F415764

General Info

Members Datasets Scaffolds Average Seq Length
343 218 339 140

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_519331_c1|nmdc:mga0k408_519331_c1_128_601
Length 157
Sequence MPGGSAGESLFKGLFGMNRGLIFDSPFLLGFEHTRNLIERAAKAAAESYPPYNVEDRGDGALRITLAVAGFAPDQLEVTVEDRQLVVAGRRDAGAQAKSEEAYLHRGIAARGFIRSFVLADGMEVEGATLEHGLLHIDLARPEPEKRVQSIPIRTAG

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
192 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
193 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
207 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 7
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.91
Nodule 0
Rhizoplane 2.04
Rhizosphere 76.38
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1017185 3300002741 Bacteria 879
2 JGI25153J46596_10082419 3300003215 Bacteria 798
3 Ga0055530_10000303 3300003791 Bacteria 44777
4 Ga0055531_10004963 3300003794 Bacteria 7901
5 Ga0055531_10010084 3300003794 Bacteria 4743
6 Ga0055543_1013880 3300004625 Bacteria 1580
7 Ga0065165_1000688 3300005262 Bacteria 48324
8 Ga0065165_1004852 3300005262 Bacteria 7992
9 Ga0070658_10208906 3300005327 Bacteria 1649
10 Ga0070658_11020360 3300005327 Bacteria 720
11 Ga0070658_11986954 3300005327 Bacteria 502
12 Ga0070670_100000022 3300005331 Bacteria 199146
13 Ga0070670_100045878 3300005331 Bacteria 3757
14 Ga0070666_10042605 3300005335 Bacteria 3038
15 Ga0070666_10064079 3300005335 Bacteria 2492
16 Ga0070661_101010164 3300005344 Bacteria 690
17 Ga0070668_100001362 3300005347 Bacteria 17489
18 Ga0070668_100004523 3300005347 Bacteria 10315
19 Ga0070668_100009396 3300005347 Bacteria 7253
20 Ga0070669_100037389 3300005353 Bacteria 3521
21 Ga0070669_100297135 3300005353 Bacteria 1298
22 Ga0070671_100023020 3300005355 Bacteria 5091
23 Ga0070659_100424254 3300005366 Bacteria 1125
24 Ga0070667_100000517 3300005367 Bacteria 38882
25 Ga0070667_100004822 3300005367 Bacteria 11300
26 Ga0070667_100012945 3300005367 Bacteria 6897
27 Ga0070678_100805492 3300005456 Bacteria 853
28 Ga0070662_100526465 3300005457 Bacteria 988
29 Ga0068853_101177451 3300005539 Bacteria 740
30 Ga0070665_100000674 3300005548 Bacteria 45861
31 Ga0070665_100001038 3300005548 Bacteria 34790
32 Ga0070665_100728339 3300005548 Bacteria 1005
33 Ga0068855_100306549 3300005563 Bacteria 1758
34 Ga0068855_100321941 3300005563 Bacteria 1709
35 Ga0070664_101115437 3300005564 Bacteria 743
36 Ga0068856_100517237 3300005614 Bacteria 1215
37 Ga0068859_100000230 3300005617 Bacteria 55064
38 Ga0068859_100020496 3300005617 Bacteria 6636
39 Ga0068864_100000125 3300005618 Bacteria 74686
40 Ga0068864_100000947 3300005618 Bacteria 24277
41 Ga0068861_100062768 3300005719 Bacteria 2854
42 Ga0068861_101505943 3300005719 Bacteria 660
43 Ga0068863_100000066 3300005841 Bacteria 117816
44 Ga0068863_100000486 3300005841 Bacteria 40496
45 Ga0068863_100003612 3300005841 Bacteria 15273
46 Ga0068863_100618779 3300005841 Bacteria 1073
47 Ga0068858_100000136 3300005842 Bacteria 77380
48 Ga0068858_100009137 3300005842 Bacteria 9477
49 Ga0068858_100101675 3300005842 Bacteria 2681
50 Ga0068858_100104460 3300005842 Bacteria 2643
51 Ga0068860_100000136 3300005843 Bacteria 120083
52 Ga0068860_100005899 3300005843 Bacteria 12329
53 Ga0068862_100012442 3300005844 Bacteria 7041
54 Ga0068862_100026726 3300005844 Bacteria 4852
55 Ga0075368_10075978 3300006042 Bacteria 1363
56 Ga0075363_100099771 3300006048 Bacteria 1606
57 Ga0075364_10031113 3300006051 Bacteria 3429
58 Ga0075367_10010195 3300006178 Bacteria 4927
59 Ga0075369_10027610 3300006186 Bacteria 2374
60 Ga0075366_10076509 3300006195 Bacteria 1997
61 Ga0075366_10373937 3300006195 Bacteria 876
62 Ga0075366_10386470 3300006195 Bacteria 861
63 Ga0075370_10018137 3300006353 Bacteria 3813
64 Ga0075370_10045623 3300006353 Bacteria 2479
65 Ga0075370_10197851 3300006353 Bacteria 1185
66 Ga0068871_100540969 3300006358 Bacteria 1054
67 Ga0097620_100000230 3300006931 Bacteria 55064
68 Ga0097620_100020496 3300006931 Bacteria 6636
69 Ga0105251_10287182 3300009011 Bacteria 744
70 Ga0105240_10028452 3300009093 Bacteria 7300
71 Ga0105240_10080907 3300009093 Bacteria 3994
72 Ga0105240_10256497 3300009093 Bacteria 2019
73 Ga0105240_10269488 3300009093 Bacteria 1961
74 Ga0105240_11003970 3300009093 Bacteria 892
75 Ga0105245_10119819 3300009098 Bacteria 2457
76 Ga0105245_10819148 3300009098 Bacteria 970
77 Ga0105247_10054464 3300009101 Bacteria 2468
78 Ga0105247_10233194 3300009101 Bacteria 1251
79 Ga0105242_10440070 3300009176 Bacteria 1226
80 Ga0105248_10012913 3300009177 Bacteria 9210
81 Ga0105248_10070558 3300009177 Bacteria 3923
82 Ga0105248_10208931 3300009177 Bacteria 2199
83 Ga0105248_10547253 3300009177 Bacteria 1306
84 Ga0105248_10572530 3300009177 Bacteria 1274
85 Ga0105237_10171052 3300009545 Bacteria 2172
86 Ga0105238_10027109 3300009551 Bacteria 5840
87 Ga0105238_10716129 3300009551 Bacteria 1013
