_100030736
410 Ga0068865_100299504
411 Ga0097620_100317039
412 Ga0099826_10225542
413 Ga0075435_100037890
414 Ga0075435_100436232
415 Ga0105240_10730656
416 Ga0111539_10002147
417 Ga0111539_10474214
418 Ga0111539_10690060
419 Ga0105245_10029219
420 Ga0105245_10553656
421 Ga0114129_10112611
422 Ga0114129_10332153
423 Ga0114129_10639563
424 Ga0114129_10769133
425 Ga0114129_11748897
426 Ga0105243_10098894
427 Ga0105243_10152912
428 Ga0105243_10266490
429 Ga0105243_10466065
430 Ga0105241_10461205
431 Ga0105242_10054994
432 Ga0105242_10406195
433 Ga0105249_10289991
434 Ga0105239_10672453
435 Ga0105239_11081432
436 Ga0105246_10761846
437 Ga0157369_10030238
438 Ga0157374_10510246
439 Ga0157378_10455708
440 Ga0157372_11246649
441 Ga0163163_10023423
442 Ga0157376_10247068
443 Ga0213876_10066531
444 Ga0207692_10279967
445 Ga0207685_10134447
446 Ga0207699_10000334
447 Ga0207645_10203180
448 Ga0207684_10026875
449 Ga0207693_10047137
450 Ga0207663_10036507
451 Ga0207663_10063209
452 Ga0207663_10258717
453 Ga0207662_10025667
454 Ga0207662_10208837
455 Ga0207657_10041341
456 Ga0207646_10111773
457 Ga0207646_10466521
458 Ga0207687_10146718
459 Ga0207687_10261501
460 Ga0207700_10000009
461 Ga0207700_10001320
462 Ga0207700_10242008
463 Ga0207664_10087110
464 Ga0207664_10145817
465 Ga0207686_10159599
466 Ga0207709_10308773
467 Ga0207665_10022073
468 Ga0207665_10156534
469 Ga0207691_10030653
470 Ga0207661_10431206
471 Ga0207667_10453980
472 Ga0207651_11029015
473 Ga0207640_10172530
474 Ga0207677_10975671
475 Ga0207678_10052570
476 Ga0207702_10002729
477 Ga0207702_10021685
478 Ga0207648_10027601
479 Ga0207676_10281700
480 Ga0207675_100096668
481 Ga0207675_100359681
482 Ga0207683_10117687
483 Ga0207683_10295063
484 Ga0207428_10050352
485 Ga0268264_10316767
486 Ga0268264_10488053
487 Ga0307516_10477362
488 Ga0307416_100355273
489 Ga0307415_100123089
490 Ga0373938_0010439
491 Ga0373941_0160737
492 Ga0373941_0195752
493 Ga0373960_0013434
494 Ga0373942_0038736
495 Ga0316574_0325442
496 Ga0373935_0318321
497 Ga0373947_0145924
498 Ga0395898_0134443
499 Ga0395901_0227586
500 Ga0395901_0387368
501 Ga0436365_0037749
502 Ga0436361_0095039
503 Ga0436363_0982464
504 Ga0436363_1471005
505 Ga0451791_0068502
506 Ga0451843_0844740
507 Ga0439458_0012562
508 Ga0439458_0026091
509 Ga0450893_0039540
510 Ga0466963_0143963
511 Ga0466964_0007824
512 Ga0466958_0015126
513 Ga0466967_0012952
514 Ga0495629_0066133
515 Ga0495653_0165821
516 Ga0495605_0366258
517 Ga0495584_0153687
518 Ga0495594_0380215
519 Ga0495596_0018925
520 Ga0495596_0191069
521 Ga0495607_0114148
522 Ga0495608_0011746
523 Ga0495618_0089797
524 Ga0495630_0036493
525 Ga0495631_0128750
526 Ga0495644_0004420
527 Ga0495642_0047590
528 Ga0495652_0387724
529 Ga0495640_0123812
530 Ga0495597_0153918
531 Ga0495656_0080211
532 Ga0495668_0206721
533 Ga0495634_0000379
534 Ga0495625_0273634
535 Ga0495659_0072320
536 Ga0495661_0182998
537 Ga0495599_0352786
538 Ga0495613_0007161
539 Ga0495613_0128441
540 Ga0495670_0176646
541 Ga0495670_0351142
542 Ga0495649_0040944
543 Ga0495676_0093857
544 Ga0495683_0109144
545 Ga0495687_065392
546 Ga0495685_102508
547 Ga0495673_0002430
548 Ga0495681_0035366
549 Ga0495684_0182231
550 Ga0495686_0020173
551 Ga0496100_0216859
552 Ga0496101_0026259
553 Ga0496101_0386369
554 Ga0496102_0042251
555 Ga0496102_0158111
556 Ga0496102_0337509
557 Ga0496104_0002196
558 Ga0496104_0115850
559 Ga0496105_0000283
560 Ga0496105_0104899
561 Ga0496106_0262552
562 Ga0496106_0478867
563 Ga0496107_0123250
564 Ga0496108_0002220
565 Ga0496108_0320755
566 Ga0496108_0591136
567 Ga0496109_0000785
568 Ga0496109_0316617
569 Ga0496109_0690685
570 Ga0496110_0000555
571 Ga0496110_0003936
572 Ga0496111_0000703
573 Ga0496111_0008947
574 Ga0496112_0000415
575 Ga0496112_0008487
