F415982

General Info

Members Datasets Scaffolds Average Seq Length
344 234 311 362

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1001370|Ga0209051_10013705
Length 406
Sequence MRRRPLLAALWPAGWAGALAGPWPRAHGAADSPPPDNPPLGISRRPLRFPADHGAHPDTHVEWWYVTGWLRRAAASAESGRSADEAAHRPDFGFQVTFFRTRTGVAALSASRFAARQLVFAHVALTDLAAASPSGRSNGPVLLHDQRIAREGFGLAGTPGTAGRQVARLQDWTLVRPPASPGDAGTLDIAIRAERFALALTLRATQPVMLQGEDGYSQKGPLPRQASHYYSEPQLAVQGRVQRRADGASAQSADVIGRAWLDHEWSDEYLPSEAVGWDWIGFNLFDGGALMAFRLRRPDGSALWGGGTHRDARGSQRAFAAGELAFRPLRTWTSPRTGVRYPVEWQVETPVGTFRVAALADDQELDSRGSTGALYWEGLSSLAGADGRTLGWGYLELTGYAERLKM

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2643221658 Variovorax sp. Root411 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541307 Variovorax sp. GV008 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2818991446 Variovorax sp. 1180 Isolate Unclassified
13 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
14 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
15 2842677519 Variovorax sp. R-72495 Isolate Unclassified
16 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
17 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
18 2885198086 Variovorax sp. 679 Isolate Unclassified
19 2885211737 Variovorax sp. 553 Isolate Unclassified
20 2899924645 Variovorax sp. 369 Isolate Unclassified
21 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
22 2904456579 Variovorax sp. 2002 Isolate Unclassified
23 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
24 2928037797 Variovorax sp. 1126 Isolate Unclassified
25 2928044640 Variovorax sp. 1128 Isolate Unclassified
26 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
27 2928070936 Variovorax gossypii 1167 Isolate Unclassified
28 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
29 2929520902 Variovorax beijingensis 502 Isolate Unclassified
30 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
31 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
32 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
33 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
34 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
40 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
47 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
233 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
234 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 0.87
Isolates 9.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.28
Nodule 0.29
Rhizoplane 1.45
Rhizosphere 42.15
Stem 0
Stem Tuber 0
Unclassified 14.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000107 3300002705 Bacteria 59945
2 JGI25154J39366_1001935 3300002738 Bacteria 6174
3 JGI25157J39369_1000020 3300002741 Bacteria 173287
4 JGI25150J39212_1002658 3300002774 Bacteria 4376
5 JGI25159J45721_1001248 3300002987 Bacteria 10718
6 JGI25159J45721_1003167 3300002987 Bacteria 5912
7 JGI25159J45721_1005442 3300002987 Bacteria 3997
8 JGI25151J46595_10000705 3300003187 Bacteria 28005
9 JGI25151J46595_10002797 3300003187 Bacteria 10103
10 JGI25151J46595_10006420 3300003187 Bacteria 5912
11 JGI25151J46595_10007579 3300003187 Bacteria 5303
12 JGI25153J46596_10006429 3300003215 Bacteria 5939
13 JGI25153J46596_10007596 3300003215 Bacteria 5303
14 rootH1_10000505 3300003316 Bacteria 1581
15 rootH2_10002841 3300003320 Bacteria 14481
16 rootH1_10031932 3300003323 Bacteria 3451
17 rootH1_10050444 3300003316 Bacteria 5160
18 rootH1_10050444 3300003323 Bacteria 2324
19 JGI25160J50197_1001845 3300003354 Bacteria 10175
20 JGI25160J50197_1004630 3300003354 Bacteria 5912
21 JGI25161J50226_1001605 3300003374 Bacteria 6588
22 JGI25161J50226_1001761 3300003374 Bacteria 6114
23 Ga0006562J51391_1164890 3300003578 Bacteria 1225
24 Ga0006562J51391_1182103 3300003578 Bacteria 5329
25 Ga0006562J51391_1182104 3300003578 Bacteria 5313
26 Ga0055539_1000155 3300003752 Bacteria 65927
27 Ga0055539_1000799 3300003752 Bacteria 7472
28 Ga0055533_1000028 3300003756 Bacteria 311012
29 Ga0055535_1000575 3300003761 Bacteria 30861
30 Ga0055542_1000109 3300003762 Bacteria 111107
31 Ga0055529_1000619 3300003763 Bacteria 26617
32 Ga0055526_1002404 3300003771 Bacteria 12680
33 Ga0055526_1007100 3300003771 Bacteria 5912
34 Ga0055537_1001373 3300003773 Bacteria 9748
35 Ga0055537_1002602 3300003773 Bacteria 5912
36 Ga0055524_1001600 3300003775 Bacteria 12680
37 Ga0055524_1005136 3300003775 Bacteria 5912
38 Ga0055536_1001548 3300003781 Bacteria 13787
39 Ga0055534_1001370 3300003784 Bacteria 9752
40 Ga0055534_1003166 3300003784 Bacteria 5326
41 Ga0055534_1009504 3300003784 Bacteria 2107
42 Ga0055528_1002424 3300003790 Bacteria 10010
43 Ga0055528_1005471 3300003790 Bacteria 5912
44 Ga0055530_10001578 3300003791 Bacteria 16321
45 Ga0055540_1001235 3300003792 Bacteria 15714
46 Ga0055540_1001858 3300003792 Bacteria 11881
47 Ga0055540_1002365 3300003792 Bacteria 10080
48 Ga0055531_10003446 3300003794 Bacteria 10080
49 Ga0055531_10004445 3300003794 Bacteria 8528
50 Ga0055531_10008627 3300003794 Bacteria 5339
51 Ga0055543_1001178 3300004625 Bacteria 11076
52 Ga0055543_1002544 3300004625 Bacteria 5950
53 Ga0065165_1002959 3300005262 Bacteria 12935
54 Ga0065165_1003750 3300005262 Bacteria 10213
55 Ga0065165_1006677 3300005262 Bacteria 5950
56 Ga0070658_10059695 3300005327 Bacteria 3106
57 Ga0070658_10099333 3300005327 Bacteria 2405
58 Ga0070690_100010988 3300005330 Bacteria 5286
59 Ga0070660_100029506 3300005339 Bacteria 4111
