F415895

General Info

Members Datasets Scaffolds Average Seq Length
344 93 648 554

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100009659|Ga0068862_1000096594
Length 569
Sequence MPSNHTHTHGEAAPRQVNRREFLKHAGRGGVGATVLLAGAGRAARASAQSPTQYPDWIPMSTKAPKRGGVMTRASSWDPPVLDPRLTQSVGLFQFAGLTSNRLVRYVLPDEASGTNDLALKGDLAESWQPSTDNRVWTFKLRQGVKWQNVPPLNGRELVAADVKYCFEAYAKEGVQSFNFREIEGMETPDKHTLRVHLNTPNVLFPQNLAEPVTVIFAREVMEEDGDLKKRLIGTGPYILKEHSRKVRVVLARNPDYFDKGRQYLDEYVILSTPDAATRLAAFRTGQSDILWVASPSEAETVRKTNSAAVVQGLKTVLAPFGLTLAQDKPPFNDVRVRRAISMAIDRQKQVDTVFEGHGILGWGVPYIYYQDTMPTAAQLGPWWQYRPAEAKKLLADAGHPNGFETTLFYYEYFPQMTSQVQLVQQDLKKNLNINLKITKLDYTSYYGRYVDGKWDGMAWGFQSGHAVGVDERTYQYMYSKSTKNFFRVNDPVIDELATKLRQTPDRTEQRVITKKIVDRELDQVWRMWMPYDAGFLVFQPHVRNASALSLRRTDGYGSAAVARLWLDK

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.71
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100009659 3300005844 Bacteria 7974
2 Ga0065707_10013174 3300005295 Bacteria 2029
3 Ga0065707_10103422 3300005295 Unclassified 2749
4 Ga0065707_10108640 3300005295 Bacteria 2502
5 Ga0070690_100038246 3300005330 Bacteria 3027
6 Ga0070690_100094700 3300005330 Bacteria 1971
7 Ga0070670_100106029 3300005331 Bacteria 2422
8 Ga0068869_100001075 3300005334 Bacteria 15932
9 Ga0070689_100070403 3300005340 Bacteria 2731
10 Ga0070669_100009417 3300005353 Bacteria 6954
11 Ga0070705_100002703 3300005440 Bacteria 8862
12 Ga0070705_100024328 3300005440 Bacteria 3267
13 Ga0070700_100022025 3300005441 Bacteria 3711
14 Ga0070700_100036649 3300005441 Bacteria 2977
15 Ga0070708_100004701 3300005445 Bacteria 10759
16 Ga0070708_100009294 3300005445 Bacteria 7921
17 Ga0070708_100010505 3300005445 Bacteria 7505
18 Ga0070708_100053366 3300005445 Bacteria 3586
19 Ga0070708_100085229 3300005445 Bacteria 2867
20 Ga0068867_100035091 3300005459 Bacteria 3637
21 Ga0070706_100020077 3300005467 Bacteria 6157
22 Ga0070706_100020216 3300005467 Bacteria 6135
23 Ga0070706_100029391 3300005467 Bacteria 5064
24 Ga0070706_100036908 3300005467 Bacteria 4514
25 Ga0070706_100038011 3300005467 Bacteria 4444
26 Ga0070706_100075307 3300005467 Bacteria 3123
27 Ga0070706_100128162 3300005467 Unclassified 2367
28 Ga0070706_100233608 3300005467 Unclassified 1717
29 Ga0070707_100011894 3300005468 Bacteria 8123
30 Ga0070707_100013227 3300005468 Bacteria 7716
31 Ga0070707_100017904 3300005468 Bacteria 6662
32 Ga0070707_100029825 3300005468 Bacteria 5191
33 Ga0070707_100084533 3300005468 Bacteria 3066
34 Ga0070707_100115841 3300005468 Bacteria 2601
35 Ga0070707_100129826 3300005468 Bacteria 2450
36 Ga0070698_100006664 3300005471 Bacteria 12524
37 Ga0070698_100013240 3300005471 Bacteria 8727
38 Ga0070698_100014052 3300005471 Bacteria 8466
39 Ga0070698_100014522 3300005471 Bacteria 8313
40 Ga0070698_100051737 3300005471 Bacteria 4182
41 Ga0070698_100053598 3300005471 Bacteria 4098
42 Ga0070698_100057070 3300005471 Bacteria 3952
43 Ga0070698_100086326 3300005471 Unclassified 3124
44 Ga0070698_100086929 3300005471 Unclassified 3112
45 Ga0070698_100130410 3300005471 Bacteria 2470
46 Ga0070699_100010567 3300005518 Bacteria 7991
47 Ga0070699_100016408 3300005518 Bacteria 6361
48 Ga0070699_100018302 3300005518 Bacteria 6020
49 Ga0070699_100022477 3300005518 Bacteria 5436
50 Ga0070699_100023923 3300005518 Bacteria 5265
51 Ga0070699_100043509 3300005518 Bacteria 3886
52 Ga0070699_100052500 3300005518 Bacteria 3527
