F415956

General Info

Members Datasets Scaffolds Average Seq Length
344 211 688 147

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10545960|Ga0105239_105459602
Length 167
Sequence MAAAPVAPVVGEGLSPDARGPIYTVLAFDFGLKRIGLASGDTLTQTAAPRPAVAVSHSGPDWAAIERELRSLHPRILVVGAPYNADGTPGKMAPAARRFAAELEKRFSLPVNMVDERWSSLEANEALKAQRASGERRKRIRREDIDSAAAAVILERWFAGEFEGHVR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
198 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
207 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 0
Rhizoplane 3.78
Rhizosphere 78.2
Stem 0
Stem Tuber 0
Unclassified 20.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10545960 3300010375 Unclassified 1320
2 JGI24033J26618_1028521 3300002155 Bacteria 743
3 rootH1_10063188 3300003316 Bacteria 1109
4 rootH1_10105766 3300003316 Bacteria 3796
5 rootL2_10080558 3300003322 Bacteria 2531
6 rootH1_10302356 3300003323 Bacteria 1493
7 JGI25405J52794_10029261 3300003911 Bacteria 1139
8 Ga0058862_11460833 3300004803 Unclassified 561
9 Ga0070683_100132207 3300005329 Unclassified 2362
10 Ga0070683_101646773 3300005329 Unclassified 617
11 Ga0070670_100805137 3300005331 Bacteria 849
12 Ga0070677_10003653 3300005333 Bacteria 4970
13 Ga0068869_100277026 3300005334 Bacteria 1348
14 Ga0068869_100312109 3300005334 Bacteria 1273
15 Ga0070666_10161393 3300005335 Bacteria 1567
16 Ga0070666_10870065 3300005335 Unclassified 665
17 Ga0070680_100016460 3300005336 Bacteria 5820
18 Ga0070680_100036544 3300005336 Bacteria 3968
19 Ga0070682_100274145 3300005337 Bacteria 1227
20 Ga0070682_100476622 3300005337 Bacteria 961
21 Ga0070689_100600550 3300005340 Unclassified 953
22 Ga0070691_10128875 3300005341 Bacteria 1280
23 Ga0070687_100122994 3300005343 Bacteria 1487
24 Ga0070661_100261149 3300005344 Unclassified 1339
25 Ga0070692_10326351 3300005345 Bacteria 946
26 Ga0070669_100399187 3300005353 Bacteria 1125
27 Ga0070675_100036828 3300005354 Bacteria 3983
28 Ga0070671_100555070 3300005355 Bacteria 991
29 Ga0070674_100257388 3300005356 Bacteria 1373
30 Ga0070673_100040574 3300005364 Bacteria 3572
31 Ga0070659_100588908 3300005366 Bacteria 955
32 Ga0070667_100028722 3300005367 Unclassified 4631
33 Ga0070667_100377715 3300005367 Bacteria 1287
34 Ga0070700_100261413 3300005441 Bacteria 1246
35 Ga0070663_101071049 3300005455 Unclassified 704
36 Ga0070681_10010369 3300005458 Bacteria 9201
37 Ga0070681_10026936 3300005458 Bacteria 5780
38 Ga0070681_10077651 3300005458 Bacteria 3278
39 Ga0070681_10096541 3300005458 Unclassified 2903
40 Ga0070685_10049751 3300005466 Bacteria 2419
41 Ga0070679_100004886 3300005530 Bacteria 12364
42 Ga0070679_100083203 3300005530 Bacteria 3189
43 Ga0070679_100138667 3300005530 Bacteria 2413
44 Ga0070679_100259491 3300005530 Unclassified 1693
45 Ga0068853_100128153 3300005539 Bacteria 2269
46 Ga0070672_100009261 3300005543 Bacteria 6781
47 Ga0070693_101096762 3300005547 Unclassified 607
48 Ga0070665_100045719 3300005548 Bacteria 4397
49 Ga0070665_100071686 3300005548 Bacteria 3471
50 Ga0070665_101037429 3300005548 Bacteria 832
51 Ga0068855_100001758 3300005563 Bacteria 27060
52 Ga0068855_100004574 3300005563 Bacteria 16898
53 Ga0068855_100429584 3300005563 Bacteria 1444
54 Ga0070664_100209617 3300005564 Bacteria 1741
55 Ga0068854_100515336 3300005578 Bacteria 1009
56 Ga0068856_100386198 3300005614 Bacteria 1420