60 Ga0070673_100011599 3300005364 Bacteria 6021
61 Ga0070659_100009180 3300005366 Bacteria 7256
62 Ga0070667_100006076 3300005367 Bacteria 10026
63 Ga0068853_100015947 3300005539 Bacteria 6177
64 Ga0068855_100000405 3300005563 Bacteria 53352
65 Ga0068855_100064160 3300005563 Bacteria 4284
66 Ga0070664_100047309 3300005564 Bacteria 3633
67 Ga0068857_100003994 3300005577 Bacteria 12427
68 Ga0068854_100036140 3300005578 Bacteria 3461
69 Ga0068854_100066074 3300005578 Bacteria 2631
70 Ga0068856_100000790 3300005614 Bacteria 34216
71 Ga0068861_100038339 3300005719 Bacteria 3567
72 Ga0068862_100084715 3300005844 Bacteria 2754
73 Ga0075362_10009134 3300006177 Bacteria 3818
74 Ga0075366_10049918 3300006195 Bacteria 2483
75 Ga0075370_10005461 3300006353 Bacteria 6323
76 Ga0075370_10037641 3300006353 Bacteria 2721
77 Ga0075370_10083922 3300006353 Bacteria 1833
78 Ga0075428_100065380 3300006844 Bacteria 3983
79 Ga0105244_10001556 3300009036 Bacteria 18234
80 Ga0105244_10086487 3300009036 Bacteria 1545
81 Ga0105240_10015439 3300009093 Bacteria 10385
82 Ga0105240_10051037 3300009093 Bacteria 5208
83 Ga0105240_10247291 3300009093 Bacteria 2064
84 Ga0105247_10011103 3300009101 Bacteria 5432
85 Ga0105243_10000362 3300009148 Bacteria 48567
86 Ga0105243_10005539 3300009148 Bacteria 9837
87 Ga0105243_10017939 3300009148 Bacteria 5356
88 Ga0105237_10069964 3300009545 Bacteria 3504
89 Ga0105238_10060386 3300009551 Bacteria 3795
90 Ga0105239_10043505 3300010375 Bacteria 4923
91 Ga0157373_10061610 3300013100 Bacteria 2657
92 Ga0157370_10015039 3300013104 Bacteria 7888
93 Ga0157370_10084914 3300013104 Bacteria 2974
94 Ga0163162_10231036 3300013306 Bacteria 1980
95 Ga0157372_10280073 3300013307 Bacteria 1939
96 Ga0182008_10004163 3300014497 Bacteria 8506
97 Ga0182008_10004941 3300014497 Bacteria 7686
98 Ga0182006_1008988 3300015261 Bacteria 4502
99 Ga0182007_10003476 3300015262 Bacteria 7415
100 Ga0163161_10000157 3300017792 Bacteria 62919
101 Ga0163161_10036173 3300017792 Bacteria 3536
102 Ga0213872_10012537 3300021361 Bacteria 3987
103 Ga0209436_101142 3300025208 Bacteria 9819
104 Ga0209674_100007 3300025226 Bacteria 1077082
105 Ga0209672_102943 3300025228 Bacteria 3779
106 Ga0209563_100033 3300025230 Bacteria 457883
107 Ga0207427_100501 3300025231 Bacteria 20836
108 Ga0209258_100048 3300025242 Bacteria 365881
109 Ga0209258_100575 3300025242 Bacteria 30925
110 Ga0209258_100655 3300025242 Bacteria 25327
111 Ga0207425_1001149 3300025245 Bacteria 11896
112 Ga0207425_1003165 3300025245 Bacteria 5384
113 Ga0209646_1000062 3300025246 Bacteria 252045
114 Ga0209026_1000026 3300025250 Bacteria 352109
115 Ga0209677_100082 3300025253 Bacteria 118875
116 Ga0209677_100116 3300025253 Bacteria 82606
117 Ga0209148_1000040 3300025254 Bacteria 473531
118 Ga0209759_1000050 3300025256 Bacteria 215979
119 Ga0209759_1000916 3300025256 Bacteria 21727
120 Ga0209759_1001283 3300025256 Bacteria 15000
121 Ga0209759_1002072 3300025256 Bacteria 9387
122 Ga0209129_1000083 3300025258 Bacteria 183270
123 Ga0209129_1003857 3300025258 Bacteria 6248
124 Ga0209129_1004533 3300025258 Bacteria 5370
125 Ga0209565_1001201 3300025263 Bacteria 12340
126 Ga0209565_1002397 3300025263 Bacteria 6794
127 Ga0209455_1000093 3300025272 Bacteria 220487
128 Ga0209673_1001556 3300025273 Bacteria 20644
129 Ga0209673_1001607 3300025273 Bacteria 19784
130 Ga0209673_1005055 3300025273 Bacteria 6794
131 Ga0209130_1001602 3300025284 Bacteria 14108
132 Ga0209130_1001679 3300025284 Bacteria 13484
133 Ga0209130_1002207 3300025284 Bacteria 10227
134 Ga0209675_1001120 3300025291 Bacteria 16341
135 Ga0209675_1003946 3300025291 Bacteria 6794
136 Ga0209675_1005321 3300025291 Bacteria 5418
137 Ga0209676_1000004 3300025292 Bacteria 1138360
138 Ga0209676_1001760 3300025292 Bacteria 18385
139 Ga0209676_1002922 3300025292 Bacteria 11168
140 Ga0209676_1006079 3300025292 Bacteria 6074
141 Ga0209676_1017268 3300025292 Bacteria 2562
142 Ga0209025_1005595 3300025294 Bacteria 10155
143 Ga0209025_1009280 3300025294 Bacteria 6886
144 Ga0209025_1012617 3300025294 Bacteria 5398
145 Ga0209025_1019409 3300025294 Bacteria 3782
146 Ga0209564_1002853 3300025295 Bacteria 12709
147 Ga0209564_1005805 3300025295 Bacteria 6886
148 Ga0209758_1000132 3300025297 Bacteria 183273
149 Ga0209758_1005241 3300025297 Bacteria 10155
150 Ga0209758_1010805 3300025297 Bacteria 5398
151 Ga0209050_1000002 3300025298 Bacteria 1792849
152 Ga0209050_1001170 3300025298 Bacteria 31017
153 Ga0209256_1000750 3300025299 Bacteria 42266
154 Ga0209256_1002639 3300025299 Bacteria 14108
155 Ga0207426_1000762 3300025302 Bacteria 35839
156 Ga0207426_1002041 3300025302 Bacteria 14108
157 Ga0207426_1002276 3300025302 Bacteria 12679
158 Ga0209051_1000002 3300025303 Bacteria 1631846
159 Ga0209051_1000533 3300025303 Bacteria 47141
160 Ga0209051_1000770 3300025303 Bacteria 33998
161 Ga0209051_1001370 3300025303 Bacteria 21049
162 Ga0209051_1001870 3300025303 Bacteria 16527
163 Ga0209051_1002364 3300025303 Bacteria 13645
164 Ga0209051_1011686 3300025303 Bacteria 4312
165 Ga0209257_1000002 3300025304 Bacteria 1767052
166 Ga0209257_1000361 3300025304 Bacteria 92239
167 Ga0209257_1006334 3300025304 Bacteria 7693
168 Ga0209257_1007228 3300025304 Bacteria 6794
169 Ga0209257_1016040 3300025304 Bacteria 3060
170 Ga0207695_10075325 3300025913 Bacteria 3434
171 Ga0207671_10032164 3300025914 Bacteria 3905
