F415750

General Info

Members Datasets Scaffolds Average Seq Length
343 168 686 220

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0119302|Ga0501038_0119302_79_816
Length 245
Sequence MTLDSEAASPPLTTIANPEEGFAMSDKRTTAKTFHETEGVDDWRVLFWGAYAHYRTRSFEEGAMLVAAIAEAAQEVDHFPDVDLRPEGVTVRTSSRRDGALFERDVELARRISAAAHLIGAEPDPSRLQSVGIAVAQDARADVRPFWAAALGYEDLGDEDAVDPLRRNPHLWFHELTPSKPSRGRVHIDVSVPADQAEARVAAAIAAGGRIADDSNAPEYWILASPENHGVDIAAWPDFEDDDLD

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
75 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
76 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
85 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
88 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2643221566 Microbacterium sp. Root166 Isolate Unclassified
159 2643221575 Microbacterium sp. Root61 Isolate Unclassified
160 2643221597 Microbacterium sp. Root180 Isolate Unclassified
161 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
162 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
163 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
164 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
165 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
166 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
167 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
168 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 7
Rhizosphere 88.63
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0119302 3300049574 Bacteria 2177
2 Ga0065715_10000054 3300005293 Bacteria 3115
3 Ga0070680_100388564 3300005336 Bacteria 1189
4 Ga0070661_100591601 3300005344 Bacteria 896
5 Ga0070692_10008734 3300005345 Bacteria 4531
6 Ga0070669_100779003 3300005353 Unclassified 812
7 Ga0070667_100613282 3300005367 Bacteria 1003
8 Ga0070694_100039981 3300005444 Bacteria 3124
9 Ga0070708_100077114 3300005445 Bacteria 3011
10 Ga0070708_100972006 3300005445 Bacteria 796
11 Ga0070681_10066883 3300005458 Bacteria 3562
12 Ga0070681_10271717 3300005458 Bacteria 1607
13 Ga0070706_100078310 3300005467 Bacteria 3061
14 Ga0070706_100449417 3300005467 Bacteria 1199
15 Ga0070707_100411521 3300005468 Bacteria 1313
16 Ga0070698_100070481 3300005471 Bacteria 3508
17 Ga0070699_100021572 3300005518 Bacteria 5555
18 Ga0070699_100188006 3300005518 Bacteria 1834
19 Ga0070684_100056295 3300005535 Bacteria 3431
20 Ga0070697_100030419 3300005536 Bacteria 4337
21 Ga0070695_100103220 3300005545 Bacteria 1923
22 Ga0070695_100142935 3300005545 Bacteria 1661
23 Ga0070696_100013865 3300005546 Bacteria 5411
24 Ga0070696_100035309 3300005546 Bacteria 3441
25 Ga0070696_100067911 3300005546 Bacteria 2502
26 Ga0070696_100076697 3300005546 Bacteria 2360
27 Ga0070696_100540114 3300005546 Bacteria 933
28 Ga0070693_100041968 3300005547 Bacteria 2576
29 Ga0070704_100043789 3300005549 Bacteria 3105
30 Ga0070704_100047808 3300005549 Bacteria 2992
31 Ga0070704_100102217 3300005549 Bacteria 2162
32 Ga0070664_100042378 3300005564 Bacteria 3843
33 Ga0068856_100580375 3300005614 Bacteria 1142
34 Ga0081539_10004594 3300005985 Bacteria 15073
35 Ga0075433_10027975 3300006852 Bacteria 4789
36 Ga0075433_10035735 3300006852 Bacteria 4276
37 Ga0075433_10185590 3300006852 Bacteria 1850
38 Ga0075433_10683230 3300006852 Bacteria 899
39 Ga0075434_100344713 3300006871 Bacteria 1511
40 Ga0111539_10962342 3300009094 Unclassified 993
