F415865

General Info

Members Datasets Scaffolds Average Seq Length
344 179 688 205

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100140821|Ga0070706_1001408212
Length 216
Sequence MKMTRGPIKSIRSVFVLIPLLLSLASVTYAQSAAIDGVDARSNPAEFAKQLSSPDSNVRQRSAEALARLAATSERKLVEGYQLQEKNKEVRLALDWALYRMGRSEALYRIVRDLDSGRQEQAIGYLSELEGPDLLYPFLKKQNNPPRVNAGLLKALARIGDTQTLDLIKPFRESHQPYVAEAAEIAHDEIEKRLSEPAQSTTRARPRTVEKATDKP

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
153 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
160 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
163 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
164 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
172 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 30.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100140821 3300005467 Unclassified 2252
2 MBSR1b_contig_4992936 2162886012 Bacteria 1722
3 JGI25406J46586_10054470 3300003203 Bacteria 1323
4 Ga0065704_10129154 3300005289 Bacteria 1645
5 Ga0065712_10096940 3300005290 Bacteria 2140
6 Ga0065715_10004297 3300005293 Bacteria 6828
7 Ga0065707_10119643 3300005295 Unclassified 2154
8 Ga0065707_10178785 3300005295 Unclassified 1432
9 Ga0070676_10030634 3300005328 Bacteria 3069
10 Ga0070690_100214218 3300005330 Bacteria 1346
11 Ga0070690_100295844 3300005330 Bacteria 1159
12 Ga0070670_100113531 3300005331 Unclassified 2335
13 Ga0068869_100026047 3300005334 Bacteria 4067
14 Ga0068869_100191840 3300005334 Unclassified 1607
15 Ga0070666_10035388 3300005335 Unclassified 3312
16 Ga0070680_100031343 3300005336 Bacteria 4274
17 Ga0070680_100051862 3300005336 Bacteria 3349
18 Ga0070680_100156799 3300005336 Bacteria 1913
19 Ga0070682_100244335 3300005337 Bacteria 1290
20 Ga0068868_100021146 3300005338 Bacteria 4900
21 Ga0068868_100701868 3300005338 Unclassified 905
22 Ga0070689_100004256 3300005340 Bacteria 9646
23 Ga0070687_100064781 3300005343 Bacteria 1942
24 Ga0070687_100076140 3300005343 Bacteria 1817
25 Ga0070687_100221149 3300005343 Unclassified 1160
26 Ga0070692_10038495 3300005345 Bacteria 2437
27 Ga0070692_10469121 3300005345 Bacteria 809
28 Ga0070669_100022153 3300005353 Bacteria 4544
29 Ga0070675_100144253 3300005354 Bacteria 2037
30 Ga0070675_100348411 3300005354 Bacteria 1313
31 Ga0070671_100038118 3300005355 Unclassified 3990
32 Ga0070674_100759745 3300005356 Bacteria 834
33 Ga0070673_100274632 3300005364 Bacteria 1476
34 Ga0070673_100457519 3300005364 Unclassified 1149
35 Ga0070659_100005538 3300005366 Bacteria 9073
36 Ga0070667_100029360 3300005367 Unclassified 4581
37 Ga0070703_10004867 3300005406 Bacteria 3753
38 Ga0070701_10236095 3300005438 Bacteria 1097
39 Ga0070701_10296112 3300005438 Unclassified 993
40 Ga0070701_10371898 3300005438 Unclassified 898
41 Ga0070705_100087173 3300005440 Bacteria 1935
42 Ga0070705_100372306 3300005440 Bacteria 1048
43 Ga0070700_100008094 3300005441 Bacteria 5714
44 Ga0070700_100065167 3300005441 Bacteria 2309
45 Ga0070700_100139084 3300005441 Bacteria 1648
46 Ga0070700_100486917 3300005441 Unclassified 946
47 Ga0070694_100019745 3300005444 Unclassified 4288
48 Ga0070694_100098444 3300005444 Bacteria 2065
49 Ga0070694_100114461 3300005444 Bacteria 1926
50 Ga0070694_100224092 3300005444 Bacteria 1412
51 Ga0070694_100234852 3300005444 Unclassified 1381
52 Ga0070708_100737124 3300005445 Unclassified 927
53 Ga0070681_10004601 3300005458 Bacteria 13175
54 Ga0070681_10080098 3300005458 Bacteria 3222