172 Ga0207657_10017817 3300025919 Bacteria 6800
173 Ga0207649_10261334 3300025920 Bacteria 1251
174 Ga0207690_10050601 3300025932 Bacteria 2774
175 Ga0207709_10000323 3300025935 Bacteria 51730
176 Ga0207709_10088486 3300025935 Bacteria 2016
177 Ga0207679_10004897 3300025945 Bacteria 8346
178 Ga0207667_10007080 3300025949 Bacteria 13546
179 Ga0207667_10042485 3300025949 Bacteria 4831
180 Ga0207667_10079406 3300025949 Bacteria 3401
181 Ga0207667_10446382 3300025949 Bacteria 1315
182 Ga0207651_10002388 3300025960 Bacteria 8968
183 Ga0207640_10009561 3300025981 Bacteria 5433
184 Ga0207658_10004133 3300025986 Bacteria 10122
185 Ga0207702_10000225 3300026078 Bacteria 65968
186 Ga0207676_10017877 3300026095 Bacteria 5145
187 Ga0207674_10013546 3300026116 Bacteria 9042
188 Ga0207674_10152263 3300026116 Bacteria 2269
189 Ga0207674_10201792 3300026116 Bacteria 1938
190 Ga0268265_10056979 3300028380 Bacteria 2976
191 Ga0307517_10000644 3300028786 Bacteria 59773
192 Ga0307515_10000195 3300028794 Bacteria 148138
193 Ga0307515_10000902 3300028794 Bacteria 68371
194 Ga0307515_10006527 3300028794 Bacteria 23330
195 Ga0307512_10128583 3300030522 Bacteria 1598
196 Ga0314311_1026772 3300030733 Bacteria 4221
197 Ga0265332_10001920 3300031238 Bacteria 11004
198 Ga0307513_10011390 3300031456 Bacteria 11056
199 Ga0307513_10166904 3300031456 Bacteria 2084
200 Ga0307509_10000033 3300031507 Bacteria 194363
201 Ga0307408_100112898 3300031548 Bacteria 2090
202 Ga0307508_10074140 3300031616 Bacteria 2979
203 Ga0307514_10012861 3300031649 Bacteria 6956
204 Ga0307514_10066812 3300031649 Bacteria 2717
205 Ga0316578_10001590 3300031728 Bacteria 9374
206 Ga0307405_10009955 3300031731 Bacteria 4900
207 Ga0307405_10250066 3300031731 Bacteria 1318
208 Ga0307406_10002205 3300031901 Bacteria 10598
209 Ga0307412_10023200 3300031911 Bacteria 3814
210 Ga0307412_10100697 3300031911 Bacteria 2043
211 Ga0307412_10130835 3300031911 Bacteria 1822
212 Ga0307416_100113313 3300032002 Bacteria 2396
213 Ga0307414_10020394 3300032004 Bacteria 4131
214 Ga0307414_10045515 3300032004 Bacteria 3005
215 Ga0307411_10015511 3300032005 Bacteria 4282
216 Ga0373934_0010396 3300035086 Bacteria 3494
217 Ga0373932_0003714 3300035112 Bacteria 3646
218 Ga0373931_0002383 3300035691 Bacteria 8319
219 Ga0373931_0012816 3300035691 Bacteria 4070
220 Ga0373947_0241563 3300035725 Bacteria 1192
221 Ga0373925_0077575 3300037068 Bacteria 2522
222 Ga0395901_0038816 3300038443 Bacteria 4925
223 Ga0436361_0606884 3300039447 Bacteria 4680
224 Ga0439436_0002689 3300041404 Bacteria 5364
225 Ga0439447_025969 3300041407 Bacteria 1505
226 Ga0439465_0007887 3300041413 Bacteria 3373
227 Ga0451807_0003847 3300041486 Bacteria 2494
228 Ga0439431_0010222 3300041997 Bacteria 2127
229 Ga0439433_0008519 3300041999 Bacteria 2225
230 Ga0439442_012563 3300042002 Bacteria 1731
231 Ga0439432_001197 3300042006 Bacteria 9813
232 Ga0439449_0042669 3300042007 Bacteria 1685
233 Ga0439449_0066217 3300042007 Bacteria 1332
234 Ga0439452_001501 3300042010 Bacteria 9458
235 Ga0439457_007065 3300042014 Bacteria 2709
236 Ga0439462_0009604 3300042015 Bacteria 2446
237 Ga0439446_0030792 3300042156 Bacteria 1551
238 Ga0439434_0001920 3300042435 Bacteria 6024
239 Ga0495629_0111319 3300046459 Bacteria 1909
240 Ga0495638_0073946 3300046460 Bacteria 2079
241 Ga0495639_0004933 3300046475 Bacteria 5722
242 Ga0495585_0012962 3300046492 Bacteria 4898
243 Ga0495583_0000245 3300046506 Bacteria 89398
244 Ga0495606_0073007 3300046507 Bacteria 2154
245 Ga0495606_0092797 3300046507 Bacteria 1853
246 Ga0495610_0043666 3300046512 Bacteria 2231
247 Ga0495616_0002253 3300046513 Bacteria 12909
248 Ga0495620_0031449 3300046515 Bacteria 2432
249 Ga0495631_0000589 3300046518 Bacteria 24095
250 Ga0495637_0021145 3300046520 Bacteria 2985
251 Ga0495637_0049706 3300046520 Bacteria 1760
252 Ga0495654_0040331 3300046530 Bacteria 2327
253 Ga0495668_0158500 3300046616 Bacteria 1240
254 Ga0495625_0003582 3300046660 Bacteria 15309
255 Ga0495625_0006197 3300046660 Bacteria 10714
256 Ga0495625_0054593 3300046660 Bacteria 2852
257 Ga0495661_0123124 3300046665 Bacteria 1430
258 Ga0495588_0008286 3300046674 Bacteria 4762
259 Ga0495588_0018052 3300046674 Bacteria 3435
260 Ga0495588_0066016 3300046674 Bacteria 1878
261 Ga0495669_0032072 3300046684 Unclassified 2308
262 Ga0495624_0037607 3300046690 Bacteria 3112
263 Ga0495624_0057068 3300046690 Bacteria 2456
264 Ga0495671_0025107 3300046692 Bacteria 3099
265 Ga0495649_0000400 3300046694 Bacteria 37554
266 Ga0495589_0049481 3300046794 Bacteria 2080
267 Ga0495660_0083053 3300046810 Bacteria 1676
268 Ga0495676_0024655 3300047321 Bacteria 5203
269 Ga0495593_0025212 3300047673 Bacteria 3291
270 Ga0495602_0100312 3300048088 Bacteria 2378
271 Ga0495614_0002409 3300048089 Bacteria 8314
272 Ga0496109_0183289 3300048912 Bacteria 1967
273 Ga0496117_0026477 3300048920 Bacteria 4537
274 Ga0496117_0069663 3300048920 Bacteria 2367
275 Ga0496118_0004662 3300048921 Bacteria 16079
276 Ga0496118_0031865 3300048921 Bacteria 4359
277 Ga0496121_0097186 3300048924 Bacteria 2283
278 Ga0496121_0143337 3300048924 Bacteria 1769
279 Ga0496125_0003750 3300048928 Bacteria 18096
280 Ga0501262_001268 3300049759 Bacteria 2834
281 nmdc:mga03683_825_c2 3300050489 Bacteria 4086
282 nmdc:mga03n38_39079_c1 3300050490 Bacteria 2056
283 nmdc:mga07m45_16754_c1 3300050496 Bacteria 3926
284 nmdc:mga07m45_422_c1 3300050496 Bacteria 17511