53 Ga0070699_100054033 3300005518 Bacteria 3476
54 Ga0070699_100086964 3300005518 Unclassified 2728
55 Ga0070697_100009238 3300005536 Bacteria 7705
56 Ga0070697_100010498 3300005536 Bacteria 7229
57 Ga0070697_100013033 3300005536 Bacteria 6517
58 Ga0070697_100016150 3300005536 Bacteria 5871
59 Ga0070697_100031185 3300005536 Bacteria 4286
60 Ga0070697_100091402 3300005536 Bacteria 2517
61 Ga0070697_100142890 3300005536 Bacteria 2013
62 Ga0070695_100019539 3300005545 Bacteria 4125
63 Ga0070695_100020772 3300005545 Bacteria 4011
64 Ga0070695_100047624 3300005545 Bacteria 2739
65 Ga0070695_100062925 3300005545 Unclassified 2410
66 Ga0070696_100046185 3300005546 Bacteria 3019
67 Ga0070696_100060476 3300005546 Bacteria 2649
68 Ga0070696_100072215 3300005546 Unclassified 2430
69 Ga0070704_100077784 3300005549 Bacteria 2431
70 Ga0068859_100054731 3300005617 Bacteria 4014
71 Ga0068859_100105918 3300005617 Bacteria 2871
72 Ga0068861_100102096 3300005719 Bacteria 2283
73 Ga0068863_100005957 3300005841 Bacteria 11958
74 Ga0068860_100103833 3300005843 Bacteria 2713
75 Ga0068862_100017044 3300005844 Bacteria 6044
76 Ga0068862_100029905 3300005844 Bacteria 4590
77 Ga0081455_10001418 3300005937 Bacteria 29680
78 Ga0081538_10002408 3300005981 Bacteria 18363
79 Ga0081538_10013445 3300005981 Bacteria 6476
80 Ga0081538_10046044 3300005981 Bacteria 2696
81 Ga0081540_1004046 3300005983 Bacteria 11356
82 Ga0081539_10000044 3300005985 Bacteria 284021
83 Ga0070716_100004224 3300006173 Bacteria 6838
84 Ga0070712_100004330 3300006175 Bacteria 8745
85 Ga0070712_100008418 3300006175 Bacteria 6489
86 Ga0075428_100000977 3300006844 Bacteria 30258
87 Ga0075428_100002656 3300006844 Bacteria 19414
88 Ga0075428_100003308 3300006844 Bacteria 17625
89 Ga0075428_100015297 3300006844 Bacteria 8509
90 Ga0075428_100017629 3300006844 Bacteria 7888
91 Ga0075428_100053897 3300006844 Bacteria 4407
92 Ga0075428_100061315 3300006844 Bacteria 4119
93 Ga0075428_100076161 3300006844 Bacteria 3663
94 Ga0075428_100099624 3300006844 Bacteria 3169
95 Ga0075428_100111705 3300006844 Bacteria 2977
96 Ga0075428_100113864 3300006844 Bacteria 2947
97 Ga0075428_100123793 3300006844 Bacteria 2814
98 Ga0075430_100002575 3300006846 Bacteria 15127
99 Ga0075430_100004800 3300006846 Bacteria 11372
100 Ga0075430_100049045 3300006846 Bacteria 3564
101 Ga0075431_100000270 3300006847 Bacteria 40180
102 Ga0075431_100003078 3300006847 Bacteria 16159
103 Ga0075431_100004687 3300006847 Bacteria 13432
104 Ga0075431_100009485 3300006847 Bacteria 9772
105 Ga0075431_100067716 3300006847 Bacteria 3686
106 Ga0075431_100177588 3300006847 Bacteria 2186
107 Ga0075433_10000853 3300006852 Bacteria 21407
108 Ga0075433_10005048 3300006852 Bacteria 10342
109 Ga0075433_10016875 3300006852 Bacteria 6034
110 Ga0075433_10023536 3300006852 Bacteria 5186
111 Ga0075433_10029270 3300006852 Bacteria 4691
112 Ga0075433_10032861 3300006852 Bacteria 4446
113 Ga0075433_10059654 3300006852 Bacteria 3338
114 Ga0075433_10095869 3300006852 Bacteria 2625
115 Ga0075433_10096085 3300006852 Unclassified 2622
116 Ga0075433_10142118 3300006852 Bacteria 2133
117 Ga0075433_10177509 3300006852 Bacteria 1895
118 Ga0075434_100003913 3300006871 Bacteria 13336
119 Ga0075434_100014133 3300006871 Bacteria 7624
120 Ga0075434_100024053 3300006871 Bacteria 5950
121 Ga0075434_100028152 3300006871 Bacteria 5520