576 Ga0496112_0031095
577 Ga0496113_0000335
578 Ga0496114_0192123
579 Ga0496114_1121961
580 Ga0496115_0002620
581 Ga0496115_0183286
582 Ga0501031_0334109
583 Ga0501032_0009056
584 Ga0501034_0000495
585 Ga0501034_0001234
586 Ga0501034_0074617
587 Ga0501034_0184961
588 Ga0501034_0237573
589 Ga0501034_0305123
590 Ga0501036_0190231
591 Ga0501036_0323592
592 Ga0501036_0756089
593 Ga0501037_0020963
594 Ga0501037_0050663
595 Ga0501038_0001995
596 Ga0501038_0051735
597 Ga0501038_0113354
598 Ga0501043_0027945
599 Ga0501043_0048384
600 Ga0501043_0195886
601 Ga0501043_0748440
602 Ga0501047_0051391
603 Ga0501047_0164172
604 Ga0501047_0265283
605 Ga0501048_0045691
606 Ga0501048_0086872
607 Ga0501048_0672074
608 Ga0501067_0055024
609 Ga0501067_0123207
610 Ga0501068_0001477
611 Ga0501068_0011355
612 Ga0501068_0065823
613 Ga0501069_0002747
614 Ga0501069_0112585
615 Ga0501070_0001421
616 Ga0501070_0028406
617 Ga0501070_0047198
618 Ga0501070_0444393
619 Ga0501072_0024714
620 Ga0501072_0141910
621 Ga0501072_0375935
622 Ga0501073_0002311
623 Ga0501073_0014290
624 Ga0501074_0053719
625 Ga0501074_0076446
626 Ga0501074_0084663
627 Ga0501074_0242298
628 Ga0501075_0052790
629 Ga0501075_0641748
630 Ga0501076_0104734
631 Ga0501079_0033225
632 Ga0501079_0083152
633 Ga0501080_0003976
634 Ga0501080_0014285
635 Ga0501080_0021701
636 Ga0501080_0102265
637 Ga0501080_0105553
638 Ga0501080_0193906
639 Ga0501081_0059069
640 Ga0501083_0004698
641 Ga0501083_0064259
642 Ga0501083_0099507
643 Ga0501035_0038204
644 Ga0501035_0207112
645 Ga0501044_0046621
646 Ga0501044_0080985
647 Ga0501044_0202740
648 Ga0501045_0098031
649 nmdc:mga03n38_174464_c1
650 nmdc:mga03n38_68248_c2
651 nmdc:mga0yw44_247273_c1
652 nmdc:mga05p37_243470_c1
653 nmdc:mga05p37_397187_c1
654 nmdc:mga05p37_78588_c1
655 nmdc:mga09592_103973_c1
656 nmdc:mga09592_624835_c1
657 nmdc:mga0qj67_84391_c1
658 nmdc:mga06r32_354900_c1
659 nmdc:mga08y16_1473831_c1
660 nmdc:mga08y16_49593_c1
661 nmdc:mga08y16_655419_c1
662 nmdc:mga0rr50_255076_c1
663 nmdc:mga0rr50_523093_c1
664 nmdc:mga08x19_12509_c1
665 nmdc:mga0a205_388110_c1
666 nmdc:mga0a205_5636_c1
667 Ga0495655_0008240
668 Ga0495595_0033037
669 Ga0500641_0016052
670 Ga0500628_048109
671 Ga0500568_0000094
672 Ga0501084_0000834
673 Ga0501084_0115870
674 Ga0501084_0644371
675 Ga0501082_0093667
676 Ga0501082_0361100
677 Ga0530510_0014621
678 Ga0530510_0101248
679 Ga0530510_0256014
680 Ga0530510_0471809
681 Ga0530510_0576415
682 2644263821
683 2785373143
684 2808914982
685 2954382539
686 2954693340
687 2954708433
688 8055159609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

2

171

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.9722 1 210
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9711 1 204
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9689 1 210
3ewn-assembly1.cif.gz_A crystal structure of a thij/pfpi family protein from pseudomonas syringae 0.9689 2 203
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9685 1 210
ID Description Score Start End Superfamily
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9722 1 210 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9588 1 210 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9517 26 206 3.40.50.880
3ewnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9443 2 200 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.922 26 206 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7Z7AXN5-F1-model_v4 DJ-1/PfpI family protein 0.9924 1 172 GO:0006355
AF-A0A249LS50-F1-model_v4 deleted 0.9901 2 203
AF-A0A6B3HCW6-F1-model_v4 DJ-1/PfpI family protein 0.9896 56 187 GO:0006355
AF-A0A1C4LLW4-F1-model_v4 DJ-1/PfpI family protein 0.9889 1 194 GO:0006355
AF-A0A6G3DK63-F1-model_v4 DJ-1/PfpI family protein 0.9886 84 204 GO:0006355

Map