285 nmdc:mga07m45_75726_c1 3300050496 Bacteria 1918
286 nmdc:mga07m45_77891_c1 3300050496 Bacteria 1891
287 nmdc:mga0sz30_26500_c1 3300050516 Bacteria 2376
288 Ga0500610_0015348 3300053079 Bacteria 3624
289 Ga0500610_0034433 3300053079 Bacteria 2591
290 Ga0500610_0100938 3300053079 Bacteria 1493
291 Ga0500635_0000160 3300053080 Bacteria 36139
292 Ga0500643_026677 3300053087 Bacteria 1805
293 Ga0500651_0000164 3300053093 Bacteria 42896
294 Ga0500562_009099 3300053108 Bacteria 2511
295 Ga0500571_059565 3300053110 Bacteria 1971
296 Ga0500593_014349 3300053117 Bacteria 3397
297 Ga0500607_037464 3300053121 Bacteria 2642
298 Ga0500608_063994 3300053122 Bacteria 1755
299 Ga0500618_023646 3300053125 Bacteria 1486
300 Ga0500626_039844 3300053128 Bacteria 2125
301 Ga0500655_005500 3300053133 Bacteria 2283
302 Ga0500658_0000132 3300053134 Bacteria 35240
303 Ga0500658_0000180 3300053134 Bacteria 30355
304 Ga0500559_0033637 3300053136 Bacteria 2207
305 Ga0500564_036993 3300053138 Bacteria 2251
306 Ga0500568_0000864 3300053139 Bacteria 21265
307 Ga0500616_0090579 3300053153 Bacteria 1515
308 Ga0500627_0010611 3300053158 Bacteria 3366
309 Ga0500634_0091598 3300053161 Bacteria 1541
310 Ga0500638_031955 3300053162 Bacteria 2540
311 Ga0500661_005716 3300055283 Bacteria 2318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0006197 Ga0495625_0006197_1616_2623 299
2 3300028794 Ga0307515_10000902 Ga0307515_1000090254 317
3 3300030522 Ga0307512_10128583 Ga0307512_101285832 317
4 3300031456 Ga0307513_10011390 Ga0307513_1001139010 317
5 3300025920 Ga0207649_10261334 Ga0207649_102613341 319
6 3300028794 Ga0307515_10006527 Ga0307515_100065272 324
7 3300031507 Ga0307509_10000033 Ga0307509_10000033145 330
8 3300021361 Ga0213872_10012537 Ga0213872_100125373 332
9 3300039447 Ga0436361_0606884 Ga0436361_0606884_760_1815 332
10 3300005844 Ga0068862_100084715 Ga0068862_1000847153 335
11 3300028380 Ga0268265_10056979 Ga0268265_100569792 335
12 3300046616 Ga0495668_0158500 Ga0495668_0158500_120_1187 335
13 3300046665 Ga0495661_0123124 Ga0495661_0123124_37_1104 335
14 3300046692 Ga0495671_0025107 Ga0495671_0025107_467_1534 335
15 3300053079 Ga0500610_0015348 Ga0500610_0015348_1376_2443 335
16 3300053117 Ga0500593_014349 Ga0500593_014349_1905_2972 335
17 3300053121 Ga0500607_037464 Ga0500607_037464_455_1522 335
18 3300025273 Ga0209673_1001607 Ga0209673_10016078 338
19 3300042007 Ga0439449_0066217 Ga0439449_0066217_91_1176 339
20 3300003578 Ga0006562J51391_1182103 Ga0006562J51391_11821033 340
21 3300003578 Ga0006562J51391_1182104 Ga0006562J51391_11821043 340
22 3300046690 Ga0495624_0037607 Ga0495624_0037607_84_1115 340
23 3300009148 Ga0105243_10000362 Ga0105243_100003626 341
24 3300025935 Ga0207709_10000323 Ga0207709_100003236 341
25 iso_pu_bacteria 2885192300 2885196127 341
26 3300032004 Ga0307414_10045515 Ga0307414_100455152 342
27 3300032005 Ga0307411_10015511 Ga0307411_100155114 342
28 3300005578 Ga0068854_100036140 Ga0068854_1000361402 344
29 3300025981 Ga0207640_10009561 Ga0207640_100095615 344
30 3300028794 Ga0307515_10000195 Ga0307515_1000019572 344
31 3300041404 Ga0439436_0002689 Ga0439436_0002689_1203_2246 344
32 3300041407 Ga0439447_025969 Ga0439447_025969_262_1305 344
33 3300041413 Ga0439465_0007887 Ga0439465_0007887_1552_2595 344
34 3300041997 Ga0439431_0010222 Ga0439431_0010222_572_1615 344
35 3300041999 Ga0439433_0008519 Ga0439433_0008519_72_1115 344
36 3300042002 Ga0439442_012563 Ga0439442_012563_509_1552 344
37 3300042006 Ga0439432_001197 Ga0439432_001197_7102_8145 344
38 3300042010 Ga0439452_001501 Ga0439452_001501_6190_7233 344
39 3300042014 Ga0439457_007065 Ga0439457_007065_1054_2097 344
40 3300042015 Ga0439462_0009604 Ga0439462_0009604_137_1180 344
41 3300042156 Ga0439446_0030792 Ga0439446_0030792_493_1536 344
42 3300042435 Ga0439434_0001920 Ga0439434_0001920_1054_2097 344
43 3300048924 Ga0496121_0097186 Ga0496121_0097186_777_1847 344
44 3300009101 Ga0105247_10011103 Ga0105247_100111033 345
45 3300031649 Ga0307514_10012861 Ga0307514_100128614 345
46 3300050490 nmdc:mga03n38_39079_c1 nmdc:mga03n38_39079_c1_944_2002 345
47 iso_pu_bacteria 2945972063 2945976517 345
48 3300003187 JGI25151J46595_10000705 JGI25151J46595_1000070523 346
49 3300006353 Ga0075370_10005461 Ga0075370_100054617 346
50 3300013100 Ga0157373_10061610 Ga0157373_100616102 346
51 3300013104 Ga0157370_10015039 Ga0157370_100150395 346
52 3300017792 Ga0163161_10000157 Ga0163161_100001575 346
53 3300026116 Ga0207674_10201792 Ga0207674_102017922 346
54 3300028786 Ga0307517_10000644 Ga0307517_1000064445 346
55 3300030733 Ga0314311_1026772 Ga0314311_10267723 346
56 3300031616 Ga0307508_10074140 Ga0307508_100741402 346
57 3300031649 Ga0307514_10066812 Ga0307514_100668124 346
58 3300031731 Ga0307405_10250066 Ga0307405_102500662 346
59 3300031911 Ga0307412_10130835 Ga0307412_101308352 346
60 3300032002 Ga0307416_100113313 Ga0307416_1001133133 346
61 3300035112 Ga0373932_0003714 Ga0373932_0003714_2082_3131 346
62 3300035691 Ga0373931_0012816 Ga0373931_0012816_2555_3604 346
63 3300042007 Ga0439449_0042669 Ga0439449_0042669_309_1379 346
64 3300046520 Ga0495637_0049706 Ga0495637_0049706_162_1229 346
65 3300046674 Ga0495588_0018052 Ga0495588_0018052_2006_3073 346
66 3300046810 Ga0495660_0083053 Ga0495660_0083053_138_1205 346
67 3300049759 Ga0501262_001268 Ga0501262_001268_106_1176 346