41 Ga0105245_10411637 3300009098 Unclassified 1353
42 Ga0114129_10413181 3300009147 Bacteria 1776
43 Ga0114129_10938147 3300009147 Bacteria 1094
44 Ga0105243_10161774 3300009148 Bacteria 1931
45 Ga0105243_10355655 3300009148 Bacteria 1346
46 Ga0105243_10522843 3300009148 Bacteria 1129
47 Ga0105241_10816756 3300009174 Bacteria 860
48 Ga0105242_10134596 3300009176 Bacteria 2138
49 Ga0105242_10646724 3300009176 Unclassified 1028
50 Ga0105248_10260365 3300009177 Bacteria 1953
51 Ga0105249_10925416 3300009553 Unclassified 939
52 Ga0105249_10973865 3300009553 Bacteria 916
53 Ga0105246_10453059 3300011119 Unclassified 1079
54 Ga0171462_1005 3300013250 Bacteria 598379
55 Ga0157378_11446543 3300013297 Bacteria 731
56 Ga0163162_11533539 3300013306 Bacteria 759
57 Ga0157375_10087392 3300013308 Bacteria 3170
58 Ga0163163_10410929 3300014325 Bacteria 1412
59 Ga0157377_10374733 3300014745 Bacteria 962
60 Ga0157376_10483528 3300014969 Bacteria 1214
61 Ga0163161_10244129 3300017792 Bacteria 1398
62 Ga0207653_10000343 3300025885 Bacteria 23981
63 Ga0207680_10299915 3300025903 Bacteria 1120
64 Ga0207643_10183467 3300025908 Unclassified 1267
65 Ga0207684_10006286 3300025910 Bacteria 10836
66 Ga0207707_10032771 3300025912 Bacteria 4547
67 Ga0207707_10133870 3300025912 Bacteria 2168
68 Ga0207660_10243626 3300025917 Bacteria 1417
69 Ga0207662_10012754 3300025918 Bacteria 4687
70 Ga0207662_10124853 3300025918 Bacteria 1617
71 Ga0207652_10622762 3300025921 Bacteria 966
72 Ga0207646_10027188 3300025922 Bacteria 5217
73 Ga0207646_10321476 3300025922 Bacteria 1398
74 Ga0207686_10045401 3300025934 Bacteria 2703
75 Ga0207704_10177345 3300025938 Bacteria 1536
76 Ga0207689_10716254 3300025942 Bacteria 844
77 Ga0207679_10032093 3300025945 Bacteria 3683
78 Ga0207677_10170786 3300026023 Bacteria 1700
79 Ga0207703_10548500 3300026035 Unclassified 1090
80 Ga0207708_10274294 3300026075 Bacteria 1365
81 Ga0207641_10672840 3300026088 Bacteria 1018
82 Ga0207648_10229875 3300026089 Bacteria 1650
83 Ga0207676_10530420 3300026095 Bacteria 1122
84 Ga0207674_10694450 3300026116 Unclassified 982
85 Ga0207675_100446567 3300026118 Bacteria 1281
86 Ga0207675_101102746 3300026118 Bacteria 813
87 Ga0209996_1017294 3300027395 Bacteria 995
88 Ga0209966_1010852 3300027695 Bacteria 1652
89 Ga0268265_10609376 3300028380 Unclassified 1045
90 Ga0316579_10012717 3300031691 Bacteria 3607
91 Ga0316576_10023029 3300031727 Bacteria 4333
92 Ga0316578_10038755 3300031728 Unclassified 2750
93 Ga0316577_10005804 3300031733 Bacteria 6494
94 Ga0307406_10189000 3300031901 Bacteria 1506
95 Ga0307406_10214827 3300031901 Bacteria 1425
96 Ga0307409_100307082 3300031995 Bacteria 1479
97 Ga0307409_100354350 3300031995 Bacteria 1386
98 Ga0307416_100078158 3300032002 Bacteria 2783
99 Ga0307416_100982866 3300032002 Bacteria 947
100 Ga0316580_10002065 3300032139 Bacteria 5448
101 Ga0316574_0027075 3300035398 Unclassified 3452
102 Ga0316582_0010541 3300036647 Bacteria 5066
103 Ga0316584_0001358 3300036712 Bacteria 14545
104 Ga0395899_0121687 3300037312 Bacteria 1869
105 Ga0395900_0245173 3300037418 Bacteria 1795
106 Ga0395898_0019363 3300037466 Bacteria 6928
107 Ga0395905_0109067 3300037471 Bacteria 2599
108 Ga0395905_0659852 3300037471 Bacteria 948
109 Ga0395901_0197653 3300038443 Bacteria 2108
110 Ga0395901_1016788 3300038443 Bacteria 804
111 Ga0439465_0116639 3300041413 Bacteria 933