122 Ga0075434_100034228 3300006871 Bacteria 5016
123 Ga0075434_100040018 3300006871 Bacteria 4643
124 Ga0075434_100056543 3300006871 Bacteria 3899
125 Ga0075434_100070671 3300006871 Bacteria 3481
126 Ga0075434_100077241 3300006871 Bacteria 3325
127 Ga0075434_100083517 3300006871 Bacteria 3191
128 Ga0075434_100106427 3300006871 Unclassified 2814
129 Ga0075429_100013692 3300006880 Bacteria 7034
130 Ga0075429_100015303 3300006880 Bacteria 6647
131 Ga0075429_100092845 3300006880 Bacteria 2632
132 Ga0075436_100000497 3300006914 Bacteria 25423
133 Ga0075436_100013698 3300006914 Bacteria 5555
134 Ga0075436_100029289 3300006914 Bacteria 3786
135 Ga0075436_100106745 3300006914 Bacteria 1953
136 Ga0075436_100107716 3300006914 Bacteria 1944
137 Ga0097620_100054731 3300006931 Bacteria 4014
138 Ga0097620_100105924 3300006931 Bacteria 2871
139 Ga0075435_100008563 3300007076 Bacteria 7352
140 Ga0075435_100014305 3300007076 Bacteria 5926
141 Ga0075435_100029963 3300007076 Bacteria 4275
142 Ga0075435_100050342 3300007076 Bacteria 3352
143 Ga0075435_100064408 3300007076 Bacteria 2978
144 Ga0075435_100108784 3300007076 Unclassified 2303
145 Ga0075435_100123684 3300007076 Bacteria 2160
146 Ga0099794_10049928 3300007265 Bacteria 2012
147 Ga0111539_10001174 3300009094 Bacteria 34740
148 Ga0111539_10002256 3300009094 Bacteria 25698
149 Ga0111539_10021846 3300009094 Bacteria 7869
150 Ga0111539_10122019 3300009094 Bacteria 3054
151 Ga0111539_10167736 3300009094 Bacteria 2566
152 Ga0111539_10268664 3300009094 Bacteria 1985
153 Ga0105247_10089490 3300009101 Bacteria 1952
154 Ga0114129_10005678 3300009147 Bacteria 17662
155 Ga0114129_10010715 3300009147 Bacteria 13069
156 Ga0114129_10015226 3300009147 Bacteria 10948
157 Ga0114129_10018847 3300009147 Bacteria 9830
158 Ga0114129_10026023 3300009147 Bacteria 8285
159 Ga0114129_10034537 3300009147 Bacteria 7143
160 Ga0114129_10042581 3300009147 Bacteria 6392
161 Ga0114129_10048380 3300009147 Bacteria 5974
162 Ga0114129_10056575 3300009147 Bacteria 5493
163 Ga0114129_10066127 3300009147 Bacteria 5043
164 Ga0114129_10093890 3300009147 Bacteria 4155
165 Ga0114129_10097096 3300009147 Bacteria 4079
166 Ga0114129_10115257 3300009147 Bacteria 3704
167 Ga0114129_10118015 3300009147 Bacteria 3655
168 Ga0114129_10124678 3300009147 Bacteria 3542
169 Ga0114129_10131054 3300009147 Bacteria 3443
170 Ga0114129_10136083 3300009147 Bacteria 3371
171 Ga0114129_10139439 3300009147 Bacteria 3325
172 Ga0114129_10146922 3300009147 Bacteria 3229
173 Ga0114129_10413500 3300009147 Bacteria 1776
174 Ga0105243_10044103 3300009148 Bacteria 3497
175 Ga0105241_10094773 3300009174 Bacteria 2361
176 Ga0105241_10162856 3300009174 Bacteria 1835
177 Ga0105242_10009396 3300009176 Bacteria 7500
178 Ga0105249_10037535 3300009553 Bacteria 4397
179 Ga0105249_10123197 3300009553 Bacteria 2466
180 Ga0157373_10047606 3300013100 Bacteria 3057
181 Ga0157378_10187368 3300013297 Bacteria 1950
182 Ga0163162_10066867 3300013306 Bacteria 3644
183 Ga0163162_10201644 3300013306 Bacteria 2118
184 Ga0207684_10001269 3300025910 Bacteria 27858
185 Ga0207684_10003224 3300025910 Bacteria 16018
186 Ga0207684_10004391 3300025910 Bacteria 13299
187 Ga0207684_10005733 3300025910 Bacteria 11404
188 Ga0207684_10009551 3300025910 Bacteria 8555
189 Ga0207684_10033378 3300025910 Bacteria 4376
190 Ga0207684_10041088 3300025910 Unclassified 3923