88 Ga0105238_10913737 3300009551 Bacteria 896
89 Ga0105249_10000376 3300009553 Bacteria 44283
90 Ga0105249_10172570 3300009553 Bacteria 2098
91 Ga0105249_10323899 3300009553 Bacteria 1553
92 Ga0105249_12215956 3300009553 Bacteria 622
93 Ga0105239_10243085 3300010375 Bacteria 2020
94 Ga0105239_11337681 3300010375 Bacteria 827
95 Ga0105239_12447322 3300010375 Bacteria 608
96 Ga0163162_10031257 3300013306 Bacteria 5281
97 Ga0163162_10162296 3300013306 Bacteria 2356
98 Ga0163162_12859733 3300013306 Bacteria 555
99 Ga0157372_11632604 3300013307 Bacteria 742
100 Ga0157375_10794347 3300013308 Bacteria 1095
101 Ga0163163_10009311 3300014325 Bacteria 8761
102 Ga0163163_10320972 3300014325 Bacteria 1602
103 Ga0163163_10845982 3300014325 Bacteria 978
104 Ga0157379_10008310 3300014968 Bacteria 9022
105 Ga0157379_10013113 3300014968 Bacteria 7256
106 Ga0157379_10051688 3300014968 Bacteria 3670
107 Ga0182007_10023006 3300015262 Bacteria 2195
108 Ga0163161_10489449 3300017792 Bacteria 1000
109 Ga0206352_11037349 3300020078 Bacteria 694
110 Ga0206350_11203069 3300020080 Bacteria 855
111 Ga0224712_10519227 3300022467 Bacteria 577
112 Ga0224712_10589174 3300022467 Bacteria 542
113 Ga0209026_1003980 3300025250 Bacteria 4611
114 Ga0209148_1035913 3300025254 Bacteria 711
115 Ga0209758_1001564 3300025297 Bacteria 26244
116 Ga0209050_1000867 3300025298 Bacteria 40877
117 Ga0209257_1000227 3300025304 Bacteria 133512
118 Ga0209257_1002114 3300025304 Bacteria 20749
119 Ga0207710_10429016 3300025900 Bacteria 681
120 Ga0207680_10078883 3300025903 Bacteria 2063
121 Ga0207705_10446306 3300025909 Bacteria 1003
122 Ga0207695_10023164 3300025913 Bacteria 7025
123 Ga0207695_10062224 3300025913 Bacteria 3854
124 Ga0207695_11157732 3300025913 Bacteria 653
125 Ga0207671_10163107 3300025914 Bacteria 1727
126 Ga0207649_10557201 3300025920 Bacteria 877
127 Ga0207681_10004772 3300025923 Bacteria 8343
128 Ga0207681_10462989 3300025923 Bacteria 1033
129 Ga0207694_10042881 3300025924 Bacteria 3491
130 Ga0207694_10234951 3300025924 Bacteria 1497
131 Ga0207694_10655397 3300025924 Bacteria 885
132 Ga0207694_10901191 3300025924 Bacteria 748
133 Ga0207650_10000016 3300025925 Bacteria 361958
134 Ga0207650_10022038 3300025925 Bacteria 4508
135 Ga0207650_10274654 3300025925 Bacteria 1371
136 Ga0207687_10072627 3300025927 Bacteria 2462
137 Ga0207644_10000420 3300025931 Bacteria 27556
138 Ga0207644_11002917 3300025931 Bacteria 701
139 Ga0207706_10766411 3300025933 Bacteria 821
140 Ga0207704_10042247 3300025938 Bacteria 2682
141 Ga0207711_10010422 3300025941 Bacteria 7716
142 Ga0207711_10040688 3300025941 Bacteria 3955
143 Ga0207711_10052095 3300025941 Bacteria 3507
144 Ga0207711_10096784 3300025941 Bacteria 2605
145 Ga0207711_10535000 3300025941 Bacteria 1093
146 Ga0207679_11263836 3300025945 Bacteria 677
147 Ga0207667_10096550 3300025949 Bacteria 3050
148 Ga0207712_10000606 3300025961 Bacteria 28447
149 Ga0207712_10309655 3300025961 Bacteria 1299
150 Ga0207712_11416905 3300025961 Bacteria 622
151 Ga0207668_10000002 3300025972 Bacteria 209163
152 Ga0207668_10000117 3300025972 Bacteria 55600
153 Ga0207668_10005619 3300025972 Bacteria 7389
154 Ga0207658_10001861 3300025986 Bacteria 15797
155 Ga0207658_10002954 3300025986 Bacteria 12172
156 Ga0207658_10004670 3300025986 Bacteria 9493
157 Ga0207703_10000065 3300026035 Bacteria 126087
158 Ga0207703_10000953 3300026035 Bacteria 27985
159 Ga0207703_10002860 3300026035 Bacteria 14716
160 Ga0207703_10195324 3300026035 Bacteria 1795
161 Ga0207639_10694603 3300026041 Bacteria 944
162 Ga0207678_10146495 3300026067 Bacteria 2015
163 Ga0207678_10435726 3300026067 Bacteria 1138
164 Ga0207641_10000011 3300026088 Bacteria 384362
165 Ga0207641_10000910 3300026088 Bacteria 30634
166 Ga0207641_10006023 3300026088 Bacteria 10274
167 Ga0207648_11121050 3300026089 Bacteria 738
168 Ga0207676_10000055 3300026095 Bacteria 124678
169 Ga0207676_10000148 3300026095 Bacteria 61016
170 Ga0207676_11133846 3300026095 Bacteria 774
171 Ga0207675_100155626 3300026118 Bacteria 2178
172 Ga0207675_100770756 3300026118 Bacteria 974
173 Ga0207698_10513074 3300026142 Bacteria 1169
174 Ga0207698_10975375 3300026142 Bacteria 857
175 Ga0209999_1000549 3300027543 Bacteria 5892
176 Ga0209983_1000896 3300027665 Bacteria 6558
177 Ga0209971_1061858 3300027682 Bacteria 906
178 Ga0209813_10032239 3300027866 Bacteria 1552
179 Ga0268266_10000887 3300028379 Bacteria 38753
180 Ga0268266_10002246 3300028379 Bacteria 21046
181 Ga0268266_10470120 3300028379 Bacteria 1197
182 Ga0268265_10017523 3300028380 Bacteria 4944
183 Ga0268265_10040383 3300028380 Bacteria 3446
184 Ga0268264_10008625 3300028381 Bacteria 8470
185 Ga0268264_10013717 3300028381 Bacteria 6671
186 Ga0265338_10748713 3300028800 Bacteria 672
187 Ga0307511_10023353 3300030521 Bacteria 5768
188 Ga0307513_10002925 3300031456 Bacteria 23351