68 3300050496 nmdc:mga07m45_422_c1 nmdc:mga07m45_422_c1_14151_15221 346
69 3300053079 Ga0500610_0034433 Ga0500610_0034433_1182_2249 346
70 3300053079 Ga0500610_0100938 Ga0500610_0100938_185_1252 346
71 3300053158 Ga0500627_0010611 Ga0500627_0010611_543_1610 346
72 iso_pu_bacteria 2842677519 2842681765 346
73 iso_pu_bacteria 2919462493 2919463992 346
74 iso_pu_bacteria 2945945610 2945946803 346
75 iso_pu_bacteria 2945984333 2945986821 346
76 3300002774 JGI25150J39212_1002658 JGI25150J39212_10026582 347
77 3300002987 JGI25159J45721_1001248 JGI25159J45721_10012482 347
78 3300002987 JGI25159J45721_1003167 JGI25159J45721_10031673 347
79 3300002987 JGI25159J45721_1005442 JGI25159J45721_10054422 347
80 3300003187 JGI25151J46595_10002797 JGI25151J46595_100027972 347
81 3300003187 JGI25151J46595_10006420 JGI25151J46595_100064203 347
82 3300003187 JGI25151J46595_10007579 JGI25151J46595_100075793 347
83 3300003215 JGI25153J46596_10006429 JGI25153J46596_100064293 347
84 3300003215 JGI25153J46596_10007596 JGI25153J46596_100075963 347
85 3300003354 JGI25160J50197_1001845 JGI25160J50197_10018452 347
86 3300003354 JGI25160J50197_1004630 JGI25160J50197_10046303 347
87 3300003374 JGI25161J50226_1001605 JGI25161J50226_10016052 347
88 3300003374 JGI25161J50226_1001761 JGI25161J50226_10017614 347
89 3300003578 Ga0006562J51391_1164890 Ga0006562J51391_11648901 347
90 3300003762 Ga0055542_1000109 Ga0055542_10001093 347
91 3300003771 Ga0055526_1002404 Ga0055526_10024044 347
92 3300003771 Ga0055526_1007100 Ga0055526_10071003 347
93 3300003773 Ga0055537_1001373 Ga0055537_10013734 347
94 3300003773 Ga0055537_1002602 Ga0055537_10026023 347
95 3300003775 Ga0055524_1001600 Ga0055524_10016003 347
96 3300003775 Ga0055524_1005136 Ga0055524_10051363 347
97 3300003781 Ga0055536_1001548 Ga0055536_10015483 347
98 3300003784 Ga0055534_1001370 Ga0055534_10013702 347
99 3300003784 Ga0055534_1003166 Ga0055534_10031663 347
100 3300003790 Ga0055528_1002424 Ga0055528_10024242 347
101 3300003790 Ga0055528_1005471 Ga0055528_10054713 347
102 3300003791 Ga0055530_10001578 Ga0055530_100015785 347
103 3300003792 Ga0055540_1001235 Ga0055540_100123511 347
104 3300003792 Ga0055540_1001858 Ga0055540_10018588 347
105 3300003792 Ga0055540_1002365 Ga0055540_10023653 347
106 3300003794 Ga0055531_10003446 Ga0055531_100034463 347
107 3300003794 Ga0055531_10004445 Ga0055531_100044454 347
108 3300003794 Ga0055531_10008627 Ga0055531_100086273 347
109 3300004625 Ga0055543_1001178 Ga0055543_10011784 347
110 3300004625 Ga0055543_1002544 Ga0055543_10025443 347
111 3300005262 Ga0065165_1002959 Ga0065165_10029593 347
112 3300005262 Ga0065165_1003750 Ga0065165_10037502 347
113 3300005262 Ga0065165_1006677 Ga0065165_10066773 347
114 3300005564 Ga0070664_100047309 Ga0070664_1000473094 347
115 3300006177 Ga0075362_10009134 Ga0075362_100091342 347
116 3300006195 Ga0075366_10049918 Ga0075366_100499182 347
117 3300006353 Ga0075370_10037641 Ga0075370_100376413 347
118 3300009036 Ga0105244_10001556 Ga0105244_1000155610 347
119 3300009036 Ga0105244_10086487 Ga0105244_100864871 347
120 3300009093 Ga0105240_10247291 Ga0105240_102472912 347
121 3300009148 Ga0105243_10005539 Ga0105243_100055394 347
122 3300013104 Ga0157370_10084914 Ga0157370_100849142 347
123 3300013306 Ga0163162_10231036 Ga0163162_102310362 347
124 3300014497 Ga0182008_10004163 Ga0182008_100041637 347
125 3300014497 Ga0182008_10004941 Ga0182008_100049414 347
126 3300015261 Ga0182006_1008988 Ga0182006_10089883 347
127 3300015262 Ga0182007_10003476 Ga0182007_100034763 347
128 3300025208 Ga0209436_101142 Ga0209436_1011424 347
129 3300025228 Ga0209672_102943 Ga0209672_1029432 347
130 3300025242 Ga0209258_100048 Ga0209258_1000483 347
131 3300025245 Ga0207425_1001149 Ga0207425_10011498 347
132 3300025245 Ga0207425_1003165 Ga0207425_10031652 347
133 3300025254 Ga0209148_1000040 Ga0209148_10000403 347
134 3300025258 Ga0209129_1000083 Ga0209129_1000083168 347
135 3300025258 Ga0209129_1003857 Ga0209129_10038572 347
136 3300025258 Ga0209129_1004533 Ga0209129_10045333 347
137 3300025263 Ga0209565_1001201 Ga0209565_10012014 347
138 3300025263 Ga0209565_1002397 Ga0209565_10023973 347
139 3300025273 Ga0209673_1001556 Ga0209673_10015563 347
140 3300025273 Ga0209673_1005055 Ga0209673_10050553 347
141 3300025284 Ga0209130_1001602 Ga0209130_10016023 347
142 3300025284 Ga0209130_1001679 Ga0209130_10016793 347
143 3300025284 Ga0209130_1002207 Ga0209130_10022074 347
144 3300025291 Ga0209675_1001120 Ga0209675_10011209 347
145 3300025291 Ga0209675_1003946 Ga0209675_10039463 347
146 3300025291 Ga0209675_1005321 Ga0209675_10053213 347
147 3300025292 Ga0209676_1000004 Ga0209676_1000004516 347
148 3300025292 Ga0209676_1001760 Ga0209676_100176010 347
149 3300025292 Ga0209676_1017268 Ga0209676_10172682 347
150 3300025294 Ga0209025_1005595 Ga0209025_10055954 347
151 3300025294 Ga0209025_1009280 Ga0209025_10092804 347
152 3300025294 Ga0209025_1012617 Ga0209025_10126173 347
153 3300025294 Ga0209025_1019409 Ga0209025_10194092 347
154 3300025295 Ga0209564_1002853 Ga0209564_10028534 347
155 3300025295 Ga0209564_1005805 Ga0209564_10058053 347
156 3300025297 Ga0209758_1000132 Ga0209758_1000132168 347
157 3300025297 Ga0209758_1005241 Ga0209758_10052414 347
158 3300025297 Ga0209758_1010805 Ga0209758_10108053 347
159 3300025298 Ga0209050_1000002 Ga0209050_10000021026 347
160 3300025298 Ga0209050_1001170 Ga0209050_100117012 347