112 Ga0439465_0251644 3300041413 Unclassified 653
113 Ga0451835_0544683 3300041492 Bacteria 1053
114 Ga0451839_1414695 3300041496 Bacteria 1220
115 Ga0451853_2156870 3300041512 Unclassified 2167
116 Ga0451853_2635163 3300041512 Bacteria 1217
117 Ga0439441_051645 3300042001 Unclassified 848
118 Ga0439456_040665 3300042013 Bacteria 1007
119 Ga0450920_028343 3300042122 Unclassified 1097
120 Ga0439435_0129337 3300042436 Bacteria 797
121 Ga0495651_0279185 3300046462 Bacteria 1129
122 Ga0495664_0128250 3300046477 Bacteria 1535
123 Ga0495584_0335419 3300046491 Unclassified 768
124 Ga0495652_0002022 3300046529 Bacteria 21559
125 Ga0495652_0078808 3300046529 Bacteria 2726
126 Ga0495659_0089063 3300046664 Bacteria 1182
127 Ga0495623_0029398 3300046679 Bacteria 3536
128 Ga0495646_0052223 3300046680 Bacteria 2470
129 Ga0495600_0390362 3300046809 Bacteria 867
130 Ga0495581_0166549 3300047315 Unclassified 1289
131 Ga0495686_0217915 3300047472 Bacteria 1087
132 Ga0496100_0729453 3300048903 Bacteria 774
133 Ga0496101_0142831 3300048904 Bacteria 1826
134 Ga0496101_0230203 3300048904 Unclassified 1440
135 Ga0496102_0030703 3300048905 Bacteria 4811
136 Ga0496102_0210510 3300048905 Bacteria 1833
137 Ga0496102_0389523 3300048905 Unclassified 1311
138 Ga0496104_0014788 3300048907 Bacteria 7053
139 Ga0496104_0050510 3300048907 Bacteria 3923
140 Ga0496104_0216700 3300048907 Bacteria 1826
141 Ga0496105_0001337 3300048908 Bacteria 17264
142 Ga0496105_0053964 3300048908 Bacteria 3319
143 Ga0496105_0593506 3300048908 Bacteria 860
144 Ga0496106_0466064 3300048909 Bacteria 1015
145 Ga0496107_0116483 3300048910 Unclassified 1967
146 Ga0496107_0225032 3300048910 Bacteria 1396
147 Ga0496108_0059373 3300048911 Bacteria 3216
148 Ga0496108_0126249 3300048911 Unclassified 2196
149 Ga0496109_0007836 3300048912 Bacteria 9045
150 Ga0496109_0128581 3300048912 Bacteria 2363
151 Ga0496109_1178495 3300048912 Bacteria 703
152 Ga0496110_0032577 3300048913 Bacteria 4502
153 Ga0496111_0128201 3300048914 Unclassified 1876
154 Ga0496112_0419197 3300048915 Bacteria 1278
155 Ga0496113_0013086 3300048916 Bacteria 5603
156 Ga0496119_0001137 3300048922 Bacteria 33415
157 Ga0496119_0274726 3300048922 Unclassified 840
158 Ga0496126_0010052 3300048929 Bacteria 9985
159 Ga0501031_0004184 3300049568 Bacteria 9323
160 Ga0501031_0016010 3300049568 Bacteria 4869
161 Ga0501031_0031004 3300049568 Bacteria 3488
162 Ga0501031_0266137 3300049568 Bacteria 1114
163 Ga0501033_0245316 3300049570 Bacteria 1270
164 Ga0501033_0273686 3300049570 Bacteria 1193
165 Ga0501034_0638438 3300049571 Bacteria 967
166 Ga0501036_0010473 3300049572 Bacteria 7660
167 Ga0501036_0012793 3300049572 Bacteria 6962
168 Ga0501036_0271866 3300049572 Unclassified 1419
169 Ga0501037_0181734 3300049573 Bacteria 1492
170 Ga0501038_0101978 3300049574 Bacteria 2389
171 Ga0501038_0134300 3300049574 Bacteria 2028
172 Ga0501038_0455018 3300049574 Bacteria 984
173 Ga0501039_0061927 3300049575 Bacteria 2898
174 Ga0501039_0169948 3300049575 Bacteria 1714
175 Ga0501039_0234293 3300049575 Bacteria 1443
176 Ga0501039_0374108 3300049575 Bacteria 1119
177 Ga0501040_0019965 3300049576 Bacteria 4461
178 Ga0501040_0024422 3300049576 Bacteria 4057
179 Ga0501040_0030944 3300049576 Bacteria 3617
180 Ga0501040_0036449 3300049576 Bacteria 3338
181 Ga0501040_0067916 3300049576 Bacteria 2457