189 Ga0307408_101160328 3300031548 Bacteria 719
190 Ga0265314_10299499 3300031711 Bacteria 903
191 Ga0307405_10583431 3300031731 Bacteria 910
192 Ga0307413_10310774 3300031824 Bacteria 1199
193 Ga0307413_10457232 3300031824 Bacteria 1015
194 Ga0307410_10252706 3300031852 Bacteria 1371
195 Ga0307410_11130425 3300031852 Bacteria 680
196 Ga0307406_10837231 3300031901 Bacteria 779
197 Ga0307414_10151791 3300032004 Bacteria 1829
198 Ga0307414_10464002 3300032004 Bacteria 1113
199 Ga0307414_10611615 3300032004 Bacteria 978
200 Ga0307411_10736250 3300032005 Bacteria 862
201 Ga0307510_10111687 3300033180 Bacteria 2473
202 Ga0307510_10480695 3300033180 Bacteria 684
203 Ga0373959_0201713 3300034820 Bacteria 526
204 Ga0373926_0155846 3300035083 Bacteria 871
205 Ga0373944_0005738 3300035089 Bacteria 3277
206 Ga0373927_0000173 3300035695 Bacteria 50996
207 Ga0373925_0000049 3300037068 Bacteria 128065
208 Ga0395899_0000115 3300037312 Bacteria 133287
209 Ga0395900_0000002 3300037418 Bacteria 671103
210 Ga0395900_0117469 3300037418 Bacteria 2729
211 Ga0395900_0558187 3300037418 Bacteria 1089
212 Ga0395898_0058912 3300037466 Bacteria 3737
213 Ga0395898_0184989 3300037466 Bacteria 1990
214 Ga0395905_0032539 3300037471 Bacteria 4904
215 Ga0395905_0062517 3300037471 Bacteria 3483
216 Ga0395905_0528093 3300037471 Bacteria 1081
217 Ga0395905_0555760 3300037471 Bacteria 1049
218 Ga0395905_0721597 3300037471 Bacteria 899
219 Ga0395901_0000021 3300038443 Bacteria 307734
220 Ga0395901_0946102 3300038443 Bacteria 840
221 Ga0436365_0251153 3300039437 Bacteria 3951
222 Ga0451853_2677717 3300041512 Bacteria 566
223 Ga0450912_012864 3300042116 Bacteria 743
224 Ga0450920_108190 3300042122 Bacteria 580
225 Ga0466968_0492388 3300044735 Bacteria 610
226 Ga0466957_0431131 3300044842 Bacteria 906
227 Ga0495629_0601403 3300046459 Bacteria 735
228 Ga0495650_0108778 3300046471 Bacteria 1032
229 Ga0495650_0166255 3300046471 Bacteria 783
230 Ga0495583_0010249 3300046506 Bacteria 5493
231 Ga0495583_0165576 3300046506 Bacteria 910
232 Ga0495610_0024953 3300046512 Bacteria 3219
233 Ga0495620_0092619 3300046515 Bacteria 1211
234 Ga0495620_0171536 3300046515 Bacteria 841
235 Ga0495628_0049549 3300046516 Bacteria 3326
236 Ga0495637_0214174 3300046520 Bacteria 703
237 Ga0495643_0069654 3300046522 Bacteria 1848
238 Ga0495642_0237948 3300046528 Bacteria 795
239 Ga0495609_0077997 3300046538 Bacteria 1450
240 Ga0495597_0008854 3300046542 Bacteria 5021
241 Ga0495645_0087170 3300046543 Bacteria 2233
242 Ga0495622_0010168 3300046557 Bacteria 4349
243 Ga0495668_0070529 3300046616 Bacteria 1921
244 Ga0495668_0102822 3300046616 Bacteria 1563
245 Ga0495668_0130904 3300046616 Bacteria 1373
246 Ga0495668_0491100 3300046616 Bacteria 676
247 Ga0495668_0492887 3300046616 Bacteria 675
248 Ga0495611_0183154 3300046648 Bacteria 978
249 Ga0495625_0328928 3300046660 Bacteria 971
250 Ga0495625_0556381 3300046660 Bacteria 694
251 Ga0495623_0405155 3300046679 Bacteria 733
252 Ga0495658_0528657 3300046683 Bacteria 755
253 Ga0495669_0190766 3300046684 Bacteria 978
254 Ga0495671_0367242 3300046692 Bacteria 690
255 Ga0495674_0146542 3300047319 Bacteria 1982
256 Ga0495672_0033952 3300047320 Bacteria 3157
257 Ga0495687_065435 3300047443 Bacteria 1480
258 Ga0495686_0003895 3300047472 Bacteria 12594
259 Ga0496101_0082928 3300048904 Bacteria 2373
260 Ga0496102_0145572 3300048905 Bacteria 2224
261 Ga0496102_0219189 3300048905 Bacteria 1793
262 Ga0496103_0045150 3300048906 Bacteria 2718
263 Ga0496107_0058915 3300048910 Bacteria 2778
264 Ga0496112_0340586 3300048915 Bacteria 1443
265 Ga0496112_0403708 3300048915 Bacteria 1306
266 Ga0496117_0031511 3300048920 Bacteria 4045
267 Ga0496118_0033831 3300048921 Bacteria 4184
268 Ga0496121_0000035 3300048924 Bacteria 374316
269 Ga0496125_0117301 3300048928 Bacteria 1909
270 Ga0501306_026975 3300049127 Bacteria 834
271 Ga0501311_028422 3300049527 Bacteria 798
272 Ga0501321_019580 3300049537 Bacteria 830
273 Ga0501325_031362 3300049541 Bacteria 610
274 Ga0501335_042665 3300049551 Bacteria 538
275 Ga0501032_0013413 3300049569 Bacteria 5831
276 Ga0501033_0046252 3300049570 Bacteria 3236
277 Ga0501033_0665592 3300049570 Bacteria 710
278 Ga0501034_0358257 3300049571 Bacteria 1386
279 Ga0501034_1635910 3300049571 Bacteria 517
280 Ga0501037_0044820 3300049573 Bacteria 3248
281 Ga0501038_0660973 3300049574 Bacteria 786
282 Ga0501047_0008955 3300049581 Bacteria 9450
283 Ga0501047_0065720 3300049581 Bacteria 3496
284 Ga0501047_0319435 3300049581 Bacteria 1393
285 Ga0501259_065677 3300049688 Bacteria 768
286 Ga0501225_0184866 3300049705 Bacteria 653
287 Ga0501080_1291753 3300049742 Bacteria 625
288 Ga0501266_027091 3300049763 Bacteria 805
289 Ga0501044_0003998 3300049823 Bacteria 16515
290 nmdc:mga00v17_62456_c1 3300050491 Bacteria 2292
291 nmdc:mga0k408_49558_c1 3300050493 Bacteria 2431
292 nmdc:mga0k408_519331_c1 3300050493 Bacteria 705