191 Ga0207684_10066787 3300025910 Bacteria 3054
192 Ga0207684_10069921 3300025910 Bacteria 2983
193 Ga0207684_10096484 3300025910 Bacteria 2523
194 Ga0207654_10012657 3300025911 Bacteria 4326
195 Ga0207707_10086883 3300025912 Bacteria 2733
196 Ga0207693_10012982 3300025915 Bacteria 6720
197 Ga0207693_10016878 3300025915 Bacteria 5829
198 Ga0207660_10101873 3300025917 Bacteria 2146
199 Ga0207646_10000982 3300025922 Bacteria 36644
200 Ga0207646_10013265 3300025922 Bacteria 7883
201 Ga0207646_10014134 3300025922 Bacteria 7591
202 Ga0207646_10023546 3300025922 Bacteria 5655
203 Ga0207646_10025749 3300025922 Bacteria 5379
204 Ga0207646_10031222 3300025922 Bacteria 4824
205 Ga0207646_10035715 3300025922 Bacteria 4488
206 Ga0207646_10062655 3300025922 Bacteria 3320
207 Ga0207646_10117236 3300025922 Unclassified 2391
208 Ga0207706_10078904 3300025933 Bacteria 2896
209 Ga0207670_10031810 3300025936 Bacteria 3387
210 Ga0207665_10011585 3300025939 Bacteria 5793
211 Ga0207711_10006615 3300025941 Bacteria 9761
212 Ga0207689_10004754 3300025942 Bacteria 12249
213 Ga0207712_10027227 3300025961 Bacteria 3816
214 Ga0207712_10027686 3300025961 Bacteria 3786
215 Ga0207708_10079414 3300026075 Bacteria 2520
216 Ga0207648_10119020 3300026089 Bacteria 2321
217 Ga0207674_10035782 3300026116 Bacteria 5181
218 Ga0207674_10057048 3300026116 Bacteria 3961
219 Ga0207675_100073284 3300026118 Bacteria 3204
220 Ga0207675_100148416 3300026118 Bacteria 2231
221 Ga0207428_10000009 3300027907 Bacteria 410565
222 Ga0207428_10005677 3300027907 Bacteria 11592
223 Ga0207428_10007391 3300027907 Bacteria 10018
224 Ga0268265_10009537 3300028380 Bacteria 6555
225 Ga0268264_10065076 3300028381 Bacteria 3070
226 Ga0307416_100080861 3300032002 Bacteria 2745
227 Ga0373940_0004973 3300035088 Bacteria 2847
228 Ga0373931_0001088 3300035691 Bacteria 11516
229 Ga0373931_0006278 3300035691 Bacteria 5546
230 Ga0395900_0030228 3300037418 Bacteria 5561
231 Ga0395900_0030393 3300037418 Bacteria 5547
232 Ga0395900_0112538 3300037418 Bacteria 2795
233 Ga0395898_0006908 3300037466 Bacteria 12072
234 Ga0395898_0020616 3300037466 Bacteria 6696
235 Ga0395901_0001564 3300038443 Bacteria 23718
236 Ga0451577_0098471 3300042876 Bacteria 2612
237 Ga0451577_0171087 3300042876 Bacteria 1957
238 Ga0453683_0005447 3300044673 Bacteria 8881
239 Ga0453683_0025552 3300044673 Bacteria 3751
240 Ga0453683_0035774 3300044673 Bacteria 3128
241 Ga0453684_0010242 3300044712 Bacteria 16060
242 Ga0451576_0036750 3300045051 Bacteria 5190
243 Ga0451576_0089385 3300045051 Bacteria 3203
244 Ga0451576_0093610 3300045051 Bacteria 3124
245 Ga0495580_0009153 3300046472 Bacteria 7808
246 Ga0496102_0004695 3300048905 Bacteria 11559
247 Ga0501040_0001737 3300049576 Bacteria 13987
248 Ga0501075_0203810 3300049591 Bacteria 1509
249 Ga0501081_0024230 3300049743 Bacteria 4074
250 nmdc:mga05p37_108004_c1 3300050507 Bacteria 3423
251 nmdc:mga05p37_114075_c1 3300050507 Bacteria 3322
252 nmdc:mga05p37_14135_c1 3300050507 Bacteria 9580
253 nmdc:mga05p37_14182_c1 3300050507 Bacteria 9568
254 nmdc:mga05p37_15911_c1 3300050507 Bacteria 9050
255 nmdc:mga05p37_239101_c1 3300050507 Bacteria 2185
256 nmdc:mga05p37_24503_c1 3300050507 Bacteria 7335
257 nmdc:mga05p37_280769_c1 3300050507 Bacteria 1986
258 nmdc:mga05p37_29925_c1 3300050507 Bacteria 6646
259 nmdc:mga05p37_30339_c1 3300050507 Bacteria 6597