57 Ga0068859_100044060 3300005617 Unclassified 4484
58 Ga0068859_100186731 3300005617 Bacteria 2157
59 Ga0068859_100706448 3300005617 Bacteria 1099
60 Ga0068863_100000722 3300005841 Bacteria 33129
61 Ga0068863_100025221 3300005841 Bacteria 5667
62 Ga0068863_100562182 3300005841 Bacteria 1127
63 Ga0068858_100012007 3300005842 Bacteria 8166
64 Ga0068858_100071551 3300005842 Bacteria 3217
65 Ga0068858_100213805 3300005842 Bacteria 1825
66 Ga0068858_102161826 3300005842 Bacteria 550
67 Ga0068860_100035031 3300005843 Bacteria 4816
68 Ga0068860_101254289 3300005843 Unclassified 762
69 Ga0068862_100004513 3300005844 Bacteria 11736
70 Ga0068862_100054584 3300005844 Bacteria 3421
71 Ga0068862_100242499 3300005844 Bacteria 1639
72 Ga0068862_100695131 3300005844 Bacteria 985
73 Ga0068862_100774640 3300005844 Unclassified 935
74 Ga0081455_10020730 3300005937 Bacteria 6182
75 Ga0081539_10000011 3300005985 Bacteria 461887
76 Ga0097621_100914442 3300006237 Bacteria 818
77 Ga0068865_100629616 3300006881 Bacteria 910
78 Ga0097620_100044060 3300006931 Unclassified 4484
79 Ga0097620_100186734 3300006931 Bacteria 2157
80 Ga0097620_100706440 3300006931 Bacteria 1099
81 Ga0105240_10003246 3300009093 Bacteria 25453
82 Ga0105240_10011428 3300009093 Bacteria 12367
83 Ga0105240_10020092 3300009093 Bacteria 8915
84 Ga0105240_10073393 3300009093 Bacteria 4225
85 Ga0105240_10932130 3300009093 Bacteria 932
86 Ga0111539_10099269 3300009094 Bacteria 3419
87 Ga0105241_10829583 3300009174 Unclassified 854
88 Ga0105248_10139598 3300009177 Bacteria 2734
89 Ga0105237_10062908 3300009545 Bacteria 3710
90 Ga0105237_10196642 3300009545 Bacteria 2016
91 Ga0105237_10230985 3300009545 Unclassified 1851
92 Ga0105237_10487836 3300009545 Bacteria 1238
93 Ga0105237_10650911 3300009545 Unclassified 1060
94 Ga0105237_11591059 3300009545 Unclassified 660
95 Ga0105238_10034829 3300009551 Bacteria 5121
96 Ga0105238_10038904 3300009551 Bacteria 4829
97 Ga0105238_10042847 3300009551 Bacteria 4582
98 Ga0105238_10081750 3300009551 Bacteria 3220
99 Ga0105238_11066190 3300009551 Unclassified 830
100 Ga0105239_10319123 3300010375 Bacteria 1752
101 Ga0105239_10648489 3300010375 Bacteria 1206
102 Ga0105246_11162491 3300011119 Bacteria 708
103 Ga0157370_10016357 3300013104 Bacteria 7512
104 Ga0157369_10006257 3300013105 Bacteria 13815
105 Ga0157369_10383187 3300013105 Bacteria 1459
106 Ga0157374_11216681 3300013296 Bacteria 775
107 Ga0163162_10196530 3300013306 Bacteria 2146
108 Ga0163163_10089432 3300014325 Bacteria 3091
109 Ga0163163_11461939 3300014325 Bacteria 745
110 Ga0157380_10392468 3300014326 Unclassified 1314
111 Ga0157379_10306086 3300014968 Bacteria 1449
112 Ga0157379_10807751 3300014968 Unclassified 886
113 Ga0157376_10321244 3300014969 Bacteria 1472
114 Ga0157376_11020975 3300014969 Bacteria 850
115 Ga0206354_10688231 3300020081 Unclassified 578
116 Ga0213874_10008685 3300021377 Bacteria 2485
117 Ga0213876_10194264 3300021384 Bacteria 1079
118 Ga0228598_1025887 3300024227 Bacteria 1154
119 Ga0207696_1078190 3300025711 Unclassified 915
120 Ga0207682_10032579 3300025893 Bacteria 2095
121 Ga0207710_10453026 3300025900 Bacteria 663
122 Ga0207688_10216502 3300025901 Bacteria 1152
123 Ga0207680_10223945 3300025903 Bacteria 1290
124 Ga0207680_10245390 3300025903 Unclassified 1235