293 nmdc:mga06z11_179033_c1 3300050494 Bacteria 1222
294 nmdc:mga04h51_29791_c1 3300050495 Bacteria 1713
295 nmdc:mga07m45_14679_c1 3300050496 Bacteria 4179
296 nmdc:mga07m45_261403_c1 3300050496 Bacteria 1007
297 nmdc:mga07m45_42423_c1 3300050496 Bacteria 1974
298 nmdc:mga0sz30_26558_c1 3300050516 Bacteria 2374
299 Ga0495601_0593378 3300053077 Bacteria 711
300 Ga0500635_0000087 3300053080 Bacteria 59735
301 Ga0500643_007545 3300053087 Bacteria 4367
302 Ga0500643_024335 3300053087 Bacteria 1923
303 Ga0500651_0004070 3300053093 Bacteria 8130
304 Ga0500641_0009430 3300053096 Bacteria 3511
305 Ga0500556_0033259 3300053104 Bacteria 1767
306 Ga0500562_028035 3300053108 Bacteria 1479
307 Ga0500569_003347 3300053109 Bacteria 3267
308 Ga0500572_202998 3300053111 Bacteria 649
309 Ga0500595_052933 3300053119 Bacteria 1251
310 Ga0500595_100057 3300053119 Bacteria 831
311 Ga0500595_137732 3300053119 Bacteria 685
312 Ga0500608_001781 3300053122 Bacteria 7695
313 Ga0500614_006852 3300053123 Bacteria 2395
314 Ga0500628_154949 3300053129 Bacteria 643
315 Ga0500559_0010118 3300053136 Bacteria 4059
316 Ga0500559_0144164 3300053136 Bacteria 1116
317 Ga0500590_005741 3300053148 Bacteria 5992
318 Ga0500603_084242 3300053150 Bacteria 925
319 Ga0500622_0030189 3300053156 Bacteria 2847
320 Ga0500638_117438 3300053162 Bacteria 1221
321 Ga0500636_0003768 3300053177 Bacteria 8563
322 Ga0500625_102278 3300053729 Bacteria 1198
323 Ga0500645_004686 3300053730 Bacteria 5197
324 Ga0500596_000110 3300053735 Bacteria 11529
325 Ga0587077_047163 3300059493 Bacteria 888
326 Ga0587092_043400 3300059512 Bacteria 791
327 Ga0587092_103605 3300059512 Bacteria 589
328 Ga0587106_019400 3300059605 Bacteria 992
329 Ga0587106_050968 3300059605 Bacteria 734
330 Ga0587109_027596 3300059624 Bacteria 1057
331 Ga0587128_152427 3300059630 Bacteria 527
332 Ga0587130_051129 3300059631 Bacteria 518
333 Ga0587068_039274 3300059641 Bacteria 851
334 Ga0587072_039515 3300059643 Bacteria 912
335 Ga0587076_053879 3300059645 Bacteria 792
336 Ga0587114_017225 3300059655 Bacteria 978
337 Ga0587114_048801 3300059655 Bacteria 710
338 Ga0587124_043933 3300059660 Bacteria 529
339 Ga0587111_0028127 3300060346 Bacteria 1131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059512 Ga0587092_043400 Ga0587092_043400_54_473 118
2 3300059605 Ga0587106_050968 Ga0587106_050968_262_681 118
3 3300059641 Ga0587068_039274 Ga0587068_039274_54_473 118
4 3300059643 Ga0587072_039515 Ga0587072_039515_53_472 118
5 3300059645 Ga0587076_053879 Ga0587076_053879_54_473 118
6 3300059655 Ga0587114_017225 Ga0587114_017225_506_925 118
7 3300059660 Ga0587124_043933 Ga0587124_043933_54_473 118
8 3300046459 Ga0495629_0601403 Ga0495629_0601403_69_494 125
9 3300005366 Ga0070659_100424254 Ga0070659_1004242542 127
10 3300025933 Ga0207706_10766411 Ga0207706_107664111 127
11 3300026067 Ga0207678_10146495 Ga0207678_101464954 127
12 3300005327 Ga0070658_11986954 Ga0070658_119869541 128
13 3300046648 Ga0495611_0183154 Ga0495611_0183154_572_958 128
14 3300031852 Ga0307410_10252706 Ga0307410_102527063 132
15 3300032004 Ga0307414_10151791 Ga0307414_101517912 132
16 3300044842 Ga0466957_0431131 Ga0466957_0431131_173_592 132
17 3300046679 Ga0495623_0405155 Ga0495623_0405155_308_706 132
18 iso_pu_bacteria 2643221598 2643998685 132
19 iso_pu_bacteria 2643221614 2644087362 132
20 iso_pu_bacteria 2643221661 2644344594 132
21 iso_pu_bacteria 2643221666 2644366722 132
22 3300037471 Ga0395905_0528093 Ga0395905_0528093_575_997 133
23 3300009093 Ga0105240_10028452 Ga0105240_100284527 134
24 3300025913 Ga0207695_10023164 Ga0207695_100231642 134
25 3300037418 Ga0395900_0117469 Ga0395900_0117469_2031_2438 135
26 3300048910 Ga0496107_0058915 Ga0496107_0058915_1603_2019 135
27 3300015262 Ga0182007_10023006 Ga0182007_100230062 136
28 3300031548 Ga0307408_101160328 Ga0307408_1011603282 136
29 3300031731 Ga0307405_10583431 Ga0307405_105834312 136
30 3300031824 Ga0307413_10310774 Ga0307413_103107742 136
31 3300031852 Ga0307410_11130425 Ga0307410_111304251 136
32 3300031901 Ga0307406_10837231 Ga0307406_108372311 136
33 3300032004 Ga0307414_10464002 Ga0307414_104640023 136
34 3300037471 Ga0395905_0062517 Ga0395905_0062517_819_1229 136
35 3300048928 Ga0496125_0117301 Ga0496125_0117301_1305_1718 136
36 3300059631 Ga0587130_051129 Ga0587130_051129_53_466 136
37 3300005614 Ga0068856_100517237 Ga0068856_1005172371 137
38 3300010375 Ga0105239_12447322 Ga0105239_124473221 137
39 3300048905 Ga0496102_0219189 Ga0496102_0219189_376_792 138
40 3300048906 Ga0496103_0045150 Ga0496103_0045150_698_1114 138
41 3300048920 Ga0496117_0031511 Ga0496117_0031511_239_655 138
42 3300048921 Ga0496118_0033831 Ga0496118_0033831_2789_3205 138
43 3300053087 Ga0500643_007545 Ga0500643_007545_3780_4199 138
44 3300009093 Ga0105240_10080907 Ga0105240_100809072 139
45 3300022467 Ga0224712_10589174 Ga0224712_105891741 139