182 Ga0501040_0113526 3300049576 Bacteria 1896
183 Ga0501040_0566494 3300049576 Unclassified 820
184 Ga0501041_0009674 3300049577 Bacteria 5681
185 Ga0501041_0011396 3300049577 Bacteria 5254
186 Ga0501041_0012118 3300049577 Bacteria 5105
187 Ga0501041_0111948 3300049577 Unclassified 1693
188 Ga0501041_0112732 3300049577 Bacteria 1687
189 Ga0501042_0001712 3300049578 Bacteria 13111
190 Ga0501042_0008942 3300049578 Bacteria 6646
191 Ga0501042_0026439 3300049578 Bacteria 4078
192 Ga0501042_0036481 3300049578 Bacteria 3488
193 Ga0501042_0152774 3300049578 Bacteria 1665
194 Ga0501042_0186503 3300049578 Bacteria 1496
195 Ga0501043_0110767 3300049579 Bacteria 2155
196 Ga0501046_0009205 3300049580 Bacteria 8551
197 Ga0501046_0074458 3300049580 Bacteria 2634
198 Ga0501046_0194444 3300049580 Bacteria 1512
199 Ga0501046_0334179 3300049580 Bacteria 1102
200 Ga0501048_0001237 3300049582 Bacteria 19359
201 Ga0501048_0011910 3300049582 Bacteria 6485
202 Ga0501048_0021970 3300049582 Bacteria 4670
203 Ga0501068_0015638 3300049584 Bacteria 4361
204 Ga0501068_0215012 3300049584 Bacteria 1221
205 Ga0501068_0315667 3300049584 Bacteria 1001
206 Ga0501069_0220198 3300049585 Bacteria 1103
207 Ga0501070_0001942 3300049586 Bacteria 18251
208 Ga0501070_0012926 3300049586 Bacteria 7036
209 Ga0501070_0019037 3300049586 Bacteria 5758
210 Ga0501070_0084197 3300049586 Bacteria 2633
211 Ga0501070_0462043 3300049586 Bacteria 1023
212 Ga0501071_0005170 3300049587 Bacteria 8359
213 Ga0501071_0018971 3300049587 Bacteria 4771
214 Ga0501071_0024933 3300049587 Bacteria 4185
215 Ga0501071_0098888 3300049587 Bacteria 2149
216 Ga0501071_0119092 3300049587 Bacteria 1956
217 Ga0501071_0127614 3300049587 Bacteria 1888
218 Ga0501071_0268261 3300049587 Bacteria 1290
219 Ga0501071_0396583 3300049587 Bacteria 1053
220 Ga0501071_0821179 3300049587 Bacteria 717
221 Ga0501072_0002951 3300049588 Bacteria 12805
222 Ga0501072_0012266 3300049588 Bacteria 6548
223 Ga0501072_0018337 3300049588 Bacteria 5387
224 Ga0501072_0041997 3300049588 Bacteria 3592
225 Ga0501072_0106378 3300049588 Bacteria 2231
226 Ga0501072_0132568 3300049588 Bacteria 1986
227 Ga0501072_0267149 3300049588 Bacteria 1361
228 Ga0501073_0083899 3300049589 Bacteria 2217
229 Ga0501073_0206510 3300049589 Bacteria 1358
230 Ga0501074_0001381 3300049590 Bacteria 16103
231 Ga0501074_0013120 3300049590 Bacteria 6023
232 Ga0501074_0016997 3300049590 Bacteria 5277
233 Ga0501074_0020493 3300049590 Bacteria 4805
234 Ga0501074_0043353 3300049590 Bacteria 3256
235 Ga0501074_0050647 3300049590 Bacteria 2998
236 Ga0501075_0018697 3300049591 Bacteria 5018
237 Ga0501075_0024078 3300049591 Bacteria 4458
238 Ga0501075_0044539 3300049591 Bacteria 3329
239 Ga0501075_0046775 3300049591 Bacteria 3250
240 Ga0501075_0103351 3300049591 Bacteria 2165
241 Ga0501075_0106267 3300049591 Bacteria 2133
242 Ga0501075_0348683 3300049591 Bacteria 1128
243 Ga0501075_0380292 3300049591 Bacteria 1076
244 Ga0501076_0004311 3300049592 Bacteria 10094
245 Ga0501076_0007677 3300049592 Bacteria 7853
246 Ga0501076_0008089 3300049592 Bacteria 7687
247 Ga0501076_0008476 3300049592 Bacteria 7532
248 Ga0501076_0020071 3300049592 Bacteria 5112
249 Ga0501076_0107289 3300049592 Bacteria 2255
250 Ga0501076_0279793 3300049592 Bacteria 1367
251 Ga0501076_0428128 3300049592 Bacteria 1089
252 Ga0501077_0007348 3300049593 Bacteria 6792