125 Ga0207699_10072633 3300025906 Bacteria 2108
126 Ga0207654_10171298 3300025911 Bacteria 1410
127 Ga0207707_10002752 3300025912 Bacteria 15679
128 Ga0207707_10036587 3300025912 Bacteria 4291
129 Ga0207707_10056165 3300025912 Bacteria 3425
130 Ga0207707_10070174 3300025912 Unclassified 3053
131 Ga0207695_10007202 3300025913 Bacteria 14227
132 Ga0207695_10014164 3300025913 Bacteria 9462
133 Ga0207695_10014238 3300025913 Bacteria 9434
134 Ga0207695_10064304 3300025913 Bacteria 3778
135 Ga0207695_10220253 3300025913 Bacteria 1805
136 Ga0207695_10320303 3300025913 Unclassified 1440
137 Ga0207693_10014961 3300025915 Bacteria 6231
138 Ga0207663_10288657 3300025916 Unclassified 1221
139 Ga0207660_10017921 3300025917 Bacteria 4714
140 Ga0207660_10597758 3300025917 Unclassified 898
141 Ga0207652_10004756 3300025921 Bacteria 11004
142 Ga0207652_10061766 3300025921 Bacteria 3236
143 Ga0207652_10281400 3300025921 Unclassified 1501
144 Ga0207652_10419868 3300025921 Unclassified 1206
145 Ga0207694_10047156 3300025924 Bacteria 3332
146 Ga0207694_10050537 3300025924 Unclassified 3220
147 Ga0207694_10160375 3300025924 Bacteria 1816
148 Ga0207694_10794803 3300025924 Bacteria 799
149 Ga0207644_10580004 3300025931 Bacteria 930
150 Ga0207665_10114744 3300025939 Bacteria 1897
151 Ga0207691_10002419 3300025940 Bacteria 18265
152 Ga0207711_10989938 3300025941 Unclassified 780
153 Ga0207689_10421177 3300025942 Bacteria 1114
154 Ga0207689_10437137 3300025942 Bacteria 1093
155 Ga0207661_10100560 3300025944 Unclassified 2427
156 Ga0207667_10020429 3300025949 Bacteria 7366
157 Ga0207667_10063850 3300025949 Bacteria 3847
158 Ga0207667_10196126 3300025949 Bacteria 2072
159 Ga0207667_11041993 3300025949 Unclassified 804
160 Ga0207651_10347255 3300025960 Bacteria 1248
161 Ga0207712_10048605 3300025961 Bacteria 2951
162 Ga0207712_10216139 3300025961 Bacteria 1530
163 Ga0207668_11609405 3300025972 Bacteria 586
164 Ga0207640_10156498 3300025981 Bacteria 1680
165 Ga0207640_10421937 3300025981 Bacteria 1092
166 Ga0207658_10116857 3300025986 Bacteria 2119
167 Ga0207658_10279935 3300025986 Unclassified 1429
168 Ga0207677_10503822 3300026023 Bacteria 1047
169 Ga0207703_10000220 3300026035 Bacteria 66005
170 Ga0207639_10145073 3300026041 Bacteria 1982
171 Ga0207678_10103918 3300026067 Unclassified 2424
172 Ga0207702_10358832 3300026078 Bacteria 1396
173 Ga0207641_10000471 3300026088 Bacteria 45559
174 Ga0207641_10382069 3300026088 Bacteria 1349
175 Ga0207641_10475580 3300026088 Unclassified 1210
176 Ga0207641_11060236 3300026088 Unclassified 808
177 Ga0207641_11518492 3300026088 Bacteria 671
178 Ga0207675_100224291 3300026118 Bacteria 1811
179 Ga0207675_100470696 3300026118 Bacteria 1247
180 Ga0207675_101483726 3300026118 Bacteria 699
181 Ga0207683_10004100 3300026121 Bacteria 12587
182 Ga0207428_10439496 3300027907 Bacteria 952
183 Ga0268266_10004546 3300028379 Bacteria 13255
184 Ga0268266_10012000 3300028379 Bacteria 7500
185 Ga0268266_10017296 3300028379 Bacteria 6154
186 Ga0268266_10041660 3300028379 Bacteria 3919
187 Ga0268266_10144926 3300028379 Unclassified 2134
188 Ga0268265_10051126 3300028380 Bacteria 3118
189 Ga0268265_10197261 3300028380 Bacteria 1743
190 Ga0268265_10482489 3300028380 Bacteria 1164
191 Ga0268264_10001047 3300028381 Bacteria 27587
192 Ga0268264_12494277 3300028381 Unclassified 522