161 3300025299 Ga0209256_1000750 Ga0209256_10007503 347
162 3300025299 Ga0209256_1002639 Ga0209256_10026393 347
163 3300025302 Ga0207426_1000762 Ga0207426_100076229 347
164 3300025302 Ga0207426_1002041 Ga0207426_10020413 347
165 3300025302 Ga0207426_1002276 Ga0207426_10022763 347
166 3300025303 Ga0209051_1000002 Ga0209051_1000002795 347
167 3300025303 Ga0209051_1000533 Ga0209051_100053316 347
168 3300025303 Ga0209051_1001870 Ga0209051_10018707 347
169 3300025303 Ga0209051_1011686 Ga0209051_10116862 347
170 3300025304 Ga0209257_1000002 Ga0209257_1000002936 347
171 3300025304 Ga0209257_1000361 Ga0209257_100036145 347
172 3300025304 Ga0209257_1007228 Ga0209257_10072283 347
173 3300025945 Ga0207679_10004897 Ga0207679_100048975 347
174 3300031548 Ga0307408_100112898 Ga0307408_1001128982 347
175 3300031901 Ga0307406_10002205 Ga0307406_100022058 347
176 3300031911 Ga0307412_10023200 Ga0307412_100232002 347
177 3300031911 Ga0307412_10100697 Ga0307412_101006972 347
178 3300032004 Ga0307414_10020394 Ga0307414_100203943 347
179 3300041486 Ga0451807_0003847 Ga0451807_0003847_1275_2333 347
180 3300046459 Ga0495629_0111319 Ga0495629_0111319_573_1640 347
181 3300046515 Ga0495620_0031449 Ga0495620_0031449_478_1536 347
182 3300046520 Ga0495637_0021145 Ga0495637_0021145_1565_2623 347
183 3300046690 Ga0495624_0057068 Ga0495624_0057068_870_1937 347
184 3300047321 Ga0495676_0024655 Ga0495676_0024655_1471_2538 347
185 3300047673 Ga0495593_0025212 Ga0495593_0025212_597_1664 347
186 3300048088 Ga0495602_0100312 Ga0495602_0100312_354_1421 347
187 3300048089 Ga0495614_0002409 Ga0495614_0002409_1350_2417 347
188 3300048920 Ga0496117_0026477 Ga0496117_0026477_602_1681 347
189 3300048920 Ga0496117_0069663 Ga0496117_0069663_629_1690 347
190 3300048921 Ga0496118_0004662 Ga0496118_0004662_3291_4370 347
191 3300048921 Ga0496118_0031865 Ga0496118_0031865_2525_3601 347
192 3300048924 Ga0496121_0143337 Ga0496121_0143337_178_1257 347
193 3300048928 Ga0496125_0003750 Ga0496125_0003750_16758_17834 347
194 3300050489 nmdc:mga03683_825_c2 nmdc:mga03683_825_c2_356_1432 347
195 3300050496 nmdc:mga07m45_16754_c1 nmdc:mga07m45_16754_c1_686_1765 347
196 3300050496 nmdc:mga07m45_77891_c1 nmdc:mga07m45_77891_c1_590_1666 347
197 3300050516 nmdc:mga0sz30_26500_c1 nmdc:mga0sz30_26500_c1_1104_2231 347
198 3300053087 Ga0500643_026677 Ga0500643_026677_352_1419 347
199 3300053093 Ga0500651_0000164 Ga0500651_0000164_27367_28434 347
200 3300053110 Ga0500571_059565 Ga0500571_059565_611_1678 347
201 3300053122 Ga0500608_063994 Ga0500608_063994_458_1525 347
202 3300053125 Ga0500618_023646 Ga0500618_023646_354_1421 347
203 3300053128 Ga0500626_039844 Ga0500626_039844_433_1491 347
204 3300053133 Ga0500655_005500 Ga0500655_005500_746_1813 347
205 3300053134 Ga0500658_0000132 Ga0500658_0000132_27503_28570 347
206 3300053136 Ga0500559_0033637 Ga0500559_0033637_388_1446 347
207 3300053138 Ga0500564_036993 Ga0500564_036993_705_1772 347
208 3300053161 Ga0500634_0091598 Ga0500634_0091598_310_1377 347
209 3300053162 Ga0500638_031955 Ga0500638_031955_614_1681 347
210 iso_pu_bacteria 2513020051 2513230767 347
211 iso_pu_bacteria 2599185214 2599622952 347
212 iso_pu_bacteria 2599185226 2599671431 347
213 iso_pu_bacteria 2599185227 2599679532 347
214 iso_pu_bacteria 2599185229 2599691548 347
215 iso_pu_bacteria 2643221658 2644325079 347
216 iso_pu_bacteria 2643221672 2644400193 347
217 iso_pu_bacteria 2818991446 2819602255 347
218 iso_pu_bacteria 2831265667 2831265783 347
219 iso_pu_bacteria 2838054893 2838056497 347
220 iso_pu_bacteria 2885198086 2885203367 347
221 iso_pu_bacteria 2885211737 2885217283 347
222 iso_pu_bacteria 2899924645 2899930534 347
223 iso_pu_bacteria 2904449895 2904456324 347
224 iso_pu_bacteria 2904456579 2904462833 347
225 iso_pu_bacteria 2928037797 2928039648 347
226 iso_pu_bacteria 2928044640 2928044747 347
227 iso_pu_bacteria 2928064002 2928064790 347
228 iso_pu_bacteria 2928070936 2928074742 347
229 iso_pu_bacteria 2929520902 2929524416 347
230 iso_pu_bacteria 2945909444 2945910943 347
231 iso_pu_bacteria 2954767861 2954771541 347
232 3300017792 Ga0163161_10036173 Ga0163161_100361733 348
233 3300031456 Ga0307513_10166904 Ga0307513_101669042 348
234 3300046460 Ga0495638_0073946 Ga0495638_0073946_502_1563 348
235 3300046507 Ga0495606_0073007 Ga0495606_0073007_404_1489 348
236 3300046512 Ga0495610_0043666 Ga0495610_0043666_702_1763 348
237 3300046513 Ga0495616_0002253 Ga0495616_0002253_7881_8942 348
238 3300046518 Ga0495631_0000589 Ga0495631_0000589_18806_19867 348
239 3300046530 Ga0495654_0040331 Ga0495654_0040331_743_1804 348
240 3300046660 Ga0495625_0054593 Ga0495625_0054593_142_1203 348
241 3300046674 Ga0495588_0008286 Ga0495588_0008286_670_1743 348
242 3300046674 Ga0495588_0066016 Ga0495588_0066016_706_1776 348
243 3300053108 Ga0500562_009099 Ga0500562_009099_828_1889 348
244 3300053134 Ga0500658_0000180 Ga0500658_0000180_28597_29658 348
245 3300053139 Ga0500568_0000864 Ga0500568_0000864_19533_20594 348
246 3300053153 Ga0500616_0090579 Ga0500616_0090579_381_1442 348
247 iso_pu_bacteria 2738541307 2738886627 348
248 iso_pu_bacteria 2881101125 2881101168 348
249 iso_pu_bacteria 2928084124 2928087122 348
250 3300031238 Ga0265332_10001920 Ga0265332_100019203 349
251 iso_pu_bacteria 2643221654 2644304112 349
252 iso_pu_bacteria 2738543013 2739252275 349
253 3300003784 Ga0055534_1009504 Ga0055534_10095042 350