260 nmdc:mga05p37_31726_c1 3300050507 Bacteria 6457
261 nmdc:mga05p37_32664_c1 3300050507 Bacteria 6367
262 nmdc:mga05p37_41561_c1 3300050507 Bacteria 5645
263 nmdc:mga05p37_48523_c1 3300050507 Bacteria 5222
264 nmdc:mga05p37_63489_c1 3300050507 Bacteria 4545
265 nmdc:mga05p37_9364_c1 3300050507 Bacteria 11592
266 nmdc:mga05p37_95748_c1 3300050507 Bacteria 3199
267 nmdc:mga09592_135471_c1 3300050508 Bacteria 2121
268 nmdc:mga09592_140186_c1 3300050508 Unclassified 2084
269 nmdc:mga09592_16135_c1 3300050508 Bacteria 6105
270 nmdc:mga09592_46495_c1 3300050508 Bacteria 3656
271 nmdc:mga09592_5707_c1 3300050508 Bacteria 10151
272 nmdc:mga0qj67_32824_c1 3300050509 Bacteria 4050
273 nmdc:mga0qj67_67273_c1 3300050509 Bacteria 2854
274 nmdc:mga0qj67_7878_c1 3300050509 Bacteria 7873
275 nmdc:mga0qj67_79383_c1 3300050509 Bacteria 2628
276 nmdc:mga06r32_100960_c1 3300050510 Bacteria 2831
277 nmdc:mga06r32_61772_c1 3300050510 Bacteria 3608
278 nmdc:mga06r32_8147_c1 3300050510 Bacteria 9431
279 nmdc:mga06r32_87_c1 3300050510 Bacteria 63774
280 nmdc:mga06r32_886_c1 3300050510 Bacteria 26660
281 nmdc:mga06r32_9220_c1 3300050510 Bacteria 8897
282 nmdc:mga08y16_191182_c1 3300050511 Bacteria 2123
283 nmdc:mga08y16_20674_c1 3300050511 Bacteria 6948
284 nmdc:mga08y16_209726_c1 3300050511 Bacteria 2018
285 nmdc:mga08y16_468_c1 3300050511 Bacteria 37480
286 nmdc:mga08y16_9863_c1 3300050511 Bacteria 10028
287 nmdc:mga0n895_139152_c1 3300050512 Bacteria 2455
288 nmdc:mga0n895_14211_c1 3300050512 Bacteria 7221
289 nmdc:mga0n895_15041_c1 3300050512 Bacteria 7051
290 nmdc:mga0n895_18680_c1 3300050512 Bacteria 6422
291 nmdc:mga0n895_2028_c1 3300050512 Bacteria 15579
292 nmdc:mga0n895_273435_c1 3300050512 Unclassified 1713
293 nmdc:mga0n895_28455_c1 3300050512 Bacteria 5315
294 nmdc:mga0n895_31512_c1 3300050512 Bacteria 5078
295 nmdc:mga0n895_72356_c1 3300050512 Bacteria 3420
296 nmdc:mga0n895_77757_c1 3300050512 Bacteria 3301
297 nmdc:mga0n895_79385_c1 3300050512 Bacteria 3268
298 nmdc:mga0n895_8626_c1 3300050512 Bacteria 8845
299 nmdc:mga0n895_8904_c1 3300050512 Bacteria 8745
300 nmdc:mga0rr50_124517_c1 3300050513 Bacteria 2056
301 nmdc:mga0rr50_14584_c1 3300050513 Bacteria 5160
302 nmdc:mga0rr50_29635_c1 3300050513 Unclassified 3863
303 nmdc:mga0rr50_4950_c1 3300050513 Bacteria 7886
304 nmdc:mga0rr50_5072_c1 3300050513 Bacteria 7813
305 nmdc:mga0rr50_6348_c1 3300050513 Bacteria 7189
306 nmdc:mga0rr50_69590_c1 3300050513 Bacteria 2679
307 nmdc:mga08x19_1266_c1 3300050514 Bacteria 15690
308 nmdc:mga08x19_18930_c1 3300050514 Bacteria 4221
309 nmdc:mga08x19_6296_c1 3300050514 Bacteria 7026
310 nmdc:mga0a205_102230_c1 3300050515 Bacteria 2765
311 nmdc:mga0a205_11113_c1 3300050515 Bacteria 8285
312 nmdc:mga0a205_1148_c2 3300050515 Bacteria 20760
313 nmdc:mga0a205_1474_c1 3300050515 Bacteria 20069
314 nmdc:mga0a205_1557_c1 3300050515 Bacteria 19626
315 nmdc:mga0a205_21701_c1 3300050515 Bacteria 6071
316 nmdc:mga0a205_29133_c1 3300050515 Bacteria 5284
317 nmdc:mga0a205_2991_c1 3300050515 Bacteria 14987
318 nmdc:mga0a205_30660_c1 3300050515 Bacteria 5151
319 nmdc:mga0a205_33831_c3 3300050515 Bacteria 1943
320 nmdc:mga0a205_33965_c1 3300050515 Bacteria 4893
321 nmdc:mga0a205_63837_c1 3300050515 Bacteria 3557
322 nmdc:mga0a205_93087_c1 3300050515 Unclassified 2912
323 nmdc:mga0a205_9806_c1 3300050515 Bacteria 8784