55 Ga0068867_100046874 3300005459 Unclassified 3176
56 Ga0068867_100860154 3300005459 Bacteria 813
57 Ga0070707_100467313 3300005468 Unclassified 1223
58 Ga0070698_100018211 3300005471 Bacteria 7396
59 Ga0070699_100213359 3300005518 Bacteria 1719
60 Ga0070699_100288061 3300005518 Bacteria 1472
61 Ga0070686_100016262 3300005544 Bacteria 4323
62 Ga0070686_100422829 3300005544 Bacteria 1018
63 Ga0070695_100035831 3300005545 Bacteria 3119
64 Ga0070695_100262724 3300005545 Unclassified 1261
65 Ga0070696_100027410 3300005546 Bacteria 3882
66 Ga0070693_100005622 3300005547 Bacteria 6045
67 Ga0070693_100016694 3300005547 Bacteria 3804
68 Ga0070665_100330512 3300005548 Bacteria 1529
69 Ga0070704_100018903 3300005549 Bacteria 4418
70 Ga0070704_100077703 3300005549 Bacteria 2432
71 Ga0070704_100511497 3300005549 Unclassified 1044
72 Ga0070664_100028089 3300005564 Bacteria 4678
73 Ga0070664_100217854 3300005564 Bacteria 1707
74 Ga0068857_100005700 3300005577 Bacteria 10648
75 Ga0068857_100042786 3300005577 Bacteria 4019
76 Ga0068857_100336629 3300005577 Bacteria 1396
77 Ga0068854_100114031 3300005578 Bacteria 2042
78 Ga0068854_100729791 3300005578 Unclassified 858
79 Ga0068854_100813817 3300005578 Bacteria 815
80 Ga0070702_100059943 3300005615 Unclassified 2211
81 Ga0070702_100110183 3300005615 Unclassified 1706
82 Ga0070702_100202219 3300005615 Bacteria 1316
83 Ga0070702_100293838 3300005615 Unclassified 1121
84 Ga0070702_100735920 3300005615 Unclassified 756
85 Ga0068852_100307829 3300005616 Bacteria 1535
86 Ga0068852_100745982 3300005616 Bacteria 991
87 Ga0068859_100008245 3300005617 Bacteria 10566
88 Ga0068859_100016086 3300005617 Bacteria 7515
89 Ga0068859_100041834 3300005617 Bacteria 4603
90 Ga0068859_100094252 3300005617 Unclassified 3046
91 Ga0068859_100094776 3300005617 Bacteria 3037
92 Ga0068859_100458196 3300005617 Unclassified 1371
93 Ga0068859_100627147 3300005617 Bacteria 1167
94 Ga0068859_100920355 3300005617 Bacteria 959
95 Ga0068859_100941142 3300005617 Bacteria 948
96 Ga0068859_101165541 3300005617 Unclassified 848
97 Ga0068864_100002210 3300005618 Bacteria 16074
98 Ga0068864_100038301 3300005618 Bacteria 4095
99 Ga0068864_100511421 3300005618 Unclassified 1157
100 Ga0068866_10039197 3300005718 Bacteria 2338
101 Ga0068861_100020095 3300005719 Bacteria 4778
102 Ga0068861_100047430 3300005719 Bacteria 3242
103 Ga0068861_100323992 3300005719 Unclassified 1343
104 Ga0068861_100357980 3300005719 Bacteria 1282
105 Ga0068851_10004089 3300005834 Bacteria 6555
106 Ga0068870_10074728 3300005840 Bacteria 1857
107 Ga0068870_10164625 3300005840 Bacteria 1318
108 Ga0068870_10237623 3300005840 Bacteria 1123
109 Ga0068863_100264204 3300005841 Unclassified 1664
110 Ga0068858_100016868 3300005842 Bacteria 6858
111 Ga0068858_100034850 3300005842 Unclassified 4669
112 Ga0068858_100041718 3300005842 Unclassified 4254
113 Ga0068858_100645010 3300005842 Bacteria 1029
114 Ga0068860_100103863 3300005843 Unclassified 2713
115 Ga0068860_100178654 3300005843 Bacteria 2052
116 Ga0068862_100003168 3300005844 Bacteria 14280
117 Ga0068862_100250241 3300005844 Bacteria 1615
118 Ga0068862_100522647 3300005844 Bacteria 1129
119 Ga0081539_10001757 3300005985 Bacteria 34548
120 Ga0081539_10006426 3300005985 Bacteria 11286
121 Ga0097621_100001486 3300006237 Bacteria 16059
122 Ga0068871_100008123 3300006358 Bacteria 7535
123 Ga0075431_100080189 3300006847 Bacteria 3370
124 Ga0075431_100139874 3300006847 Bacteria 2495
