F415693

General Info

Members Datasets Scaffolds Average Seq Length
343 208 686 173

Family's Representative Sequence

Representative Sequence 3300042156|Ga0439446_0070036|Ga0439446_0070036_30_548
Length 172
Sequence VPITRLNHAVLYVRDIERSVAFYRDVLGFRLLDVLPEGFRGAAFLQAPGSTNDHDLGLFEVGTTAAASPAGRGGSVGLYHLAWEVDTLAELERLAGRLLEAGALGGASDHGTTKSLYGHDPDGIEFEIAWIVPAALIDPAAIEGRKRIGRLDLDAELARYGAETSGGVGISH

Samples

Sample ID Description Type Environment
1 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
141 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
203 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
204 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
205 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
206 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
207 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
208 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 8.16
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 3.79
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439446_0070036 3300042156 Bacteria 1072
2 JGI24033J26618_1037200 3300002155 Bacteria 670
3 JGI25407J50210_10083971 3300003373 Bacteria 790
4 Ga0070658_10272891 3300005327 Bacteria 1438
5 Ga0070683_100205140 3300005329 Bacteria 1872
6 Ga0070683_100287731 3300005329 Bacteria 1563
7 Ga0068869_101032990 3300005334 Bacteria 717
8 Ga0070680_100090781 3300005336 Bacteria 2529
9 Ga0070682_100296158 3300005337 Bacteria 1185
10 Ga0070660_100209527 3300005339 Bacteria 1582
11 Ga0070692_10149077 3300005345 Bacteria 1331
12 Ga0070675_100119036 3300005354 Bacteria 2243
13 Ga0070674_100030832 3300005356 Bacteria 3547
14 Ga0070688_100324765 3300005365 Bacteria 1119
15 Ga0070659_100045161 3300005366 Bacteria 3450
16 Ga0070659_100151971 3300005366 Bacteria 1889
17 Ga0070667_100714204 3300005367 Bacteria 928
18 Ga0070713_100378530 3300005436 Bacteria 1318
19 Ga0070701_10059492 3300005438 Bacteria 2009
20 Ga0070705_100384377 3300005440 Bacteria 1034
21 Ga0070700_100175594 3300005441 Bacteria 1486
22 Ga0070694_100054036 3300005444 Bacteria 2720
23 Ga0070663_100425948 3300005455 Bacteria 1089
24 Ga0070663_101029300 3300005455 Bacteria 717
25 Ga0070678_100878044 3300005456 Bacteria 818
26 Ga0070662_100149200 3300005457 Bacteria 1818
27 Ga0068867_100011531 3300005459 Bacteria 6239
28 Ga0070679_100077123 3300005530 Bacteria 3321
29 Ga0070679_101053233 3300005530 Bacteria 758
30 Ga0070684_100106929 3300005535 Bacteria 2505
31 Ga0070684_100433140 3300005535 Bacteria 1214
32 Ga0070684_100709549 3300005535 Bacteria 938
33 Ga0068853_100087643 3300005539 Bacteria 2732
34 Ga0070672_100632158 3300005543 Bacteria 934
35 Ga0070686_100001029 3300005544 Bacteria 16041
36 Ga0070704_100037293 3300005549 Bacteria 3320
37 Ga0068855_100006757 3300005563 Bacteria 13914
38 Ga0070664_100193497 3300005564 Bacteria 1813
39 Ga0068854_100180545 3300005578 Bacteria 1648
40 Ga0070702_100111659 3300005615 Bacteria 1696
41 Ga0068852_100105424 3300005616 Bacteria 2554
42 Ga0068859_101093145 3300005617 Bacteria 877
43 Ga0068864_101664076 3300005618 Bacteria 643
44 Ga0068861_100099450 3300005719 Bacteria 2311
45 Ga0068861_100527506 3300005719 Bacteria 1072
46 Ga0068863_100686239 3300005841 Bacteria 1017
47 Ga0068858_100091274 3300005842 Bacteria 2835
48 Ga0068860_100242611 3300005843 Bacteria 1753
49 Ga0068860_100556317 3300005843 Bacteria 1150
50 Ga0068862_101031259 3300005844 Bacteria 815
51 Ga0081455_10003739 3300005937 Bacteria 17390
52 Ga0081455_10012295 3300005937 Bacteria 8542
53 Ga0081455_10042245 3300005937 Bacteria 4002
54 Ga0081455_10214175 3300005937 Bacteria 1433
55 Ga0081538_10000192 3300005981 Bacteria 67045
56 Ga0081538_10007801 3300005981 Bacteria 9192
57 Ga0081540_1032693 3300005983 Bacteria 2836
58 Ga0081540_1221647 3300005983 Bacteria 673
59 Ga0081539_10000662 3300005985 Bacteria 69140
60 Ga0081539_10014916 3300005985 Bacteria 5702
61 Ga0075363_100046948 3300006048 Bacteria 2293
62 Ga0075432_10000337 3300006058 Bacteria 13379