253 Ga0501077_0026381 3300049593 Bacteria 3687
254 Ga0501077_0068036 3300049593 Unclassified 2258
255 Ga0501077_0074894 3300049593 Bacteria 2144
256 Ga0501077_0106654 3300049593 Bacteria 1775
257 Ga0501077_0482898 3300049593 Unclassified 794
258 Ga0501079_0002432 3300049741 Bacteria 13525
259 Ga0501079_0006777 3300049741 Bacteria 8618
260 Ga0501079_0030245 3300049741 Bacteria 4161
261 Ga0501079_0033129 3300049741 Bacteria 3973
262 Ga0501079_0034513 3300049741 Bacteria 3892
263 Ga0501079_0055426 3300049741 Bacteria 3059
264 Ga0501079_0069183 3300049741 Bacteria 2725
265 Ga0501079_0276513 3300049741 Bacteria 1313
266 Ga0501079_0431076 3300049741 Bacteria 1035
267 Ga0501080_0008138 3300049742 Bacteria 9500
268 Ga0501080_0021370 3300049742 Bacteria 5991
269 Ga0501080_0049332 3300049742 Bacteria 3918
270 Ga0501080_0318885 3300049742 Bacteria 1407
271 Ga0501080_0767582 3300049742 Unclassified 847
272 Ga0501081_0002532 3300049743 Bacteria 11520
273 Ga0501081_0006201 3300049743 Bacteria 7746
274 Ga0501081_0050163 3300049743 Bacteria 2875
275 Ga0501081_0105576 3300049743 Bacteria 1995
276 Ga0501083_0040410 3300049744 Bacteria 3166
277 Ga0501083_0058580 3300049744 Bacteria 2577
278 Ga0501083_0066600 3300049744 Bacteria 2398
279 Ga0501035_0003727 3300049822 Bacteria 14534
280 Ga0501035_0049938 3300049822 Bacteria 3750
281 Ga0501035_0098488 3300049822 Bacteria 2567
282 Ga0501035_0305395 3300049822 Bacteria 1340
283 Ga0501035_0547753 3300049822 Bacteria 948
284 Ga0501035_0818066 3300049822 Unclassified 743
285 Ga0501044_0177152 3300049823 Bacteria 2101
286 Ga0501044_0202624 3300049823 Bacteria 1942
287 Ga0501045_0003562 3300049824 Bacteria 10695
288 Ga0501045_0004340 3300049824 Bacteria 9773
289 Ga0501045_0028345 3300049824 Bacteria 4039
290 Ga0501045_0048209 3300049824 Bacteria 3105
291 Ga0501045_0554278 3300049824 Unclassified 852
292 nmdc:mga05p37_299682_c1 3300050507 Bacteria 1910
293 nmdc:mga05p37_35164_c1 3300050507 Bacteria 6142
294 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
295 nmdc:mga08y16_243406_c1 3300050511 Unclassified 1859
296 nmdc:mga0n895_318834_c1 3300050512 Bacteria 1575
297 nmdc:mga0rr50_137368_c1 3300050513 Bacteria 1963
298 nmdc:mga0rr50_553117_c1 3300050513 Unclassified 980
299 nmdc:mga0a205_178916_c1 3300050515 Bacteria 2015
300 nmdc:mga0a205_4937_c1 3300050515 Bacteria 12000
301 nmdc:mga0a205_644575_c1 3300050515 Bacteria 911
302 nmdc:mga0a205_8792_c2 3300050515 Bacteria 5054
303 Ga0495601_0004195 3300053077 Bacteria 8309
304 Ga0495601_0014512 3300053077 Bacteria 4748
305 Ga0495601_0119268 3300053077 Bacteria 1712
306 Ga0495612_0069627 3300053078 Bacteria 1465
307 Ga0495619_0234685 3300053085 Bacteria 1271
308 Ga0500577_0002287 3300053142 Bacteria 4883
309 Ga0500616_0000089 3300053153 Bacteria 191075
310 Ga0501084_0004494 3300054114 Bacteria 11396
311 Ga0501084_0007563 3300054114 Bacteria 8956
312 Ga0501084_0019800 3300054114 Bacteria 5609
313 Ga0501084_0022127 3300054114 Bacteria 5303
314 Ga0501084_0087266 3300054114 Bacteria 2619
315 Ga0501084_0138514 3300054114 Bacteria 2048
316 Ga0501084_0252644 3300054114 Bacteria 1488
317 Ga0501082_0012823 3300060353 Bacteria 7204
318 Ga0501082_0014314 3300060353 Bacteria 6826
319 Ga0501082_0082915 3300060353 Bacteria 2766
320 Ga0501082_0250916 3300060353 Bacteria 1540
321 Ga0501082_0415044 3300060353 Bacteria 1175