125 Ga0075431_100750184 3300006847 Bacteria 951
126 Ga0075433_10033047 3300006852 Bacteria 4434
127 Ga0075429_100142918 3300006880 Bacteria 2095
128 Ga0075436_100026061 3300006914 Bacteria 4025
129 Ga0097620_100003326 3300006931 Bacteria 16344
130 Ga0097620_100008245 3300006931 Bacteria 10566
131 Ga0097620_100016086 3300006931 Bacteria 7515
132 Ga0097620_100041837 3300006931 Bacteria 4603
133 Ga0097620_100094253 3300006931 Unclassified 3046
134 Ga0097620_100094781 3300006931 Bacteria 3037
135 Ga0097620_100458218 3300006931 Unclassified 1371
136 Ga0097620_100627178 3300006931 Bacteria 1167
137 Ga0097620_100920380 3300006931 Bacteria 959
138 Ga0097620_100941133 3300006931 Bacteria 948
139 Ga0097620_101165620 3300006931 Unclassified 848
140 Ga0105240_10196550 3300009093 Bacteria 2367
141 Ga0111539_10237354 3300009094 Bacteria 2122
142 Ga0111539_10257209 3300009094 Unclassified 2033
143 Ga0111539_10289606 3300009094 Bacteria 1906
144 Ga0105247_10419416 3300009101 Unclassified 958
145 Ga0105247_10551890 3300009101 Bacteria 847
146 Ga0114129_10010754 3300009147 Bacteria 13043
147 Ga0114129_10029767 3300009147 Bacteria 7732
148 Ga0114129_10157498 3300009147 Bacteria 3105
149 Ga0114129_10697612 3300009147 Bacteria 1305
150 Ga0114129_11188776 3300009147 Unclassified 950
151 Ga0105241_10031795 3300009174 Bacteria 3952
152 Ga0105241_10200062 3300009174 Unclassified 1668
153 Ga0105241_10424414 3300009174 Unclassified 1171
154 Ga0105241_10556520 3300009174 Bacteria 1030
155 Ga0105242_10045474 3300009176 Unclassified 3558
156 Ga0105242_10180588 3300009176 Bacteria 1862
157 Ga0105248_10013311 3300009177 Bacteria 9054
158 Ga0105248_10035323 3300009177 Bacteria 5591
159 Ga0105248_10460924 3300009177 Bacteria 1433
160 Ga0105248_10461509 3300009177 Bacteria 1432
161 Ga0105237_10000829 3300009545 Bacteria 42345
162 Ga0105237_10146599 3300009545 Unclassified 2355
163 Ga0105249_10111963 3300009553 Bacteria 2581
164 Ga0105239_10287393 3300010375 Bacteria 1852
165 Ga0105239_10392404 3300010375 Unclassified 1570
166 Ga0105239_10411273 3300010375 Bacteria 1532
167 Ga0105246_10686600 3300011119 Unclassified 895
168 Ga0157373_10004796 3300013100 Bacteria 10176
169 Ga0157373_10018841 3300013100 Bacteria 5023
170 Ga0157373_10141356 3300013100 Unclassified 1693
171 Ga0157373_10156884 3300013100 Bacteria 1601
172 Ga0157371_10857883 3300013102 Unclassified 687
173 Ga0157374_10124363 3300013296 Bacteria 2492
174 Ga0157378_10002109 3300013297 Bacteria 17723
175 Ga0157378_10017316 3300013297 Bacteria 6321
176 Ga0163162_10001226 3300013306 Bacteria 23960
177 Ga0163162_10161047 3300013306 Bacteria 2366
178 Ga0163162_10487979 3300013306 Unclassified 1363
179 Ga0163162_10609246 3300013306 Unclassified 1218
180 Ga0157372_10045362 3300013307 Unclassified 4876
181 Ga0157372_10061973 3300013307 Bacteria 4189
182 Ga0157375_10016305 3300013308 Bacteria 6669
183 Ga0157375_10062113 3300013308 Bacteria 3711
184 Ga0157375_10378381 3300013308 Bacteria 1582
185 Ga0157375_11404653 3300013308 Unclassified 822
186 Ga0163163_10003293 3300014325 Bacteria 13699
187 Ga0163163_10009936 3300014325 Bacteria 8532
188 Ga0157380_10002489 3300014326 Bacteria 12418
189 Ga0157380_10095399 3300014326 Bacteria 2464
190 Ga0157380_10110509 3300014326 Bacteria 2309
191 Ga0157380_12001521 3300014326 Unclassified 641
192 Ga0157379_10043149 3300014968 Bacteria 4026
193 Ga0157379_10120136 3300014968 Bacteria 2363
194 Ga0163161_10737799 3300017792 Unclassified 823