193 Ga0307515_10010871 3300028794 Bacteria 17367
194 Ga0307515_10327028 3300028794 Bacteria 1195
195 Ga0307515_10363533 3300028794 Unclassified 1087
196 Ga0307511_10002630 3300030521 Bacteria 18733
197 Ga0307513_10191670 3300031456 Bacteria 1895
198 Ga0307509_10074196 3300031507 Bacteria 3539
199 Ga0307509_10491762 3300031507 Bacteria 913
200 Ga0307509_10865794 3300031507 Unclassified 568
201 Ga0307509_10884854 3300031507 Bacteria 558
202 Ga0307406_11000156 3300031901 Unclassified 717
203 Ga0307412_10221765 3300031911 Bacteria 1450
204 Ga0307409_102021282 3300031995 Bacteria 606
205 Ga0307510_10000023 3300033180 Bacteria 155640
206 Ga0307510_10004123 3300033180 Bacteria 17059
207 Ga0373936_0001633 3300035113 Bacteria 8219
208 Ga0373931_0510064 3300035691 Bacteria 777
209 Ga0395900_0094152 3300037418 Bacteria 3077
210 Ga0395900_0166922 3300037418 Bacteria 2243
211 Ga0395898_0030812 3300037466 Bacteria 5365
212 Ga0395898_0040052 3300037466 Bacteria 4636
213 Ga0395898_0275052 3300037466 Bacteria 1606
214 Ga0436365_0012630 3300039437 Bacteria 10034
215 Ga0436365_0640936 3300039437 Unclassified 758
216 Ga0436361_0131482 3300039447 Bacteria 883
217 Ga0436363_0390155 3300039450 Bacteria 15470
218 Ga0436363_0396130 3300039450 Bacteria 4367
219 Ga0436363_0420958 3300039450 Bacteria 1780
220 Ga0451789_0731708 3300041443 Bacteria 861
221 Ga0451798_0803536 3300041458 Bacteria 1280
222 Ga0451798_1174374 3300041458 Unclassified 655
223 Ga0451800_1046609 3300041459 Bacteria 1076
224 Ga0451802_2019175 3300041460 Bacteria 1008
225 Ga0451804_0319875 3300041463 Unclassified 675
226 Ga0451807_2653646 3300041486 Bacteria 1038
227 Ga0451833_0515421 3300041491 Bacteria 841
228 Ga0451837_1119722 3300041494 Bacteria 2117
229 Ga0451843_1176304 3300041509 Unclassified 750
230 Ga0451853_1104529 3300041512 Unclassified 589
231 Ga0439446_0054431 3300042156 Bacteria 1200
232 Ga0466969_0007998 3300044656 Bacteria 5614
233 Ga0466969_0015552 3300044656 Bacteria 3986
234 Ga0466972_0129087 3300044658 Bacteria 1191
235 Ga0466966_0002522 3300044684 Bacteria 12003
236 Ga0466966_0032897 3300044684 Unclassified 3357
237 Ga0466966_0379892 3300044684 Bacteria 849
238 Ga0466964_0001600 3300044706 Bacteria 7807
239 Ga0466971_0000246 3300044719 Bacteria 20770
240 Ga0466968_0067430 3300044735 Unclassified 1552
241 Ga0466970_0000381 3300044765 Bacteria 21528
242 Ga0466957_0038785 3300044842 Bacteria 2871
243 Ga0466957_0281137 3300044842 Unclassified 1114
244 Ga0466959_0011489 3300045049 Bacteria 6365
245 Ga0466959_0012293 3300045049 Bacteria 6180
246 Ga0466959_0023066 3300045049 Bacteria 4604
247 Ga0466959_0067035 3300045049 Bacteria 2603
248 Ga0466958_0169739 3300045836 Unclassified 1381
249 Ga0466958_0628229 3300045836 Bacteria 699
250 Ga0466967_1248639 3300045976 Bacteria 740
251 Ga0495590_0001530 3300046457 Bacteria 9947
252 Ga0495590_0133372 3300046457 Bacteria 894
253 Ga0495638_0106790 3300046460 Bacteria 1668
254 Ga0495583_0029601 3300046506 Bacteria 2677
255 Ga0495606_0191220 3300046507 Bacteria 1173
256 Ga0495606_0417381 3300046507 Bacteria 695
257 Ga0495610_0318566 3300046512 Unclassified 594
258 Ga0495616_0001135 3300046513 Bacteria 18863
259 Ga0495616_0127007 3300046513 Bacteria 1172
260 Ga0495616_0312596 3300046513 Unclassified 661
261 Ga0495632_0062136 3300046519 Bacteria 1811