322 Ga0530510_0002096 3300061734 Bacteria 13699
323 Ga0530510_0008879 3300061734 Bacteria 7035
324 Ga0530510_0009277 3300061734 Bacteria 6903
325 Ga0530510_0009917 3300061734 Bacteria 6683
326 Ga0530510_0012719 3300061734 Bacteria 5916
327 Ga0530510_0020869 3300061734 Bacteria 4659
328 Ga0530510_0045871 3300061734 Unclassified 3157
329 Ga0530510_0082922 3300061734 Bacteria 2335
330 Ga0530510_0163988 3300061734 Bacteria 1644
331 Ga0530510_0295280 3300061734 Bacteria 1212
332 2643846698 2643221566 Bacteria 3460379
333 2643847008 2643221566 Bacteria 3460379
334 2643886226 2643221575 Bacteria 4022601
335 2643994660 2643221597 Bacteria 3347721
336 2723643734 2721755702 Bacteria 4373124
337 2774400383 2773857763 Bacteria 4180068
338 2833711995 2833709550 Bacteria 4008291
339 2852635221 2852632344 Bacteria 3463163
340 2857734721 2857733635 Bacteria 3532004
341 2862996099 2862993130 Bacteria 3860849
342 2919446720 2919443155 Bacteria 4072969
343 2964326967 2964326757 Bacteria 3290868
344 Ga0501038_0119302
345 Ga0065715_10000054
346 Ga0070680_100388564
347 Ga0070661_100591601
348 Ga0070692_10008734
349 Ga0070669_100779003
350 Ga0070667_100613282
351 Ga0070694_100039981
352 Ga0070708_100077114
353 Ga0070708_100972006
354 Ga0070681_10066883
355 Ga0070681_10271717
356 Ga0070706_100078310
357 Ga0070706_100449417
358 Ga0070707_100411521
359 Ga0070698_100070481
360 Ga0070699_100021572
361 Ga0070699_100188006
362 Ga0070684_100056295
363 Ga0070697_100030419
364 Ga0070695_100103220
365 Ga0070695_100142935
366 Ga0070696_100013865
367 Ga0070696_100035309
368 Ga0070696_100067911
369 Ga0070696_100076697
370 Ga0070696_100540114
371 Ga0070693_100041968
372 Ga0070704_100043789
373 Ga0070704_100047808
374 Ga0070704_100102217
375 Ga0070664_100042378
376 Ga0068856_100580375
377 Ga0081539_10004594
378 Ga0075433_10027975
379 Ga0075433_10035735
380 Ga0075433_10185590
381 Ga0075433_10683230
382 Ga0075434_100344713
383 Ga0111539_10962342
384 Ga0105245_10411637
385 Ga0114129_10413181
386 Ga0114129_10938147
387 Ga0105243_10161774
388 Ga0105243_10355655
389 Ga0105243_10522843
390 Ga0105241_10816756
391 Ga0105242_10134596
392 Ga0105242_10646724
393 Ga0105248_10260365
394 Ga0105249_10925416
395 Ga0105249_10973865
396 Ga0105246_10453059
397 Ga0171462_1005
398 Ga0157378_11446543
399 Ga0163162_11533539
400 Ga0157375_10087392
401 Ga0163163_10410929
402 Ga0157377_10374733
403 Ga0157376_10483528
404 Ga0163161_10244129
405 Ga0207653_10000343
406 Ga0207680_10299915
407 Ga0207643_10183467
408 Ga0207684_10006286
409 Ga0207707_10032771
410 Ga0207707_10133870
411 Ga0207660_10243626
412 Ga0207662_10012754
413 Ga0207662_10124853
414 Ga0207652_10622762
415 Ga0207646_10027188
416 Ga0207646_10321476
417 Ga0207686_10045401
418 Ga0207704_10177345
419 Ga0207689_10716254
420 Ga0207679_10032093
421 Ga0207677_10170786
422 Ga0207703_10548500
423 Ga0207708_10274294
424 Ga0207641_10672840
425 Ga0207648_10229875
426 Ga0207676_10530420
427 Ga0207674_10694450
428 Ga0207675_100446567
429 Ga0207675_101102746
430 Ga0209996_1017294
431 Ga0209966_1010852
432 Ga0268265_10609376
433 Ga0316579_10012717
434 Ga0316576_10023029
435 Ga0316578_10038755
436 Ga0316577_10005804
437 Ga0307406_10189000
438 Ga0307406_10214827
439 Ga0307409_100307082
440 Ga0307409_100354350
441 Ga0307416_100078158
442 Ga0307416_100982866
443 Ga0316580_10002065
444 Ga0316574_0027075