195 Ga0207656_10108440 3300025321 Bacteria 1280
196 Ga0207653_10001829 3300025885 Bacteria 6783
197 Ga0207642_10134608 3300025899 Bacteria 1294
198 Ga0207710_10352646 3300025900 Unclassified 750
199 Ga0207680_10058954 3300025903 Bacteria 2329
200 Ga0207647_10472981 3300025904 Unclassified 701
201 Ga0207645_10117412 3300025907 Bacteria 1726
202 Ga0207643_10096656 3300025908 Bacteria 1728
203 Ga0207643_10108413 3300025908 Bacteria 1634
204 Ga0207643_10210888 3300025908 Bacteria 1185
205 Ga0207684_10114999 3300025910 Bacteria 2304
206 Ga0207654_10017234 3300025911 Bacteria 3773
207 Ga0207707_10018339 3300025912 Bacteria 6099
208 Ga0207707_10020844 3300025912 Bacteria 5726
209 Ga0207671_10003425 3300025914 Bacteria 15840
210 Ga0207671_10401077 3300025914 Unclassified 1091
211 Ga0207660_10352046 3300025917 Bacteria 1180
212 Ga0207660_10541589 3300025917 Unclassified 946
213 Ga0207662_10006882 3300025918 Bacteria 6160
214 Ga0207662_10098790 3300025918 Unclassified 1806
215 Ga0207662_10203612 3300025918 Bacteria 1282
216 Ga0207652_10036150 3300025921 Unclassified 4176
217 Ga0207646_10132591 3300025922 Unclassified 2243
218 Ga0207681_10031850 3300025923 Bacteria 3447
219 Ga0207650_10027388 3300025925 Bacteria 4080
220 Ga0207644_10007642 3300025931 Bacteria 7050
221 Ga0207690_10026256 3300025932 Bacteria 3666
222 Ga0207686_10042883 3300025934 Unclassified 2769
223 Ga0207670_10000252 3300025936 Bacteria 33423
224 Ga0207669_10654547 3300025937 Bacteria 859
225 Ga0207704_10767909 3300025938 Unclassified 803
226 Ga0207711_10007579 3300025941 Bacteria 9081
227 Ga0207711_10016173 3300025941 Bacteria 6194
228 Ga0207711_10085062 3300025941 Bacteria 2770
229 Ga0207711_10680326 3300025941 Unclassified 960
230 Ga0207689_10062729 3300025942 Bacteria 3057
231 Ga0207689_10160125 3300025942 Bacteria 1855
232 Ga0207689_10282780 3300025942 Unclassified 1374
233 Ga0207679_10008683 3300025945 Bacteria 6478
234 Ga0207679_10313665 3300025945 Bacteria 1356
235 Ga0207651_10394470 3300025960 Bacteria 1176
236 Ga0207712_10037710 3300025961 Bacteria 3299
237 Ga0207658_10049403 3300025986 Unclassified 3091
238 Ga0207677_10009809 3300026023 Bacteria 5396
239 Ga0207677_10077260 3300026023 Unclassified 2374
240 Ga0207703_10005647 3300026035 Bacteria 10045
241 Ga0207703_10026067 3300026035 Unclassified 4600
242 Ga0207703_10098362 3300026035 Bacteria 2474
243 Ga0207703_10143090 3300026035 Unclassified 2077
244 Ga0207639_10039909 3300026041 Bacteria 3501
245 Ga0207708_10021661 3300026075 Bacteria 4848
246 Ga0207708_10042153 3300026075 Bacteria 3480
247 Ga0207708_10074089 3300026075 Bacteria 2609
248 Ga0207708_10402521 3300026075 Unclassified 1132
249 Ga0207641_10687506 3300026088 Unclassified 1007
250 Ga0207641_11215206 3300026088 Unclassified 753
251 Ga0207648_10406306 3300026089 Bacteria 1235
252 Ga0207676_10007130 3300026095 Bacteria 7917
253 Ga0207676_10007886 3300026095 Bacteria 7573
254 Ga0207676_10013607 3300026095 Bacteria 5840
255 Ga0207676_10133899 3300026095 Unclassified 2112
256 Ga0207674_10002399 3300026116 Bacteria 23688
257 Ga0207674_10127714 3300026116 Unclassified 2507
258 Ga0207674_10177889 3300026116 Bacteria 2080
259 Ga0207674_10254490 3300026116 Unclassified 1703
260 Ga0207675_100031287 3300026118 Bacteria 4957
261 Ga0207675_100248905 3300026118 Bacteria 1719
262 Ga0268266_10395510 3300028379 Bacteria 1306
263 Ga0268265_10007408 3300028380 Bacteria 7412