262 Ga0495597_0144382 3300046542 Bacteria 980
263 Ga0495597_0334623 3300046542 Unclassified 583
264 Ga0495668_0338781 3300046616 Unclassified 825
265 Ga0495668_0532671 3300046616 Bacteria 648
266 Ga0495625_0022637 3300046660 Bacteria 4815
267 Ga0495625_0076762 3300046660 Bacteria 2335
268 Ga0495625_0155405 3300046660 Bacteria 1535
269 Ga0495671_0106858 3300046692 Bacteria 1367
270 Ga0495649_0028857 3300046694 Bacteria 3075
271 Ga0495649_0057372 3300046694 Bacteria 2100
272 Ga0495649_0198161 3300046694 Unclassified 1044
273 Ga0495683_0289232 3300047323 Unclassified 707
274 Ga0495687_174215 3300047443 Unclassified 709
275 Ga0495686_0087473 3300047472 Bacteria 1895
276 Ga0495686_0134971 3300047472 Bacteria 1460
277 Ga0495686_0444458 3300047472 Bacteria 690
278 Ga0496100_0261461 3300048903 Bacteria 1284
279 Ga0496102_0003293 3300048905 Bacteria 13692
280 Ga0496106_0235454 3300048909 Bacteria 1463
281 Ga0496106_0534518 3300048909 Unclassified 941
282 Ga0496110_1260844 3300048913 Bacteria 648
283 Ga0496115_0581533 3300048918 Unclassified 892
284 Ga0496116_0037166 3300048919 Unclassified 3398
285 Ga0496117_0001017 3300048920 Bacteria 42848
286 Ga0496118_0001065 3300048921 Bacteria 42851
287 Ga0496119_0004121 3300048922 Bacteria 14641
288 Ga0496120_0000202 3300048923 Bacteria 102418
289 Ga0496121_0030611 3300048924 Bacteria 4939
290 Ga0496121_0103075 3300048924 Unclassified 2196
291 Ga0496121_0220445 3300048924 Bacteria 1336
292 Ga0496125_0006505 3300048928 Bacteria 12605
293 Ga0496125_0010546 3300048928 Bacteria 9342
294 Ga0496126_0124905 3300048929 Bacteria 2228
295 Ga0496126_0159876 3300048929 Unclassified 1925
296 Ga0496126_0354991 3300048929 Unclassified 1198
297 Ga0495678_040458 3300049459 Bacteria 1874
298 Ga0501039_0668042 3300049575 Bacteria 813
299 Ga0501041_0910256 3300049577 Unclassified 565
300 Ga0501042_0602182 3300049578 Bacteria 799
301 Ga0501047_0445820 3300049581 Bacteria 1124
302 Ga0501047_0761256 3300049581 Bacteria 784
303 Ga0501048_0473590 3300049582 Bacteria 897
304 Ga0501067_0368428 3300049583 Unclassified 801
305 Ga0501068_0002980 3300049584 Bacteria 9023
306 Ga0501070_0393206 3300049586 Bacteria 1122
307 Ga0501071_0069167 3300049587 Bacteria 2570
308 Ga0501072_0049064 3300049588 Bacteria 3323
309 Ga0501073_0045563 3300049589 Bacteria 3088
310 Ga0501074_0007099 3300049590 Bacteria 8095
311 Ga0501076_0010007 3300049592 Bacteria 7016
312 Ga0501077_0022439 3300049593 Bacteria 3998
313 Ga0501077_0689836 3300049593 Bacteria 656
314 Ga0501079_0000692 3300049741 Bacteria 22699
315 Ga0501080_0013825 3300049742 Bacteria 7431
316 Ga0501083_0004157 3300049744 Bacteria 10197
317 Ga0501083_0189656 3300049744 Bacteria 1342
318 Ga0500644_0263367 3300053088 Bacteria 730
319 Ga0500646_0022354 3300053090 Bacteria 1692
320 Ga0500583_0062570 3300053092 Bacteria 1760
321 Ga0500583_0069313 3300053092 Bacteria 1684
322 Ga0500583_0225901 3300053092 Unclassified 927
323 Ga0500651_0750303 3300053093 Bacteria 518
324 Ga0500641_0015724 3300053096 Bacteria 2814
325 Ga0500641_0192304 3300053096 Bacteria 873
326 Ga0500593_086281 3300053117 Bacteria 1336
327 Ga0500594_0229835 3300053118 Unclassified 614
328 Ga0500617_004762 3300053124 Bacteria 5114
329 Ga0500652_300896 3300053131 Unclassified 620
330 Ga0500658_0024747 3300053134 Bacteria 2302