254 3300006844 Ga0075428_100065380 Ga0075428_1000653803 350
255 3300025292 Ga0209676_1006079 Ga0209676_10060793 350
256 3300025304 Ga0209257_1016040 Ga0209257_10160402 350
257 3300026095 Ga0207676_10017877 Ga0207676_100178772 350
258 3300025292 Ga0209676_1002922 Ga0209676_10029227 351
259 3300025303 Ga0209051_1002364 Ga0209051_10023647 351
260 3300025304 Ga0209257_1006334 Ga0209257_10063344 351
261 3300031731 Ga0307405_10009955 Ga0307405_100099554 351
262 iso_pu_bacteria 2643221683 2644467633 351
263 3300005367 Ga0070667_100006076 Ga0070667_1000060763 355
264 3300025986 Ga0207658_10004133 Ga0207658_100041338 355
265 3300031728 Ga0316578_10001590 Ga0316578_100015907 355
266 3300035725 Ga0373947_0241563 Ga0373947_0241563_16_1092 355
267 3300037068 Ga0373925_0077575 Ga0373925_0077575_1264_2340 355
268 3300046492 Ga0495585_0012962 Ga0495585_0012962_1809_3017 355
269 3300005364 Ga0070673_100011599 Ga0070673_1000115994 356
270 3300025960 Ga0207651_10002388 Ga0207651_100023885 356
271 3300025303 Ga0209051_1000770 Ga0209051_100077019 361
272 3300025949 Ga0207667_10079406 Ga0207667_100794062 362
273 3300005327 Ga0070658_10099333 Ga0070658_100993332 367
274 3300005330 Ga0070690_100010988 Ga0070690_1000109886 367
275 3300005563 Ga0068855_100000405 Ga0068855_10000040540 367
276 3300005719 Ga0068861_100038339 Ga0068861_1000383395 367
277 3300025256 Ga0209759_1001283 Ga0209759_10012832 367
278 3300025949 Ga0207667_10007080 Ga0207667_100070807 367
279 3300005339 Ga0070660_100029506 Ga0070660_1000295061 368
280 3300005366 Ga0070659_100009180 Ga0070659_1000091803 368
281 3300005563 Ga0068855_100064160 Ga0068855_1000641606 368
282 3300009093 Ga0105240_10051037 Ga0105240_100510374 368
283 3300025256 Ga0209759_1002072 Ga0209759_10020729 368
284 3300025913 Ga0207695_10075325 Ga0207695_100753252 368
285 3300025919 Ga0207657_10017817 Ga0207657_100178172 368
286 3300025932 Ga0207690_10050601 Ga0207690_100506012 368
287 3300003752 Ga0055539_1000155 Ga0055539_100015539 369
288 3300003756 Ga0055533_1000028 Ga0055533_1000028124 369
289 3300025226 Ga0209674_100007 Ga0209674_100007919 369
290 3300025230 Ga0209563_100033 Ga0209563_100033122 369
291 3300025253 Ga0209677_100082 Ga0209677_10008267 369
292 3300005327 Ga0070658_10059695 Ga0070658_100596952 372
293 3300003323 rootH1_10031932 rootH1_100319322 373
294 3300048912 Ga0496109_0183289 Ga0496109_0183289_658_1869 374
295 3300053080 Ga0500635_0000160 Ga0500635_0000160_31114_32316 374
296 3300003320 rootH2_10002841 rootH2_1000284111 376
297 3300009148 Ga0105243_10017939 Ga0105243_100179395 376
298 3300025935 Ga0207709_10088486 Ga0207709_100884862 376
299 3300038443 Ga0395901_0038816 Ga0395901_0038816_528_1658 376
300 3300046475 Ga0495639_0004933 Ga0495639_0004933_1174_2340 376
301 3300025242 Ga0209258_100655 Ga0209258_10065515 377
302 3300046506 Ga0495583_0000245 Ga0495583_0000245_75782_76945 377
303 3300046507 Ga0495606_0092797 Ga0495606_0092797_129_1292 377
304 3300046660 Ga0495625_0003582 Ga0495625_0003582_11759_12922 377
305 3300046684 Ga0495669_0032072 Ga0495669_0032072_576_1739 377
306 3300046694 Ga0495649_0000400 Ga0495649_0000400_12502_13665 377
307 3300046794 Ga0495589_0049481 Ga0495589_0049481_229_1392 377
308 3300055283 Ga0500661_005716 Ga0500661_005716_682_1845 377
309 3300025303 Ga0209051_1001370 Ga0209051_10013705 378
310 3300025949 Ga0207667_10446382 Ga0207667_104463821 378
311 3300035691 Ga0373931_0002383 Ga0373931_0002383_893_2065 378
312 3300002705 JGI25156J39149_1000107 JGI25156J39149_100010721 380
313 3300002738 JGI25154J39366_1001935 JGI25154J39366_10019358 380
314 3300002741 JGI25157J39369_1000020 JGI25157J39369_1000020125 380
315 3300003316 rootH1_10000505 rootH1_100005051 380
316 3300003323 rootH1_10050444 rootH1_100504442 380
317 3300003752 Ga0055539_1000799 Ga0055539_10007993 380
318 3300003761 Ga0055535_1000575 Ga0055535_100057519 380
319 3300003763 Ga0055529_1000619 Ga0055529_100061915 380
320 3300005539 Ga0068853_100015947 Ga0068853_1000159474 380
321 3300005577 Ga0068857_100003994 Ga0068857_1000039944 380
322 3300005578 Ga0068854_100066074 Ga0068854_1000660741 380
323 3300005614 Ga0068856_100000790 Ga0068856_10000079010 380
324 3300006353 Ga0075370_10083922 Ga0075370_100839222 380
325 3300009093 Ga0105240_10015439 Ga0105240_100154399 380
326 3300009545 Ga0105237_10069964 Ga0105237_100699642 380
327 3300009551 Ga0105238_10060386 Ga0105238_100603865 380
328 3300010375 Ga0105239_10043505 Ga0105239_100435052 380
329 3300013307 Ga0157372_10280073 Ga0157372_102800732 380
330 3300025231 Ga0207427_100501 Ga0207427_1005018 380
331 3300025242 Ga0209258_100575 Ga0209258_10057519 380
332 3300025246 Ga0209646_1000062 Ga0209646_100006267 380
333 3300025250 Ga0209026_1000026 Ga0209026_1000026146 380
334 3300025253 Ga0209677_100116 Ga0209677_10011636 380
335 3300025256 Ga0209759_1000050 Ga0209759_100005036 380
336 3300025256 Ga0209759_1000916 Ga0209759_10009162 380
337 3300025272 Ga0209455_1000093 Ga0209455_1000093175 380
338 3300025914 Ga0207671_10032164 Ga0207671_100321645 380
339 3300025949 Ga0207667_10042485 Ga0207667_100424852 380
340 3300026078 Ga0207702_10000225 Ga0207702_1000022525 380
341 3300026116 Ga0207674_10013546 Ga0207674_100135464 380
342 3300026116 Ga0207674_10152263 Ga0207674_101522632 380
343 3300035086 Ga0373934_0010396 Ga0373934_0010396_2031_3194 380
344 3300050496 nmdc:mga07m45_75726_c1 nmdc:mga07m45_75726_c1_399_1598 380