46 3300025254 Ga0209148_1035913 Ga0209148_10359131 139
47 3300025913 Ga0207695_10062224 Ga0207695_100622246 139
48 3300025924 Ga0207694_10655397 Ga0207694_106553972 139
49 3300025949 Ga0207667_10096550 Ga0207667_100965504 139
50 3300031711 Ga0265314_10299499 Ga0265314_102994991 139
51 3300033180 Ga0307510_10111687 Ga0307510_101116873 139
52 3300033180 Ga0307510_10480695 Ga0307510_104806951 139
53 3300035089 Ga0373944_0005738 Ga0373944_0005738_2014_2433 139
54 3300035695 Ga0373927_0000173 Ga0373927_0000173_37351_37770 139
55 3300037068 Ga0373925_0000049 Ga0373925_0000049_31239_31658 139
56 3300037418 Ga0395900_0558187 Ga0395900_0558187_270_689 139
57 3300037466 Ga0395898_0184989 Ga0395898_0184989_176_595 139
58 3300038443 Ga0395901_0946102 Ga0395901_0946102_383_802 139
59 3300046471 Ga0495650_0108778 Ga0495650_0108778_16_435 139
60 3300049570 Ga0501033_0665592 Ga0501033_0665592_52_471 139
61 3300049571 Ga0501034_0358257 Ga0501034_0358257_795_1217 139
62 3300049581 Ga0501047_0008955 Ga0501047_0008955_706_1125 139
63 3300049581 Ga0501047_0319435 Ga0501047_0319435_483_902 139
64 3300053129 Ga0500628_154949 Ga0500628_154949_26_445 139
65 3300053156 Ga0500622_0030189 Ga0500622_0030189_668_1102 139
66 3300059655 Ga0587114_048801 Ga0587114_048801_198_617 139
67 3300005327 Ga0070658_10208906 Ga0070658_102089061 140
68 3300005327 Ga0070658_11020360 Ga0070658_110203601 140
69 3300005331 Ga0070670_100000022 Ga0070670_10000002289 140
70 3300005331 Ga0070670_100045878 Ga0070670_1000458786 140
71 3300005335 Ga0070666_10042605 Ga0070666_100426055 140
72 3300005335 Ga0070666_10064079 Ga0070666_100640794 140
73 3300005344 Ga0070661_101010164 Ga0070661_1010101641 140
74 3300005347 Ga0070668_100001362 Ga0070668_10000136217 140
75 3300005347 Ga0070668_100004523 Ga0070668_1000045239 140
76 3300005347 Ga0070668_100009396 Ga0070668_1000093966 140
77 3300005353 Ga0070669_100037389 Ga0070669_1000373895 140
78 3300005353 Ga0070669_100297135 Ga0070669_1002971352 140
79 3300005355 Ga0070671_100023020 Ga0070671_1000230206 140
80 3300005367 Ga0070667_100000517 Ga0070667_10000051723 140
81 3300005367 Ga0070667_100004822 Ga0070667_1000048227 140
82 3300005367 Ga0070667_100012945 Ga0070667_1000129457 140
83 3300005457 Ga0070662_100526465 Ga0070662_1005264652 140
84 3300005539 Ga0068853_101177451 Ga0068853_1011774511 140
85 3300005548 Ga0070665_100000674 Ga0070665_10000067425 140
86 3300005548 Ga0070665_100001038 Ga0070665_10000103826 140
87 3300005548 Ga0070665_100728339 Ga0070665_1007283391 140
88 3300005563 Ga0068855_100306549 Ga0068855_1003065491 140
89 3300005563 Ga0068855_100321941 Ga0068855_1003219413 140
90 3300005564 Ga0070664_101115437 Ga0070664_1011154371 140
91 3300005617 Ga0068859_100000230 Ga0068859_10000023046 140
92 3300005617 Ga0068859_100020496 Ga0068859_1000204966 140
93 3300005618 Ga0068864_100000125 Ga0068864_10000012532 140
94 3300005618 Ga0068864_100000947 Ga0068864_10000094726 140
95 3300005719 Ga0068861_100062768 Ga0068861_1000627683 140
96 3300005719 Ga0068861_101505943 Ga0068861_1015059432 140
97 3300005841 Ga0068863_100000066 Ga0068863_10000006643 140
98 3300005841 Ga0068863_100000486 Ga0068863_10000048618 140
99 3300005841 Ga0068863_100003612 Ga0068863_1000036124 140
100 3300005841 Ga0068863_100618779 Ga0068863_1006187794 140
101 3300005842 Ga0068858_100000136 Ga0068858_10000013630 140
102 3300005842 Ga0068858_100009137 Ga0068858_10000913710 140
103 3300005842 Ga0068858_100101675 Ga0068858_1001016755 140
104 3300005842 Ga0068858_100104460 Ga0068858_1001044603 140
105 3300005843 Ga0068860_100000136 Ga0068860_100000136113 140
106 3300005843 Ga0068860_100005899 Ga0068860_10000589911 140
107 3300005844 Ga0068862_100012442 Ga0068862_1000124425 140
108 3300005844 Ga0068862_100026726 Ga0068862_1000267266 140
109 3300006042 Ga0075368_10075978 Ga0075368_100759782 140
110 3300006048 Ga0075363_100099771 Ga0075363_1000997712 140
111 3300006051 Ga0075364_10031113 Ga0075364_100311136 140
112 3300006178 Ga0075367_10010195 Ga0075367_100101958 140
113 3300006186 Ga0075369_10027610 Ga0075369_100276105 140
114 3300006195 Ga0075366_10076509 Ga0075366_100765093 140
115 3300006353 Ga0075370_10045623 Ga0075370_100456234 140
116 3300006358 Ga0068871_100540969 Ga0068871_1005409691 140
117 3300006931 Ga0097620_100000230 Ga0097620_10000023046 140
118 3300006931 Ga0097620_100020496 Ga0097620_1000204966 140
119 3300009011 Ga0105251_10287182 Ga0105251_102871822 140
120 3300009093 Ga0105240_10256497 Ga0105240_102564974 140
121 3300009093 Ga0105240_10269488 Ga0105240_102694884 140
122 3300009098 Ga0105245_10119819 Ga0105245_101198193 140
123 3300009098 Ga0105245_10819148 Ga0105245_108191481 140
124 3300009101 Ga0105247_10054464 Ga0105247_100544645 140
125 3300009101 Ga0105247_10233194 Ga0105247_102331941 140
126 3300009176 Ga0105242_10440070 Ga0105242_104400702 140