331 Ga0500568_0132050 3300053139 Bacteria 928
332 Ga0500577_0090420 3300053142 Bacteria 1236
333 Ga0500588_0128412 3300053146 Bacteria 900
334 Ga0500590_103671 3300053148 Bacteria 1362
335 Ga0500616_0000182 3300053153 Bacteria 103375
336 Ga0500616_0036161 3300053153 Bacteria 2681
337 Ga0500622_0009293 3300053156 Bacteria 5448
338 Ga0500637_0007685 3300053178 Bacteria 5404
339 Ga0500611_012367 3300053727 Bacteria 1438
340 Ga0500611_023313 3300053727 Bacteria 1204
341 Ga0501084_0053909 3300054114 Bacteria 3363
342 Ga0501082_0059578 3300060353 Bacteria 3290
343 Ga0466962_0000405 3300061719 Bacteria 18653
344 Ga0530510_0127355 3300061734 Bacteria 1872
345 Ga0105239_10545960
346 JGI24033J26618_1028521
347 rootH1_10063188
348 rootH1_10105766
349 rootL2_10080558
350 rootH1_10302356
351 JGI25405J52794_10029261
352 Ga0058862_11460833
353 Ga0070683_100132207
354 Ga0070683_101646773
355 Ga0070670_100805137
356 Ga0070677_10003653
357 Ga0068869_100277026
358 Ga0068869_100312109
359 Ga0070666_10161393
360 Ga0070666_10870065
361 Ga0070680_100016460
362 Ga0070680_100036544
363 Ga0070682_100274145
364 Ga0070682_100476622
365 Ga0070689_100600550
366 Ga0070691_10128875
367 Ga0070687_100122994
368 Ga0070661_100261149
369 Ga0070692_10326351
370 Ga0070669_100399187
371 Ga0070675_100036828
372 Ga0070671_100555070
373 Ga0070674_100257388
374 Ga0070673_100040574
375 Ga0070659_100588908
376 Ga0070667_100028722
377 Ga0070667_100377715
378 Ga0070700_100261413
379 Ga0070663_101071049
380 Ga0070681_10010369
381 Ga0070681_10026936
382 Ga0070681_10077651
383 Ga0070681_10096541
384 Ga0070685_10049751
385 Ga0070679_100004886
386 Ga0070679_100083203
387 Ga0070679_100138667
388 Ga0070679_100259491
389 Ga0068853_100128153
390 Ga0070672_100009261
391 Ga0070693_101096762
392 Ga0070665_100045719
393 Ga0070665_100071686
394 Ga0070665_101037429
395 Ga0068855_100001758
396 Ga0068855_100004574
397 Ga0068855_100429584
398 Ga0070664_100209617
399 Ga0068854_100515336
400 Ga0068856_100386198
401 Ga0068859_100044060
402 Ga0068859_100186731
403 Ga0068859_100706448
404 Ga0068863_100000722
405 Ga0068863_100025221
406 Ga0068863_100562182
407 Ga0068858_100012007
408 Ga0068858_100071551
409 Ga0068858_100213805
410 Ga0068858_102161826
411 Ga0068860_100035031
412 Ga0068860_101254289
413 Ga0068862_100004513
414 Ga0068862_100054584
415 Ga0068862_100242499
416 Ga0068862_100695131
417 Ga0068862_100774640
418 Ga0081455_10020730
419 Ga0081539_10000011
420 Ga0097621_100914442
421 Ga0068865_100629616
422 Ga0097620_100044060
423 Ga0097620_100186734
424 Ga0097620_100706440
425 Ga0105240_10003246
426 Ga0105240_10011428
427 Ga0105240_10020092
428 Ga0105240_10073393
429 Ga0105240_10932130
430 Ga0111539_10099269
431 Ga0105241_10829583
432 Ga0105248_10139598
433 Ga0105237_10062908
434 Ga0105237_10196642
435 Ga0105237_10230985
436 Ga0105237_10487836
437 Ga0105237_10650911
438 Ga0105237_11591059
439 Ga0105238_10034829
440 Ga0105238_10038904
441 Ga0105238_10042847
442 Ga0105238_10081750
443 Ga0105238_11066190
444 Ga0105239_10319123
445 Ga0105239_10648489
446 Ga0105246_11162491
447 Ga0157370_10016357
448 Ga0157369_10006257
449 Ga0157369_10383187
450 Ga0157374_11216681
451 Ga0163162_10196530
452 Ga0163163_10089432
453 Ga0163163_11461939
454 Ga0157380_10392468
455 Ga0157379_10306086
456 Ga0157379_10807751
457 Ga0157376_10321244
458 Ga0157376_11020975