264 Ga0268264_10069207 3300028381 Unclassified 2985
265 Ga0268264_10139396 3300028381 Bacteria 2161
266 Ga0268264_10222424 3300028381 Bacteria 1738
267 Ga0314311_1263158 3300030733 Bacteria 1086
268 Ga0307408_100057862 3300031548 Bacteria 2816
269 Ga0307408_100150846 3300031548 Bacteria 1835
270 Ga0307405_10152761 3300031731 Bacteria 1625
271 Ga0307406_10030131 3300031901 Bacteria 3291
272 Ga0307407_10097050 3300031903 Unclassified 1821
273 Ga0307407_10447407 3300031903 Unclassified 937
274 Ga0307412_10162654 3300031911 Unclassified 1660
275 Ga0307412_10243715 3300031911 Unclassified 1392
276 Ga0307409_100570420 3300031995 Unclassified 1114
277 Ga0307416_100105771 3300032002 Bacteria 2464
278 Ga0307416_100827820 3300032002 Unclassified 1023
279 Ga0307414_10287410 3300032004 Unclassified 1385
280 Ga0307411_10038813 3300032005 Bacteria 3008
281 Ga0307411_10305273 3300032005 Bacteria 1278
282 Ga0307415_100028124 3300032126 Bacteria 3572
283 Ga0307415_100036783 3300032126 Bacteria 3211
284 Ga0373949_0055957 3300035090 Bacteria 1005
285 Ga0373941_0057410 3300035115 Bacteria 1257
286 Ga0373942_0004260 3300035207 Unclassified 3330
287 Ga0373961_0145540 3300035241 Unclassified 804
288 Ga0373961_0228363 3300035241 Unclassified 666
289 Ga0373931_0416684 3300035691 Unclassified 853
290 Ga0395900_0189837 3300037418 Unclassified 2085
291 Ga0395900_0782607 3300037418 Unclassified 883
292 Ga0395898_0223965 3300037466 Unclassified 1794
293 Ga0395905_0507074 3300037471 Unclassified 1107
294 Ga0496102_0806861 3300048905 Unclassified 861
295 Ga0496104_0095043 3300048907 Bacteria 2852
296 Ga0496104_0809288 3300048907 Unclassified 843
297 Ga0496112_0253107 3300048915 Bacteria 1712
298 Ga0496112_0340684 3300048915 Unclassified 1443
299 Ga0496112_0681625 3300048915 Bacteria 956
300 Ga0501292_011504 3300049515 Unclassified 1340
301 Ga0501298_004203 3300049521 Unclassified 2261
302 Ga0501299_010431 3300049522 Bacteria 1551
303 Ga0501038_0026603 3300049574 Bacteria 5152
304 Ga0501069_0255409 3300049585 Bacteria 1023
305 Ga0501198_009111 3300049649 Bacteria 1452
306 Ga0501202_008133 3300049652 Bacteria 1907
307 Ga0501209_016113 3300049656 Bacteria 1681
308 Ga0501216_011317 3300049660 Bacteria 1448
309 Ga0501216_021726 3300049660 Unclassified 1130
310 Ga0501217_012254 3300049661 Bacteria 1907
311 Ga0501217_048824 3300049661 Bacteria 1100
312 Ga0501217_063505 3300049661 Unclassified 991
313 Ga0501223_010504 3300049663 Bacteria 1860
314 Ga0501223_019573 3300049663 Unclassified 1330
315 Ga0501227_010128 3300049665 Bacteria 2040
316 Ga0501228_018943 3300049666 Unclassified 762
317 Ga0501230_009613 3300049667 Bacteria 1492
318 Ga0501235_016706 3300049669 Bacteria 1622
319 Ga0501249_012148 3300049679 Bacteria 1817
320 Ga0501250_011575 3300049680 Bacteria 1030
321 Ga0501253_056965 3300049683 Bacteria 833
322 Ga0501225_0004417 3300049705 Unclassified 4188
323 Ga0501225_0036788 3300049705 Bacteria 1349
324 Ga0501225_0079274 3300049705 Bacteria 941
325 Ga0501266_013582 3300049763 Unclassified 1061
326 Ga0501212_010241 3300049851 Unclassified 1333
327 nmdc:mga05p37_11343_c1 3300050507 Bacteria 10600
328 nmdc:mga05p37_23246_c1 3300050507 Bacteria 7518
329 nmdc:mga05p37_569735_c1 3300050507 Bacteria 1285
330 nmdc:mga0qj67_468889_c1 3300050509 Bacteria 1014
331 nmdc:mga0qj67_82839_c1 3300050509 Bacteria 2572
332 nmdc:mga06r32_1163809_c1 3300050510 Unclassified 718
333 nmdc:mga06r32_170997_c1 3300050510 Bacteria 2157