127 3300009177 Ga0105248_10012913 Ga0105248_100129133 140
128 3300009177 Ga0105248_10070558 Ga0105248_100705582 140
129 3300009177 Ga0105248_10208931 Ga0105248_102089314 140
130 3300009177 Ga0105248_10547253 Ga0105248_105472532 140
131 3300009177 Ga0105248_10572530 Ga0105248_105725302 140
132 3300009545 Ga0105237_10171052 Ga0105237_101710522 140
133 3300009551 Ga0105238_10027109 Ga0105238_100271094 140
134 3300009551 Ga0105238_10716129 Ga0105238_107161292 140
135 3300009551 Ga0105238_10913737 Ga0105238_109137371 140
136 3300009553 Ga0105249_10000376 Ga0105249_100003767 140
137 3300009553 Ga0105249_10172570 Ga0105249_101725703 140
138 3300009553 Ga0105249_10323899 Ga0105249_103238991 140
139 3300009553 Ga0105249_12215956 Ga0105249_122159561 140
140 3300010375 Ga0105239_10243085 Ga0105239_102430852 140
141 3300010375 Ga0105239_11337681 Ga0105239_113376812 140
142 3300013306 Ga0163162_10031257 Ga0163162_100312576 140
143 3300013306 Ga0163162_10162296 Ga0163162_101622962 140
144 3300013306 Ga0163162_12859733 Ga0163162_128597331 140
145 3300013307 Ga0157372_11632604 Ga0157372_116326041 140
146 3300014325 Ga0163163_10009311 Ga0163163_100093117 140
147 3300014325 Ga0163163_10320972 Ga0163163_103209723 140
148 3300014325 Ga0163163_10845982 Ga0163163_108459821 140
149 3300014968 Ga0157379_10008310 Ga0157379_100083107 140
150 3300014968 Ga0157379_10013113 Ga0157379_1001311310 140
151 3300014968 Ga0157379_10051688 Ga0157379_100516885 140
152 3300017792 Ga0163161_10489449 Ga0163161_104894491 140
153 3300020078 Ga0206352_11037349 Ga0206352_110373491 140
154 3300020080 Ga0206350_11203069 Ga0206350_112030692 140
155 3300022467 Ga0224712_10519227 Ga0224712_105192272 140
156 3300025900 Ga0207710_10429016 Ga0207710_104290161 140
157 3300025903 Ga0207680_10078883 Ga0207680_100788833 140
158 3300025909 Ga0207705_10446306 Ga0207705_104463062 140
159 3300025913 Ga0207695_11157732 Ga0207695_111577321 140
160 3300025914 Ga0207671_10163107 Ga0207671_101631073 140
161 3300025920 Ga0207649_10557201 Ga0207649_105572012 140
162 3300025923 Ga0207681_10004772 Ga0207681_100047728 140
163 3300025923 Ga0207681_10462989 Ga0207681_104629892 140
164 3300025924 Ga0207694_10042881 Ga0207694_100428815 140
165 3300025924 Ga0207694_10234951 Ga0207694_102349512 140
166 3300025924 Ga0207694_10901191 Ga0207694_109011912 140
167 3300025925 Ga0207650_10000016 Ga0207650_1000001657 140
168 3300025925 Ga0207650_10022038 Ga0207650_100220386 140
169 3300025927 Ga0207687_10072627 Ga0207687_100726273 140
170 3300025931 Ga0207644_10000420 Ga0207644_1000042018 140
171 3300025931 Ga0207644_11002917 Ga0207644_110029171 140
172 3300025941 Ga0207711_10010422 Ga0207711_100104227 140
173 3300025941 Ga0207711_10040688 Ga0207711_100406882 140
174 3300025941 Ga0207711_10052095 Ga0207711_100520956 140
175 3300025941 Ga0207711_10096784 Ga0207711_100967845 140
176 3300025941 Ga0207711_10535000 Ga0207711_105350001 140
177 3300025945 Ga0207679_11263836 Ga0207679_112638361 140
178 3300025961 Ga0207712_10000606 Ga0207712_100006066 140
179 3300025961 Ga0207712_10309655 Ga0207712_103096552 140
180 3300025961 Ga0207712_11416905 Ga0207712_114169051 140
181 3300025972 Ga0207668_10000002 Ga0207668_1000000272 140
182 3300025972 Ga0207668_10000117 Ga0207668_1000011735 140
183 3300025972 Ga0207668_10005619 Ga0207668_100056196 140
184 3300025986 Ga0207658_10001861 Ga0207658_1000186112 140
185 3300025986 Ga0207658_10002954 Ga0207658_1000295413 140
186 3300025986 Ga0207658_10004670 Ga0207658_100046702 140
187 3300026035 Ga0207703_10000065 Ga0207703_1000006559 140
188 3300026035 Ga0207703_10000953 Ga0207703_1000095321 140
189 3300026035 Ga0207703_10002860 Ga0207703_1000286013 140
190 3300026035 Ga0207703_10195324 Ga0207703_101953243 140
191 3300026041 Ga0207639_10694603 Ga0207639_106946031 140
192 3300026067 Ga0207678_10435726 Ga0207678_104357262 140
193 3300026088 Ga0207641_10000011 Ga0207641_10000011346 140
194 3300026088 Ga0207641_10000910 Ga0207641_100009106 140
195 3300026088 Ga0207641_10006023 Ga0207641_100060233 140
196 3300026095 Ga0207676_10000055 Ga0207676_10000055124 140
197 3300026095 Ga0207676_10000148 Ga0207676_1000014839 140
198 3300026118 Ga0207675_100155626 Ga0207675_1001556263 140
199 3300026118 Ga0207675_100770756 Ga0207675_1007707562 140
200 3300026142 Ga0207698_10513074 Ga0207698_105130742 140
201 3300026142 Ga0207698_10975375 Ga0207698_109753751 140
202 3300027543 Ga0209999_1000549 Ga0209999_10005492 140
203 3300027665 Ga0209983_1000896 Ga0209983_10008966 140
204 3300027682 Ga0209971_1061858 Ga0209971_10618581 140
205 3300027866 Ga0209813_10032239 Ga0209813_100322392 140
206 3300028379 Ga0268266_10000887 Ga0268266_1000088719 140
207 3300028379 Ga0268266_10002246 Ga0268266_1000224610 140
208 3300028379 Ga0268266_10470120 Ga0268266_104701202 140
209 3300028380 Ga0268265_10017523 Ga0268265_100175232 140
210 3300028380 Ga0268265_10040383 Ga0268265_100403835 140