459 Ga0206354_10688231
460 Ga0213874_10008685
461 Ga0213876_10194264
462 Ga0228598_1025887
463 Ga0207696_1078190
464 Ga0207682_10032579
465 Ga0207710_10453026
466 Ga0207688_10216502
467 Ga0207680_10223945
468 Ga0207680_10245390
469 Ga0207699_10072633
470 Ga0207654_10171298
471 Ga0207707_10002752
472 Ga0207707_10036587
473 Ga0207707_10056165
474 Ga0207707_10070174
475 Ga0207695_10007202
476 Ga0207695_10014164
477 Ga0207695_10014238
478 Ga0207695_10064304
479 Ga0207695_10220253
480 Ga0207695_10320303
481 Ga0207693_10014961
482 Ga0207663_10288657
483 Ga0207660_10017921
484 Ga0207660_10597758
485 Ga0207652_10004756
486 Ga0207652_10061766
487 Ga0207652_10281400
488 Ga0207652_10419868
489 Ga0207694_10047156
490 Ga0207694_10050537
491 Ga0207694_10160375
492 Ga0207694_10794803
493 Ga0207644_10580004
494 Ga0207665_10114744
495 Ga0207691_10002419
496 Ga0207711_10989938
497 Ga0207689_10421177
498 Ga0207689_10437137
499 Ga0207661_10100560
500 Ga0207667_10020429
501 Ga0207667_10063850
502 Ga0207667_10196126
503 Ga0207667_11041993
504 Ga0207651_10347255
505 Ga0207712_10048605
506 Ga0207712_10216139
507 Ga0207668_11609405
508 Ga0207640_10156498
509 Ga0207640_10421937
510 Ga0207658_10116857
511 Ga0207658_10279935
512 Ga0207677_10503822
513 Ga0207703_10000220
514 Ga0207639_10145073
515 Ga0207678_10103918
516 Ga0207702_10358832
517 Ga0207641_10000471
518 Ga0207641_10382069
519 Ga0207641_10475580
520 Ga0207641_11060236
521 Ga0207641_11518492
522 Ga0207675_100224291
523 Ga0207675_100470696
524 Ga0207675_101483726
525 Ga0207683_10004100
526 Ga0207428_10439496
527 Ga0268266_10004546
528 Ga0268266_10012000
529 Ga0268266_10017296
530 Ga0268266_10041660
531 Ga0268266_10144926
532 Ga0268265_10051126
533 Ga0268265_10197261
534 Ga0268265_10482489
535 Ga0268264_10001047
536 Ga0268264_12494277
537 Ga0307515_10010871
538 Ga0307515_10327028
539 Ga0307515_10363533
540 Ga0307511_10002630
541 Ga0307513_10191670
542 Ga0307509_10074196
543 Ga0307509_10491762
544 Ga0307509_10865794
545 Ga0307509_10884854
546 Ga0307406_11000156
547 Ga0307412_10221765
548 Ga0307409_102021282
549 Ga0307510_10000023
550 Ga0307510_10004123
551 Ga0373936_0001633
552 Ga0373931_0510064
553 Ga0395900_0094152
554 Ga0395900_0166922
555 Ga0395898_0030812
556 Ga0395898_0040052
557 Ga0395898_0275052
558 Ga0436365_0012630
559 Ga0436365_0640936
560 Ga0436361_0131482
561 Ga0436363_0390155
562 Ga0436363_0396130
563 Ga0436363_0420958
564 Ga0451789_0731708
565 Ga0451798_0803536
566 Ga0451798_1174374
567 Ga0451800_1046609
568 Ga0451802_2019175
569 Ga0451804_0319875
570 Ga0451807_2653646
571 Ga0451833_0515421
572 Ga0451837_1119722
573 Ga0451843_1176304
574 Ga0451853_1104529
575 Ga0439446_0054431
576 Ga0466969_0007998
577 Ga0466969_0015552
578 Ga0466972_0129087
579 Ga0466966_0002522
580 Ga0466966_0032897
581 Ga0466966_0379892
582 Ga0466964_0001600
583 Ga0466971_0000246
584 Ga0466968_0067430
585 Ga0466970_0000381
586 Ga0466957_0038785
587 Ga0466957_0281137
588 Ga0466959_0011489
589 Ga0466959_0012293
590 Ga0466959_0023066
591 Ga0466959_0067035
592 Ga0466958_0169739
593 Ga0466958_0628229
594 Ga0466967_1248639
595 Ga0495590_0001530
596 Ga0495590_0133372
597 Ga0495638_0106790
598 Ga0495583_0029601
599 Ga0495606_0191220
600 Ga0495606_0417381
601 Ga0495610_0318566
602 Ga0495616_0001135
603 Ga0495616_0127007
604 Ga0495616_0312596