334 nmdc:mga06r32_573638_c1 3300050510 Bacteria 1101
335 nmdc:mga06r32_77133_c1 3300050510 Bacteria 3236
336 nmdc:mga08y16_258345_c1 3300050511 Bacteria 1799
337 nmdc:mga08y16_688761_c1 3300050511 Bacteria 1023
338 nmdc:mga0n895_115455_c1 3300050512 Bacteria 2703
339 nmdc:mga0n895_282018_c1 3300050512 Bacteria 1685
340 nmdc:mga08x19_5833_c1 3300050514 Bacteria 7286
341 nmdc:mga08x19_842385_c1 3300050514 Bacteria 651
342 nmdc:mga0a205_52262_c1 3300050515 Bacteria 3944
343 nmdc:mga0a205_71417_c1 3300050515 Bacteria 3353
344 nmdc:mga0a205_812835_c1 3300050515 Unclassified 782
345 Ga0070706_100140821
346 MBSR1b_contig_4992936
347 JGI25406J46586_10054470
348 Ga0065704_10129154
349 Ga0065712_10096940
350 Ga0065715_10004297
351 Ga0065707_10119643
352 Ga0065707_10178785
353 Ga0070676_10030634
354 Ga0070690_100214218
355 Ga0070690_100295844
356 Ga0070670_100113531
357 Ga0068869_100026047
358 Ga0068869_100191840
359 Ga0070666_10035388
360 Ga0070680_100031343
361 Ga0070680_100051862
362 Ga0070680_100156799
363 Ga0070682_100244335
364 Ga0068868_100021146
365 Ga0068868_100701868
366 Ga0070689_100004256
367 Ga0070687_100064781
368 Ga0070687_100076140
369 Ga0070687_100221149
370 Ga0070692_10038495
371 Ga0070692_10469121
372 Ga0070669_100022153
373 Ga0070675_100144253
374 Ga0070675_100348411
375 Ga0070671_100038118
376 Ga0070674_100759745
377 Ga0070673_100274632
378 Ga0070673_100457519
379 Ga0070659_100005538
380 Ga0070667_100029360
381 Ga0070703_10004867
382 Ga0070701_10236095
383 Ga0070701_10296112
384 Ga0070701_10371898
385 Ga0070705_100087173
386 Ga0070705_100372306
387 Ga0070700_100008094
388 Ga0070700_100065167
389 Ga0070700_100139084
390 Ga0070700_100486917
391 Ga0070694_100019745
392 Ga0070694_100098444
393 Ga0070694_100114461
394 Ga0070694_100224092
395 Ga0070694_100234852
396 Ga0070708_100737124
397 Ga0070681_10004601
398 Ga0070681_10080098
399 Ga0068867_100046874
400 Ga0068867_100860154
401 Ga0070707_100467313
402 Ga0070698_100018211
403 Ga0070699_100213359
404 Ga0070699_100288061
405 Ga0070686_100016262
406 Ga0070686_100422829
407 Ga0070695_100035831
408 Ga0070695_100262724
409 Ga0070696_100027410
410 Ga0070693_100005622
411 Ga0070693_100016694
412 Ga0070665_100330512
413 Ga0070704_100018903
414 Ga0070704_100077703
415 Ga0070704_100511497
416 Ga0070664_100028089
417 Ga0070664_100217854
418 Ga0068857_100005700
419 Ga0068857_100042786
420 Ga0068857_100336629
421 Ga0068854_100114031
422 Ga0068854_100729791
423 Ga0068854_100813817
424 Ga0070702_100059943
425 Ga0070702_100110183
426 Ga0070702_100202219
427 Ga0070702_100293838
428 Ga0070702_100735920
429 Ga0068852_100307829
430 Ga0068852_100745982
431 Ga0068859_100008245
432 Ga0068859_100016086
433 Ga0068859_100041834
434 Ga0068859_100094252
435 Ga0068859_100094776
436 Ga0068859_100458196
437 Ga0068859_100627147
438 Ga0068859_100920355
439 Ga0068859_100941142
440 Ga0068859_101165541
441 Ga0068864_100002210
442 Ga0068864_100038301
443 Ga0068864_100511421
444 Ga0068866_10039197
445 Ga0068861_100020095
446 Ga0068861_100047430
447 Ga0068861_100323992
448 Ga0068861_100357980
449 Ga0068851_10004089
450 Ga0068870_10074728
451 Ga0068870_10164625
452 Ga0068870_10237623
453 Ga0068863_100264204
454 Ga0068858_100016868
455 Ga0068858_100034850
456 Ga0068858_100041718
457 Ga0068858_100645010
458 Ga0068860_100103863
459 Ga0068860_100178654
460 Ga0068862_100003168
461 Ga0068862_100250241
462 Ga0068862_100522647
463 Ga0081539_10001757
464 Ga0081539_10006426