324 Ga0530510_0013811 3300061734 Bacteria 5686
325 Ga0068862_100009659
326 Ga0065707_10013174
327 Ga0065707_10103422
328 Ga0065707_10108640
329 Ga0070690_100038246
330 Ga0070690_100094700
331 Ga0070670_100106029
332 Ga0068869_100001075
333 Ga0070689_100070403
334 Ga0070669_100009417
335 Ga0070705_100002703
336 Ga0070705_100024328
337 Ga0070700_100022025
338 Ga0070700_100036649
339 Ga0070708_100004701
340 Ga0070708_100009294
341 Ga0070708_100010505
342 Ga0070708_100053366
343 Ga0070708_100085229
344 Ga0068867_100035091
345 Ga0070706_100020077
346 Ga0070706_100020216
347 Ga0070706_100029391
348 Ga0070706_100036908
349 Ga0070706_100038011
350 Ga0070706_100075307
351 Ga0070706_100128162
352 Ga0070706_100233608
353 Ga0070707_100011894
354 Ga0070707_100013227
355 Ga0070707_100017904
356 Ga0070707_100029825
357 Ga0070707_100084533
358 Ga0070707_100115841
359 Ga0070707_100129826
360 Ga0070698_100006664
361 Ga0070698_100013240
362 Ga0070698_100014052
363 Ga0070698_100014522
364 Ga0070698_100051737
365 Ga0070698_100053598
366 Ga0070698_100057070
367 Ga0070698_100086326
368 Ga0070698_100086929
369 Ga0070698_100130410
370 Ga0070699_100010567
371 Ga0070699_100016408
372 Ga0070699_100018302
373 Ga0070699_100022477
374 Ga0070699_100023923
375 Ga0070699_100043509
376 Ga0070699_100052500
377 Ga0070699_100054033
378 Ga0070699_100086964
379 Ga0070697_100009238
380 Ga0070697_100010498
381 Ga0070697_100013033
382 Ga0070697_100016150
383 Ga0070697_100031185
384 Ga0070697_100091402
385 Ga0070697_100142890
386 Ga0070695_100019539
387 Ga0070695_100020772
388 Ga0070695_100047624
389 Ga0070695_100062925
390 Ga0070696_100046185
391 Ga0070696_100060476
392 Ga0070696_100072215
393 Ga0070704_100077784
394 Ga0068859_100054731
395 Ga0068859_100105918
396 Ga0068861_100102096
397 Ga0068863_100005957
398 Ga0068860_100103833
399 Ga0068862_100017044
400 Ga0068862_100029905
401 Ga0081455_10001418
402 Ga0081538_10002408
403 Ga0081538_10013445
404 Ga0081538_10046044
405 Ga0081540_1004046
406 Ga0081539_10000044
407 Ga0070716_100004224
408 Ga0070712_100004330
409 Ga0070712_100008418
410 Ga0075428_100000977
411 Ga0075428_100002656
412 Ga0075428_100003308
413 Ga0075428_100015297
414 Ga0075428_100017629
415 Ga0075428_100053897
416 Ga0075428_100061315
417 Ga0075428_100076161
418 Ga0075428_100099624
419 Ga0075428_100111705
420 Ga0075428_100113864
421 Ga0075428_100123793
422 Ga0075430_100002575
423 Ga0075430_100004800
424 Ga0075430_100049045
425 Ga0075431_100000270
426 Ga0075431_100003078
427 Ga0075431_100004687
428 Ga0075431_100009485
429 Ga0075431_100067716
430 Ga0075431_100177588
431 Ga0075433_10000853
432 Ga0075433_10005048
433 Ga0075433_10016875
434 Ga0075433_10023536
435 Ga0075433_10029270
436 Ga0075433_10032861
437 Ga0075433_10059654
438 Ga0075433_10095869
439 Ga0075433_10096085
440 Ga0075433_10142118
441 Ga0075433_10177509
442 Ga0075434_100003913
443 Ga0075434_100014133
444 Ga0075434_100024053
445 Ga0075434_100028152
446 Ga0075434_100034228
447 Ga0075434_100040018
448 Ga0075434_100056543
449 Ga0075434_100070671
450 Ga0075434_100077241
451 Ga0075434_100083517
452 Ga0075434_100106427
453 Ga0075429_100013692
454 Ga0075429_100015303
455 Ga0075429_100092845
456 Ga0075436_100000497
457 Ga0075436_100013698
458 Ga0075436_100029289
459 Ga0075436_100106745
460 Ga0075436_100107716
461 Ga0097620_100054731
462 Ga0097620_100105924
463 Ga0075435_100008563