605 Ga0495632_0062136
606 Ga0495597_0144382
607 Ga0495597_0334623
608 Ga0495668_0338781
609 Ga0495668_0532671
610 Ga0495625_0022637
611 Ga0495625_0076762
612 Ga0495625_0155405
613 Ga0495671_0106858
614 Ga0495649_0028857
615 Ga0495649_0057372
616 Ga0495649_0198161
617 Ga0495683_0289232
618 Ga0495687_174215
619 Ga0495686_0087473
620 Ga0495686_0134971
621 Ga0495686_0444458
622 Ga0496100_0261461
623 Ga0496102_0003293
624 Ga0496106_0235454
625 Ga0496106_0534518
626 Ga0496110_1260844
627 Ga0496115_0581533
628 Ga0496116_0037166
629 Ga0496117_0001017
630 Ga0496118_0001065
631 Ga0496119_0004121
632 Ga0496120_0000202
633 Ga0496121_0030611
634 Ga0496121_0103075
635 Ga0496121_0220445
636 Ga0496125_0006505
637 Ga0496125_0010546
638 Ga0496126_0124905
639 Ga0496126_0159876
640 Ga0496126_0354991
641 Ga0495678_040458
642 Ga0501039_0668042
643 Ga0501041_0910256
644 Ga0501042_0602182
645 Ga0501047_0445820
646 Ga0501047_0761256
647 Ga0501048_0473590
648 Ga0501067_0368428
649 Ga0501068_0002980
650 Ga0501070_0393206
651 Ga0501071_0069167
652 Ga0501072_0049064
653 Ga0501073_0045563
654 Ga0501074_0007099
655 Ga0501076_0010007
656 Ga0501077_0022439
657 Ga0501077_0689836
658 Ga0501079_0000692
659 Ga0501080_0013825
660 Ga0501083_0004157
661 Ga0501083_0189656
662 Ga0500644_0263367
663 Ga0500646_0022354
664 Ga0500583_0062570
665 Ga0500583_0069313
666 Ga0500583_0225901
667 Ga0500651_0750303
668 Ga0500641_0015724
669 Ga0500641_0192304
670 Ga0500593_086281
671 Ga0500594_0229835
672 Ga0500617_004762
673 Ga0500652_300896
674 Ga0500658_0024747
675 Ga0500568_0132050
676 Ga0500577_0090420
677 Ga0500588_0128412
678 Ga0500590_103671
679 Ga0500616_0000182
680 Ga0500616_0036161
681 Ga0500622_0009293
682 Ga0500637_0007685
683 Ga0500611_012367
684 Ga0500611_023313
685 Ga0501084_0053909
686 Ga0501082_0059578
687 Ga0466962_0000405
688 Ga0530510_0127355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

23

160

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nu0-assembly1.cif.gz_A structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.9486 10 103
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.9163 10 106
1nu0-assembly2.cif.gz_B structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.889 10 106
1nmn-assembly2.cif.gz_B structure of yqgf from escherichia coli, a hypothetical protein 0.858 10 112
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.7945 10 110
ID Description Score Start End Superfamily
1nu0A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.948 10 103 3.30.420.140
1vhxB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8351 11 106 3.30.420.140
af_Q2FXW1_3_142_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8066 10 116 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8002 11 116 3.30.420.140
3ebgA01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.7705 11 26 2.60.40.1730
ID Description Score Start End GO Terms
AF-A0A6F8PL22-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9567 10 103 GO:0000967
GO:0004518
GO:0005829
AF-A0A3M1V350-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9564 11 103 GO:0000967
GO:0004518
GO:0005829
AF-A0A7Z8D1X0-F1-model_v4 deleted 0.9558 8 102
AF-A0A836X800-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9496 5 103 GO:0000967
GO:0004518
GO:0005829
AF-A0A7Z8D1X0-F1-model_v4 deleted 0.9367 8 102

Map