465 Ga0097621_100001486
466 Ga0068871_100008123
467 Ga0075431_100080189
468 Ga0075431_100139874
469 Ga0075431_100750184
470 Ga0075433_10033047
471 Ga0075429_100142918
472 Ga0075436_100026061
473 Ga0097620_100003326
474 Ga0097620_100008245
475 Ga0097620_100016086
476 Ga0097620_100041837
477 Ga0097620_100094253
478 Ga0097620_100094781
479 Ga0097620_100458218
480 Ga0097620_100627178
481 Ga0097620_100920380
482 Ga0097620_100941133
483 Ga0097620_101165620
484 Ga0105240_10196550
485 Ga0111539_10237354
486 Ga0111539_10257209
487 Ga0111539_10289606
488 Ga0105247_10419416
489 Ga0105247_10551890
490 Ga0114129_10010754
491 Ga0114129_10029767
492 Ga0114129_10157498
493 Ga0114129_10697612
494 Ga0114129_11188776
495 Ga0105241_10031795
496 Ga0105241_10200062
497 Ga0105241_10424414
498 Ga0105241_10556520
499 Ga0105242_10045474
500 Ga0105242_10180588
501 Ga0105248_10013311
502 Ga0105248_10035323
503 Ga0105248_10460924
504 Ga0105248_10461509
505 Ga0105237_10000829
506 Ga0105237_10146599
507 Ga0105249_10111963
508 Ga0105239_10287393
509 Ga0105239_10392404
510 Ga0105239_10411273
511 Ga0105246_10686600
512 Ga0157373_10004796
513 Ga0157373_10018841
514 Ga0157373_10141356
515 Ga0157373_10156884
516 Ga0157371_10857883
517 Ga0157374_10124363
518 Ga0157378_10002109
519 Ga0157378_10017316
520 Ga0163162_10001226
521 Ga0163162_10161047
522 Ga0163162_10487979
523 Ga0163162_10609246
524 Ga0157372_10045362
525 Ga0157372_10061973
526 Ga0157375_10016305
527 Ga0157375_10062113
528 Ga0157375_10378381
529 Ga0157375_11404653
530 Ga0163163_10003293
531 Ga0163163_10009936
532 Ga0157380_10002489
533 Ga0157380_10095399
534 Ga0157380_10110509
535 Ga0157380_12001521
536 Ga0157379_10043149
537 Ga0157379_10120136
538 Ga0163161_10737799
539 Ga0207656_10108440
540 Ga0207653_10001829
541 Ga0207642_10134608
542 Ga0207710_10352646
543 Ga0207680_10058954
544 Ga0207647_10472981
545 Ga0207645_10117412
546 Ga0207643_10096656
547 Ga0207643_10108413
548 Ga0207643_10210888
549 Ga0207684_10114999
550 Ga0207654_10017234
551 Ga0207707_10018339
552 Ga0207707_10020844
553 Ga0207671_10003425
554 Ga0207671_10401077
555 Ga0207660_10352046
556 Ga0207660_10541589
557 Ga0207662_10006882
558 Ga0207662_10098790
559 Ga0207662_10203612
560 Ga0207652_10036150
561 Ga0207646_10132591
562 Ga0207681_10031850
563 Ga0207650_10027388
564 Ga0207644_10007642
565 Ga0207690_10026256
566 Ga0207686_10042883
567 Ga0207670_10000252
568 Ga0207669_10654547
569 Ga0207704_10767909
570 Ga0207711_10007579
571 Ga0207711_10016173
572 Ga0207711_10085062
573 Ga0207711_10680326
574 Ga0207689_10062729
575 Ga0207689_10160125
576 Ga0207689_10282780
577 Ga0207679_10008683
578 Ga0207679_10313665
579 Ga0207651_10394470
580 Ga0207712_10037710
581 Ga0207658_10049403
582 Ga0207677_10009809
583 Ga0207677_10077260
584 Ga0207703_10005647
585 Ga0207703_10026067
586 Ga0207703_10098362
587 Ga0207703_10143090
588 Ga0207639_10039909
589 Ga0207708_10021661
590 Ga0207708_10042153
591 Ga0207708_10074089
592 Ga0207708_10402521
593 Ga0207641_10687506
594 Ga0207641_11215206
595 Ga0207648_10406306
596 Ga0207676_10007130
597 Ga0207676_10007886
598 Ga0207676_10013607
599 Ga0207676_10133899
600 Ga0207674_10002399
601 Ga0207674_10127714
602 Ga0207674_10177889
603 Ga0207674_10254490
604 Ga0207675_100031287
605 Ga0207675_100248905
606 Ga0268266_10395510
607 Ga0268265_10007408
608 Ga0268264_10069207
609 Ga0268264_10139396
610 Ga0268264_10222424
611 Ga0314311_1263158
612 Ga0307408_100057862
613 Ga0307408_100150846