211 3300028381 Ga0268264_10008625 Ga0268264_100086259 140
212 3300028381 Ga0268264_10013717 Ga0268264_100137171 140
213 3300028800 Ga0265338_10748713 Ga0265338_107487131 140
214 3300031456 Ga0307513_10002925 Ga0307513_100029258 140
215 3300034820 Ga0373959_0201713 Ga0373959_0201713_56_478 140
216 3300035083 Ga0373926_0155846 Ga0373926_0155846_308_742 140
217 3300037312 Ga0395899_0000115 Ga0395899_0000115_30478_30900 140
218 3300037418 Ga0395900_0000002 Ga0395900_0000002_67808_68230 140
219 3300037466 Ga0395898_0058912 Ga0395898_0058912_1755_2177 140
220 3300037471 Ga0395905_0032539 Ga0395905_0032539_1433_1855 140
221 3300038443 Ga0395901_0000021 Ga0395901_0000021_226679_227101 140
222 3300039437 Ga0436365_0251153 Ga0436365_0251153_3016_3438 140
223 3300041512 Ga0451853_2677717 Ga0451853_2677717_100_522 140
224 3300042116 Ga0450912_012864 Ga0450912_012864_214_639 140
225 3300042122 Ga0450920_108190 Ga0450920_108190_21_443 140
226 3300044735 Ga0466968_0492388 Ga0466968_0492388_150_572 140
227 3300046506 Ga0495583_0010249 Ga0495583_0010249_2074_2496 140
228 3300046506 Ga0495583_0165576 Ga0495583_0165576_233_655 140
229 3300046512 Ga0495610_0024953 Ga0495610_0024953_409_831 140
230 3300046515 Ga0495620_0092619 Ga0495620_0092619_433_855 140
231 3300046516 Ga0495628_0049549 Ga0495628_0049549_2730_3161 140
232 3300046520 Ga0495637_0214174 Ga0495637_0214174_178_621 140
233 3300046522 Ga0495643_0069654 Ga0495643_0069654_770_1192 140
234 3300046528 Ga0495642_0237948 Ga0495642_0237948_286_708 140
235 3300046538 Ga0495609_0077997 Ga0495609_0077997_509_931 140
236 3300046542 Ga0495597_0008854 Ga0495597_0008854_4004_4426 140
237 3300046543 Ga0495645_0087170 Ga0495645_0087170_1313_1744 140
238 3300046557 Ga0495622_0010168 Ga0495622_0010168_2608_3030 140
239 3300046616 Ga0495668_0491100 Ga0495668_0491100_82_504 140
240 3300046660 Ga0495625_0328928 Ga0495625_0328928_525_947 140
241 3300046683 Ga0495658_0528657 Ga0495658_0528657_203_625 140
242 3300046684 Ga0495669_0190766 Ga0495669_0190766_284_706 140
243 3300046692 Ga0495671_0367242 Ga0495671_0367242_122_544 140
244 3300047319 Ga0495674_0146542 Ga0495674_0146542_405_836 140
245 3300047320 Ga0495672_0033952 Ga0495672_0033952_268_690 140
246 3300047443 Ga0495687_065435 Ga0495687_065435_291_713 140
247 3300048904 Ga0496101_0082928 Ga0496101_0082928_14_436 140
248 3300048905 Ga0496102_0145572 Ga0496102_0145572_912_1334 140
249 3300048915 Ga0496112_0340586 Ga0496112_0340586_715_1137 140
250 3300048915 Ga0496112_0403708 Ga0496112_0403708_305_727 140
251 3300048924 Ga0496121_0000035 Ga0496121_0000035_315589_316011 140
252 3300049127 Ga0501306_026975 Ga0501306_026975_357_779 140
253 3300049527 Ga0501311_028422 Ga0501311_028422_37_459 140
254 3300049537 Ga0501321_019580 Ga0501321_019580_56_478 140
255 3300049551 Ga0501335_042665 Ga0501335_042665_89_511 140
256 3300049569 Ga0501032_0013413 Ga0501032_0013413_756_1178 140
257 3300049570 Ga0501033_0046252 Ga0501033_0046252_2494_2916 140
258 3300049571 Ga0501034_1635910 Ga0501034_1635910_77_502 140
259 3300049573 Ga0501037_0044820 Ga0501037_0044820_1576_1998 140
260 3300049574 Ga0501038_0660973 Ga0501038_0660973_58_480 140
261 3300049581 Ga0501047_0065720 Ga0501047_0065720_1876_2298 140
262 3300049688 Ga0501259_065677 Ga0501259_065677_131_553 140
263 3300049742 Ga0501080_1291753 Ga0501080_1291753_28_450 140
264 3300049763 Ga0501266_027091 Ga0501266_027091_310_732 140
265 3300049823 Ga0501044_0003998 Ga0501044_0003998_16002_16424 140
266 3300050491 nmdc:mga00v17_62456_c1 nmdc:mga00v17_62456_c1_699_1121 140
267 3300050493 nmdc:mga0k408_49558_c1 nmdc:mga0k408_49558_c1_325_747 140
268 3300050494 nmdc:mga06z11_179033_c1 nmdc:mga06z11_179033_c1_157_579 140
269 3300050495 nmdc:mga04h51_29791_c1 nmdc:mga04h51_29791_c1_442_864 140
270 3300050496 nmdc:mga07m45_14679_c1 nmdc:mga07m45_14679_c1_1961_2383 140
271 3300050516 nmdc:mga0sz30_26558_c1 nmdc:mga0sz30_26558_c1_1558_1980 140
272 3300053077 Ga0495601_0593378 Ga0495601_0593378_183_614 140
273 3300053080 Ga0500635_0000087 Ga0500635_0000087_13440_13862 140
274 3300053087 Ga0500643_024335 Ga0500643_024335_776_1198 140
275 3300053093 Ga0500651_0004070 Ga0500651_0004070_4782_5204 140
276 3300053096 Ga0500641_0009430 Ga0500641_0009430_1960_2382 140
277 3300053104 Ga0500556_0033259 Ga0500556_0033259_913_1356 140
278 3300053108 Ga0500562_028035 Ga0500562_028035_511_933 140
279 3300053109 Ga0500569_003347 Ga0500569_003347_2362_2784 140
280 3300053111 Ga0500572_202998 Ga0500572_202998_157_579 140
281 3300053119 Ga0500595_052933 Ga0500595_052933_250_672 140
282 3300053119 Ga0500595_100057 Ga0500595_100057_394_816 140
283 3300053119 Ga0500595_137732 Ga0500595_137732_220_666 140
284 3300053122 Ga0500608_001781 Ga0500608_001781_4604_5026 140
285 3300053123 Ga0500614_006852 Ga0500614_006852_633_1055 140
286 3300053136 Ga0500559_0010118 Ga0500559_0010118_48_470 140