464 Ga0075435_100014305
465 Ga0075435_100029963
466 Ga0075435_100050342
467 Ga0075435_100064408
468 Ga0075435_100108784
469 Ga0075435_100123684
470 Ga0099794_10049928
471 Ga0111539_10001174
472 Ga0111539_10002256
473 Ga0111539_10021846
474 Ga0111539_10122019
475 Ga0111539_10167736
476 Ga0111539_10268664
477 Ga0105247_10089490
478 Ga0114129_10005678
479 Ga0114129_10010715
480 Ga0114129_10015226
481 Ga0114129_10018847
482 Ga0114129_10026023
483 Ga0114129_10034537
484 Ga0114129_10042581
485 Ga0114129_10048380
486 Ga0114129_10056575
487 Ga0114129_10066127
488 Ga0114129_10093890
489 Ga0114129_10097096
490 Ga0114129_10115257
491 Ga0114129_10118015
492 Ga0114129_10124678
493 Ga0114129_10131054
494 Ga0114129_10136083
495 Ga0114129_10139439
496 Ga0114129_10146922
497 Ga0114129_10413500
498 Ga0105243_10044103
499 Ga0105241_10094773
500 Ga0105241_10162856
501 Ga0105242_10009396
502 Ga0105249_10037535
503 Ga0105249_10123197
504 Ga0157373_10047606
505 Ga0157378_10187368
506 Ga0163162_10066867
507 Ga0163162_10201644
508 Ga0207684_10001269
509 Ga0207684_10003224
510 Ga0207684_10004391
511 Ga0207684_10005733
512 Ga0207684_10009551
513 Ga0207684_10033378
514 Ga0207684_10041088
515 Ga0207684_10066787
516 Ga0207684_10069921
517 Ga0207684_10096484
518 Ga0207654_10012657
519 Ga0207707_10086883
520 Ga0207693_10012982
521 Ga0207693_10016878
522 Ga0207660_10101873
523 Ga0207646_10000982
524 Ga0207646_10013265
525 Ga0207646_10014134
526 Ga0207646_10023546
527 Ga0207646_10025749
528 Ga0207646_10031222
529 Ga0207646_10035715
530 Ga0207646_10062655
531 Ga0207646_10117236
532 Ga0207706_10078904
533 Ga0207670_10031810
534 Ga0207665_10011585
535 Ga0207711_10006615
536 Ga0207689_10004754
537 Ga0207712_10027227
538 Ga0207712_10027686
539 Ga0207708_10079414
540 Ga0207648_10119020
541 Ga0207674_10035782
542 Ga0207674_10057048
543 Ga0207675_100073284
544 Ga0207675_100148416
545 Ga0207428_10000009
546 Ga0207428_10005677
547 Ga0207428_10007391
548 Ga0268265_10009537
549 Ga0268264_10065076
550 Ga0307416_100080861
551 Ga0373940_0004973
552 Ga0373931_0001088
553 Ga0373931_0006278
554 Ga0395900_0030228
555 Ga0395900_0030393
556 Ga0395900_0112538
557 Ga0395898_0006908
558 Ga0395898_0020616
559 Ga0395901_0001564
560 Ga0451577_0098471
561 Ga0451577_0171087
562 Ga0453683_0005447
563 Ga0453683_0025552
564 Ga0453683_0035774
565 Ga0453684_0010242
566 Ga0451576_0036750
567 Ga0451576_0089385
568 Ga0451576_0093610
569 Ga0495580_0009153
570 Ga0496102_0004695
571 Ga0501040_0001737
572 Ga0501075_0203810
573 Ga0501081_0024230
574 nmdc:mga05p37_108004_c1
575 nmdc:mga05p37_114075_c1
576 nmdc:mga05p37_14135_c1
577 nmdc:mga05p37_14182_c1
578 nmdc:mga05p37_15911_c1
579 nmdc:mga05p37_239101_c1
580 nmdc:mga05p37_24503_c1
581 nmdc:mga05p37_280769_c1
582 nmdc:mga05p37_29925_c1
583 nmdc:mga05p37_30339_c1
584 nmdc:mga05p37_31726_c1
585 nmdc:mga05p37_32664_c1
586 nmdc:mga05p37_41561_c1
587 nmdc:mga05p37_48523_c1
588 nmdc:mga05p37_63489_c1
589 nmdc:mga05p37_9364_c1
590 nmdc:mga05p37_95748_c1
591 nmdc:mga09592_135471_c1
592 nmdc:mga09592_140186_c1
593 nmdc:mga09592_16135_c1
594 nmdc:mga09592_46495_c1
595 nmdc:mga09592_5707_c1
596 nmdc:mga0qj67_32824_c1
597 nmdc:mga0qj67_67273_c1
598 nmdc:mga0qj67_7878_c1
599 nmdc:mga0qj67_79383_c1
600 nmdc:mga06r32_100960_c1
601 nmdc:mga06r32_61772_c1
602 nmdc:mga06r32_8147_c1
603 nmdc:mga06r32_87_c1
604 nmdc:mga06r32_886_c1