445 Ga0316582_0010541
446 Ga0316584_0001358
447 Ga0395899_0121687
448 Ga0395900_0245173
449 Ga0395898_0019363
450 Ga0395905_0109067
451 Ga0395905_0659852
452 Ga0395901_0197653
453 Ga0395901_1016788
454 Ga0439465_0116639
455 Ga0439465_0251644
456 Ga0451835_0544683
457 Ga0451839_1414695
458 Ga0451853_2156870
459 Ga0451853_2635163
460 Ga0439441_051645
461 Ga0439456_040665
462 Ga0450920_028343
463 Ga0439435_0129337
464 Ga0495651_0279185
465 Ga0495664_0128250
466 Ga0495584_0335419
467 Ga0495652_0002022
468 Ga0495652_0078808
469 Ga0495659_0089063
470 Ga0495623_0029398
471 Ga0495646_0052223
472 Ga0495600_0390362
473 Ga0495581_0166549
474 Ga0495686_0217915
475 Ga0496100_0729453
476 Ga0496101_0142831
477 Ga0496101_0230203
478 Ga0496102_0030703
479 Ga0496102_0210510
480 Ga0496102_0389523
481 Ga0496104_0014788
482 Ga0496104_0050510
483 Ga0496104_0216700
484 Ga0496105_0001337
485 Ga0496105_0053964
486 Ga0496105_0593506
487 Ga0496106_0466064
488 Ga0496107_0116483
489 Ga0496107_0225032
490 Ga0496108_0059373
491 Ga0496108_0126249
492 Ga0496109_0007836
493 Ga0496109_0128581
494 Ga0496109_1178495
495 Ga0496110_0032577
496 Ga0496111_0128201
497 Ga0496112_0419197
498 Ga0496113_0013086
499 Ga0496119_0001137
500 Ga0496119_0274726
501 Ga0496126_0010052
502 Ga0501031_0004184
503 Ga0501031_0016010
504 Ga0501031_0031004
505 Ga0501031_0266137
506 Ga0501033_0245316
507 Ga0501033_0273686
508 Ga0501034_0638438
509 Ga0501036_0010473
510 Ga0501036_0012793
511 Ga0501036_0271866
512 Ga0501037_0181734
513 Ga0501038_0101978
514 Ga0501038_0134300
515 Ga0501038_0455018
516 Ga0501039_0061927
517 Ga0501039_0169948
518 Ga0501039_0234293
519 Ga0501039_0374108
520 Ga0501040_0019965
521 Ga0501040_0024422
522 Ga0501040_0030944
523 Ga0501040_0036449
524 Ga0501040_0067916
525 Ga0501040_0113526
526 Ga0501040_0566494
527 Ga0501041_0009674
528 Ga0501041_0011396
529 Ga0501041_0012118
530 Ga0501041_0111948
531 Ga0501041_0112732
532 Ga0501042_0001712
533 Ga0501042_0008942
534 Ga0501042_0026439
535 Ga0501042_0036481
536 Ga0501042_0152774
537 Ga0501042_0186503
538 Ga0501043_0110767
539 Ga0501046_0009205
540 Ga0501046_0074458
541 Ga0501046_0194444
542 Ga0501046_0334179
543 Ga0501048_0001237
544 Ga0501048_0011910
545 Ga0501048_0021970
546 Ga0501068_0015638
547 Ga0501068_0215012
548 Ga0501068_0315667
549 Ga0501069_0220198
550 Ga0501070_0001942
551 Ga0501070_0012926
552 Ga0501070_0019037
553 Ga0501070_0084197
554 Ga0501070_0462043
555 Ga0501071_0005170
556 Ga0501071_0018971
557 Ga0501071_0024933
558 Ga0501071_0098888
559 Ga0501071_0119092
560 Ga0501071_0127614
561 Ga0501071_0268261
562 Ga0501071_0396583
563 Ga0501071_0821179
564 Ga0501072_0002951
565 Ga0501072_0012266
566 Ga0501072_0018337
567 Ga0501072_0041997
568 Ga0501072_0106378
569 Ga0501072_0132568
570 Ga0501072_0267149
571 Ga0501073_0083899
572 Ga0501073_0206510
573 Ga0501074_0001381
574 Ga0501074_0013120
575 Ga0501074_0016997
576 Ga0501074_0020493
577 Ga0501074_0043353
578 Ga0501074_0050647
579 Ga0501075_0018697
580 Ga0501075_0024078
581 Ga0501075_0044539
582 Ga0501075_0046775
583 Ga0501075_0103351
584 Ga0501075_0106267
585 Ga0501075_0348683
586 Ga0501075_0380292
587 Ga0501076_0004311
588 Ga0501076_0007677
589 Ga0501076_0008089
590 Ga0501076_0008476
591 Ga0501076_0020071
592 Ga0501076_0107289
593 Ga0501076_0279793
594 Ga0501076_0428128
595 Ga0501077_0007348
596 Ga0501077_0026381