287 3300053136 Ga0500559_0144164 Ga0500559_0144164_499_921 140
288 3300053148 Ga0500590_005741 Ga0500590_005741_4020_4442 140
289 3300053150 Ga0500603_084242 Ga0500603_084242_338_760 140
290 3300053162 Ga0500638_117438 Ga0500638_117438_414_836 140
291 3300053177 Ga0500636_0003768 Ga0500636_0003768_5265_5687 140
292 3300053729 Ga0500625_102278 Ga0500625_102278_475_897 140
293 3300053735 Ga0500596_000110 Ga0500596_000110_1255_1677 140
294 3300059493 Ga0587077_047163 Ga0587077_047163_87_509 140
295 3300059512 Ga0587092_103605 Ga0587092_103605_57_479 140
296 3300059605 Ga0587106_019400 Ga0587106_019400_382_804 140
297 3300059624 Ga0587109_027596 Ga0587109_027596_244_666 140
298 3300059630 Ga0587128_152427 Ga0587128_152427_49_471 140
299 3300060346 Ga0587111_0028127 Ga0587111_0028127_112_534 140
300 3300002741 JGI25157J39369_1017185 JGI25157J39369_10171852 141
301 3300003215 JGI25153J46596_10082419 JGI25153J46596_100824192 141
302 3300003791 Ga0055530_10000303 Ga0055530_1000030320 141
303 3300003794 Ga0055531_10004963 Ga0055531_100049635 141
304 3300003794 Ga0055531_10010084 Ga0055531_100100843 141
305 3300004625 Ga0055543_1013880 Ga0055543_10138801 141
306 3300005262 Ga0065165_1000688 Ga0065165_100068846 141
307 3300005262 Ga0065165_1004852 Ga0065165_10048527 141
308 3300005456 Ga0070678_100805492 Ga0070678_1008054922 141
309 3300006195 Ga0075366_10373937 Ga0075366_103739372 141
310 3300006195 Ga0075366_10386470 Ga0075366_103864702 141
311 3300006353 Ga0075370_10018137 Ga0075370_100181375 141
312 3300006353 Ga0075370_10197851 Ga0075370_101978512 141
313 3300009093 Ga0105240_11003970 Ga0105240_110039702 141
314 3300013308 Ga0157375_10794347 Ga0157375_107943472 141
315 3300025250 Ga0209026_1003980 Ga0209026_10039804 141
316 3300025297 Ga0209758_1001564 Ga0209758_10015646 141
317 3300025298 Ga0209050_1000867 Ga0209050_10008674 141
318 3300025304 Ga0209257_1000227 Ga0209257_1000227103 141
319 3300025304 Ga0209257_1002114 Ga0209257_10021145 141
320 3300025925 Ga0207650_10274654 Ga0207650_102746542 141
321 3300025938 Ga0207704_10042247 Ga0207704_100422471 141
322 3300026089 Ga0207648_11121050 Ga0207648_111210502 141
323 3300026095 Ga0207676_11133846 Ga0207676_111338462 141
324 3300030521 Ga0307511_10023353 Ga0307511_100233538 141
325 3300031824 Ga0307413_10457232 Ga0307413_104572322 141
326 3300032004 Ga0307414_10611615 Ga0307414_106116152 141
327 3300032005 Ga0307411_10736250 Ga0307411_107362501 141
328 3300037471 Ga0395905_0555760 Ga0395905_0555760_518_949 141
329 3300037471 Ga0395905_0721597 Ga0395905_0721597_95_520 141
330 3300046471 Ga0495650_0166255 Ga0495650_0166255_44_517 141
331 3300046515 Ga0495620_0171536 Ga0495620_0171536_282_713 141
332 3300046616 Ga0495668_0070529 Ga0495668_0070529_1377_1802 141
333 3300046616 Ga0495668_0102822 Ga0495668_0102822_553_978 141
334 3300046616 Ga0495668_0130904 Ga0495668_0130904_783_1214 141
335 3300046616 Ga0495668_0492887 Ga0495668_0492887_196_627 141
336 3300046660 Ga0495625_0556381 Ga0495625_0556381_251_676 141
337 3300047472 Ga0495686_0003895 Ga0495686_0003895_8771_9196 141
338 3300049541 Ga0501325_031362 Ga0501325_031362_56_481 141
339 3300049705 Ga0501225_0184866 Ga0501225_0184866_123_548 141
340 3300050493 nmdc:mga0k408_519331_c1 nmdc:mga0k408_519331_c1_128_601 141
341 3300050496 nmdc:mga07m45_261403_c1 nmdc:mga07m45_261403_c1_500_925 141
342 3300050496 nmdc:mga07m45_42423_c1 nmdc:mga07m45_42423_c1_617_1048 141
343 3300053730 Ga0500645_004686 Ga0500645_004686_549_974 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

54

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8052 33 126
6pqb-assembly1.cif.gz_A crystal structure of aminoglycoside-resistance methyltransferase rmtc bound to s-adenosylhomocysteine (sah) 0.7931 104 126
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.7813 37 128
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.7728 37 128
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.764 33 123
ID Description Score Start End Superfamily
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8337 34 125 2.60.40.790
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8061 33 123 2.60.40.790
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8052 33 126 2.60.40.790
af_G5EEI8_215_319_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.802 32 125 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7967 34 128 2.60.40.790
ID Description Score Start End GO Terms
AF-W0F8G4-F1-model_v4 SHSP domain-containing protein 0.7868 31 127
AF-A0A3B9EP23-F1-model_v4 Heat-shock protein 0.7412 33 141
AF-A0A1Q3MRJ7-F1-model_v4 SHSP domain-containing protein 0.7365 33 138
AF-A0A5Q3L9R6-F1-model_v4 Molecular chaperone (Small heat shock protein) 0.7311 33 140
AF-A0A7W4XFB8-F1-model_v4 deleted 0.7301 29 141

Feature Viewer

pLDDT pTM Quality
75.4 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map