614 Ga0307405_10152761
615 Ga0307406_10030131
616 Ga0307407_10097050
617 Ga0307407_10447407
618 Ga0307412_10162654
619 Ga0307412_10243715
620 Ga0307409_100570420
621 Ga0307416_100105771
622 Ga0307416_100827820
623 Ga0307414_10287410
624 Ga0307411_10038813
625 Ga0307411_10305273
626 Ga0307415_100028124
627 Ga0307415_100036783
628 Ga0373949_0055957
629 Ga0373941_0057410
630 Ga0373942_0004260
631 Ga0373961_0145540
632 Ga0373961_0228363
633 Ga0373931_0416684
634 Ga0395900_0189837
635 Ga0395900_0782607
636 Ga0395898_0223965
637 Ga0395905_0507074
638 Ga0496102_0806861
639 Ga0496104_0095043
640 Ga0496104_0809288
641 Ga0496112_0253107
642 Ga0496112_0340684
643 Ga0496112_0681625
644 Ga0501292_011504
645 Ga0501298_004203
646 Ga0501299_010431
647 Ga0501038_0026603
648 Ga0501069_0255409
649 Ga0501198_009111
650 Ga0501202_008133
651 Ga0501209_016113
652 Ga0501216_011317
653 Ga0501216_021726
654 Ga0501217_012254
655 Ga0501217_048824
656 Ga0501217_063505
657 Ga0501223_010504
658 Ga0501223_019573
659 Ga0501227_010128
660 Ga0501228_018943
661 Ga0501230_009613
662 Ga0501235_016706
663 Ga0501249_012148
664 Ga0501250_011575
665 Ga0501253_056965
666 Ga0501225_0004417
667 Ga0501225_0036788
668 Ga0501225_0079274
669 Ga0501266_013582
670 Ga0501212_010241
671 nmdc:mga05p37_11343_c1
672 nmdc:mga05p37_23246_c1
673 nmdc:mga05p37_569735_c1
674 nmdc:mga0qj67_468889_c1
675 nmdc:mga0qj67_82839_c1
676 nmdc:mga06r32_1163809_c1
677 nmdc:mga06r32_170997_c1
678 nmdc:mga06r32_573638_c1
679 nmdc:mga06r32_77133_c1
680 nmdc:mga08y16_258345_c1
681 nmdc:mga08y16_688761_c1
682 nmdc:mga0n895_115455_c1
683 nmdc:mga0n895_282018_c1
684 nmdc:mga08x19_5833_c1
685 nmdc:mga08x19_842385_c1
686 nmdc:mga0a205_52262_c1
687 nmdc:mga0a205_71417_c1
688 nmdc:mga0a205_812835_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d0b-assembly2.cif.gz_B crystal structure of epoxyqueuosine reductase with a trna-tyr epoxyqueuosine-modified trna stem loop 0.9329 38 95
4jw2-assembly1.cif.gz_A selection of specific protein binders for pre-defined targets from an optimized library of artificial helicoidal repeat proteins (alpharep) 0.7986 36 108
4jw2-assembly1.cif.gz_A selection of specific protein binders for pre-defined targets from an optimized library of artificial helicoidal repeat proteins (alpharep) 0.7679 36 108
5t87-assembly4.cif.gz_D crystal structure of cdi complex from cupriavidus taiwanensis lmg 19424 0.664 102 189
5dcq-assembly3.cif.gz_A crystal structure of bacterial adhesin, fne from streptococcus equi spp. equi. 0.6325 38 182
ID Description Score Start End Superfamily
4jw2A00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7986 36 108 1.25.10.10
af_I1KBE7_122_210_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.7771 126 201 1.20.930.10
4jw2A00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7679 36 108 1.25.10.10
af_I1KTE5_88_174_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.7145 126 193 1.20.930.10
af_F4J4Y5_99_193_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.7099 122 201 1.20.930.10
ID Description Score Start End GO Terms
AF-A0A2V9RBT2-F1-model_v4 HEAT repeat domain-containing protein 0.9305 35 187 GO:0016491
AF-A0A6L8HTP9-F1-model_v4 deleted 0.9289 35 188
AF-A0A2V9LFN5-F1-model_v4 HEAT repeat domain-containing protein 0.9239 38 189
AF-G2LLF0-F1-model_v4 HEAT repeat protein 0.9191 38 191 GO:0016491
AF-A0A2V9L3Y9-F1-model_v4 HEAT repeat domain-containing protein 0.9177 35 192 GO:0016491

Map