605 nmdc:mga06r32_9220_c1
606 nmdc:mga08y16_191182_c1
607 nmdc:mga08y16_20674_c1
608 nmdc:mga08y16_209726_c1
609 nmdc:mga08y16_468_c1
610 nmdc:mga08y16_9863_c1
611 nmdc:mga0n895_139152_c1
612 nmdc:mga0n895_14211_c1
613 nmdc:mga0n895_15041_c1
614 nmdc:mga0n895_18680_c1
615 nmdc:mga0n895_2028_c1
616 nmdc:mga0n895_273435_c1
617 nmdc:mga0n895_28455_c1
618 nmdc:mga0n895_31512_c1
619 nmdc:mga0n895_72356_c1
620 nmdc:mga0n895_77757_c1
621 nmdc:mga0n895_79385_c1
622 nmdc:mga0n895_8626_c1
623 nmdc:mga0n895_8904_c1
624 nmdc:mga0rr50_124517_c1
625 nmdc:mga0rr50_14584_c1
626 nmdc:mga0rr50_29635_c1
627 nmdc:mga0rr50_4950_c1
628 nmdc:mga0rr50_5072_c1
629 nmdc:mga0rr50_6348_c1
630 nmdc:mga0rr50_69590_c1
631 nmdc:mga08x19_1266_c1
632 nmdc:mga08x19_18930_c1
633 nmdc:mga08x19_6296_c1
634 nmdc:mga0a205_102230_c1
635 nmdc:mga0a205_11113_c1
636 nmdc:mga0a205_1148_c2
637 nmdc:mga0a205_1474_c1
638 nmdc:mga0a205_1557_c1
639 nmdc:mga0a205_21701_c1
640 nmdc:mga0a205_29133_c1
641 nmdc:mga0a205_2991_c1
642 nmdc:mga0a205_30660_c1
643 nmdc:mga0a205_33831_c3
644 nmdc:mga0a205_33965_c1
645 nmdc:mga0a205_63837_c1
646 nmdc:mga0a205_93087_c1
647 nmdc:mga0a205_9806_c1
648 Ga0530510_0013811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00496

SBP_bac_5

Bacterial extracellular solute-binding proteins, family 5 Middle

119

486

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kz9-assembly2.cif.gz_B crystal structure of pseudomonas sp. pdc86 substrate-binding protein aapf in complex with a signaling molecule heheaa 0.8591 64 555
7kz9-assembly2.cif.gz_B crystal structure of pseudomonas sp. pdc86 substrate-binding protein aapf in complex with a signaling molecule heheaa 0.854 64 555
4xkr-assembly1.cif.gz_A crystal structure of nika from staphylococcus aureus in complex with ni-(l-his)(2-methyl-thiazolidine dicarboxylate) (co-crystallization with ni(ii) and cddeltahis medium supernatant) 0.8528 65 547
4qfo-assembly1.cif.gz_A crystal structure of dipeptide binding protein from pseudoalteromonas sp. sm9913 in complex with met-leu 0.85 65 559
6ofq-assembly1.cif.gz_A abc transporter-associated periplasmic binding protein dppa from helicobacter pylori in complex with peptide stsa 0.845 62 559
ID Description Score Start End Superfamily
af_P76128_42_177_3.90.76.10 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8789 77 214 3.90.76.10
1uqwB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8702 233 285 3.40.190.10
6hlxA02 Alpha Beta;Alpha-Beta Complex;Dipeptide-binding Protein; domain 1;Dipeptide-binding Protein; Domain 1 0.8637 75 230 3.90.76.10
1b52A03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8609 316 528 3.10.105.10
af_Q2G2P5_26_248_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8592 64 284 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V7IBG4-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9304 54 559 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A2V7IBG4-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.9183 54 559 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A2V6VLU5-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.8948 98 559 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A2V6VLU5-F1-model_v4 Solute-binding protein family 5 domain-containing protein 0.891 98 559 GO:0015833
GO:0042597
GO:0043190
GO:1904680
AF-A0A5C7NKL8-F1-model_v4 deleted 0.8889 57 559

Map