597 Ga0501077_0068036
598 Ga0501077_0074894
599 Ga0501077_0106654
600 Ga0501077_0482898
601 Ga0501079_0002432
602 Ga0501079_0006777
603 Ga0501079_0030245
604 Ga0501079_0033129
605 Ga0501079_0034513
606 Ga0501079_0055426
607 Ga0501079_0069183
608 Ga0501079_0276513
609 Ga0501079_0431076
610 Ga0501080_0008138
611 Ga0501080_0021370
612 Ga0501080_0049332
613 Ga0501080_0318885
614 Ga0501080_0767582
615 Ga0501081_0002532
616 Ga0501081_0006201
617 Ga0501081_0050163
618 Ga0501081_0105576
619 Ga0501083_0040410
620 Ga0501083_0058580
621 Ga0501083_0066600
622 Ga0501035_0003727
623 Ga0501035_0049938
624 Ga0501035_0098488
625 Ga0501035_0305395
626 Ga0501035_0547753
627 Ga0501035_0818066
628 Ga0501044_0177152
629 Ga0501044_0202624
630 Ga0501045_0003562
631 Ga0501045_0004340
632 Ga0501045_0028345
633 Ga0501045_0048209
634 Ga0501045_0554278
635 nmdc:mga05p37_299682_c1
636 nmdc:mga05p37_35164_c1
637 nmdc:mga05p37_7_c1
638 nmdc:mga08y16_243406_c1
639 nmdc:mga0n895_318834_c1
640 nmdc:mga0rr50_137368_c1
641 nmdc:mga0rr50_553117_c1
642 nmdc:mga0a205_178916_c1
643 nmdc:mga0a205_4937_c1
644 nmdc:mga0a205_644575_c1
645 nmdc:mga0a205_8792_c2
646 Ga0495601_0004195
647 Ga0495601_0014512
648 Ga0495601_0119268
649 Ga0495612_0069627
650 Ga0495619_0234685
651 Ga0500577_0002287
652 Ga0500616_0000089
653 Ga0501084_0004494
654 Ga0501084_0007563
655 Ga0501084_0019800
656 Ga0501084_0022127
657 Ga0501084_0087266
658 Ga0501084_0138514
659 Ga0501084_0252644
660 Ga0501082_0012823
661 Ga0501082_0014314
662 Ga0501082_0082915
663 Ga0501082_0250916
664 Ga0501082_0415044
665 Ga0530510_0002096
666 Ga0530510_0008879
667 Ga0530510_0009277
668 Ga0530510_0009917
669 Ga0530510_0012719
670 Ga0530510_0020869
671 Ga0530510_0045871
672 Ga0530510_0082922
673 Ga0530510_0163988
674 Ga0530510_0295280
675 2643846698
676 2643847008
677 2643886226
678 2643994660
679 2723643734
680 2774400383
681 2833711995
682 2852635221
683 2857734721
684 2862996099
685 2919446720
686 2964326967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

24

115

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

130

234

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.8075 17 89
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.8044 19 87
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.8019 20 88
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.7917 20 88
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.7913 20 88
ID Description Score Start End Superfamily
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8493 20 87 3.30.1360.20
1usoB00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8428 27 84 3.30.1360.20
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8346 160 206 3.30.720.110
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.8169 27 85 3.30.1360.20
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8162 167 207 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A1F8TIC5-F1-model_v4 Glyoxalase-like domain-containing protein 0.9818 160 206
AF-A0A2W5XN71-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9408 1 94 GO:0006729
GO:0008124
AF-A0A852YF32-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9313 3 212 GO:0006729
GO:0008124
AF-A0A852Y9S9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9297 4 211 GO:0016829
AF-A0A5B1M5C2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9242 3 98 GO:0006729
GO:0008124

Map