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17186

Lipocalin_9

Lipocalin-like domain

270

400

0.96

PF07143

CrtC

CrtC N-terminal lipocalin domain

61

267

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9272 36 371
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.921 33 371
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9126 33 371
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9077 36 371
7a0q-assembly1.cif.gz_A crystal structure of kievitone hydratase from nectria haematococca (c2 sg) 0.6989 34 373
ID Description Score Start End Superfamily
2ichA02 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9245 245 371 2.40.370.10
2ichA02 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9105 245 371 2.40.370.10
2ichA01 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8876 43 244 2.40.370.10
2ichA01 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8829 43 244 2.40.370.10
af_O86370_59_249_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.877 43 242 2.40.370.10
ID Description Score Start End GO Terms
AF-A0A257GX40-F1-model_v4 Uncharacterized protein 0.9813 255 377
AF-A0A4Q3K823-F1-model_v4 deleted 0.9748 183 377
AF-A0A3C0KDV8-F1-model_v4 Carotenoid 1,2-hydratase 0.9732 234 377
AF-A0A2N2V8H4-F1-model_v4 Carotenoid 1,2-hydratase 0.9701 164 377
AF-A0A4Q3K823-F1-model_v4 deleted 0.9602 183 377

Feature Viewer

pLDDT pTM Quality
87.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map