63 Ga0097621_100036537 3300006237 Bacteria 3930
64 Ga0075428_100000074 3300006844 Bacteria 82188
65 Ga0075428_100001119 3300006844 Bacteria 28604
66 Ga0075428_100012920 3300006844 Bacteria 9288
67 Ga0075428_100024855 3300006844 Bacteria 6627
68 Ga0075428_100096523 3300006844 Bacteria 3222
69 Ga0075428_100297117 3300006844 Bacteria 1737
70 Ga0075428_100305935 3300006844 Bacteria 1709
71 Ga0075430_100002877 3300006846 Bacteria 14409
72 Ga0075430_100004118 3300006846 Bacteria 12271
73 Ga0075431_100003975 3300006847 Bacteria 14409
74 Ga0075431_100009944 3300006847 Bacteria 9555
75 Ga0075431_100129052 3300006847 Bacteria 2609
76 Ga0075433_10002770 3300006852 Bacteria 13410
77 Ga0075433_10113424 3300006852 Bacteria 2404
78 Ga0075434_100000897 3300006871 Bacteria 23872
79 Ga0075434_100206775 3300006871 Bacteria 1983
80 Ga0075429_100000048 3300006880 Bacteria 56393
81 Ga0075429_100007657 3300006880 Bacteria 9376
82 Ga0075429_100121151 3300006880 Bacteria 2287
83 Ga0075429_100581701 3300006880 Bacteria 981
84 Ga0075436_100015043 3300006914 Bacteria 5303
85 Ga0097620_101093057 3300006931 Bacteria 877
86 Ga0075435_100006646 3300007076 Bacteria 8195
87 Ga0075435_100095323 3300007076 Bacteria 2461
88 Ga0111539_10003170 3300009094 Bacteria 21766
89 Ga0105245_10021498 3300009098 Bacteria 5661
90 Ga0105245_10028363 3300009098 Bacteria 4938
91 Ga0105245_10395554 3300009098 Bacteria 1380
92 Ga0114129_10002321 3300009147 Bacteria 26414
93 Ga0114129_10003209 3300009147 Bacteria 22944
94 Ga0114129_10729906 3300009147 Bacteria 1270
95 Ga0105243_10273363 3300009148 Bacteria 1518
96 Ga0105242_10102180 3300009176 Bacteria 2431
97 Ga0105242_10593167 3300009176 Bacteria 1069
98 Ga0105242_11592841 3300009176 Bacteria 686
99 Ga0105248_10033464 3300009177 Bacteria 5742
100 Ga0105248_10061610 3300009177 Bacteria 4213
101 Ga0105249_10448024 3300009553 Bacteria 1329
102 Ga0105249_10530906 3300009553 Bacteria 1225
103 Ga0105239_10094140 3300010375 Bacteria 3308
104 Ga0105246_10038225 3300011119 Bacteria 3225
105 Ga0157344_1007665 3300012476 Bacteria 725
106 Ga0157370_10214922 3300013104 Bacteria 1781
107 Ga0157369_10012484 3300013105 Bacteria 9638
108 Ga0157374_10046562 3300013296 Bacteria 4017
109 Ga0157378_10001199 3300013297 Bacteria 23518
110 Ga0157378_11568850 3300013297 Bacteria 704
111 Ga0163162_10419471 3300013306 Bacteria 1470
112 Ga0163162_10726704 3300013306 Bacteria 1113
113 Ga0157372_10368094 3300013307 Bacteria 1675
114 Ga0157372_10668336 3300013307 Bacteria 1209
115 Ga0157375_10001763 3300013308 Bacteria 18566
116 Ga0157375_11851694 3300013308 Bacteria 716
117 Ga0157377_10004740 3300014745 Bacteria 6298
118 Ga0157377_10076328 3300014745 Bacteria 1949
119 Ga0157379_10024661 3300014968 Bacteria 5338
120 Ga0163161_10199042 3300017792 Bacteria 1543
121 Ga0197907_11015224 3300020069 Bacteria 905
122 Ga0197907_11016203 3300020069 Bacteria 878
123 Ga0197907_11226266 3300020069 Bacteria 948
124 Ga0206356_11524221 3300020070 Bacteria 1164
125 Ga0206356_11593343 3300020070 Bacteria 1122
126 Ga0206349_1063901 3300020075 Bacteria 988
127 Ga0206349_1487846 3300020075 Bacteria 623
128 Ga0206355_1334045 3300020076 Bacteria 850
129 Ga0206351_10508886 3300020077 Bacteria 1060
130 Ga0206352_10738300 3300020078 Bacteria 973
131 Ga0206352_10949719 3300020078 Bacteria 1215
132 Ga0206350_10018177 3300020080 Bacteria 943
133 Ga0206350_10344064 3300020080 Bacteria 875
134 Ga0206350_10697522 3300020080 Bacteria 1123
135 Ga0206350_11503242 3300020080 Bacteria 1386
136 Ga0206353_10598329 3300020082 Bacteria 1564
137 Ga0154015_1690038 3300020610 Bacteria 766
138 Ga0224712_10073026 3300022467 Bacteria 1398
139 Ga0224712_10128999 3300022467 Bacteria 1103
140 Ga0224712_10497847 3300022467 Bacteria 589
141 Ga0207705_10119787 3300025909 Bacteria 1952
142 Ga0207705_10130445 3300025909 Bacteria 1870
143 Ga0207705_10401285 3300025909 Bacteria 1060
144 Ga0207707_10235034 3300025912 Bacteria 1594
145 Ga0207660_10109300 3300025917 Bacteria 2078
146 Ga0207657_10108050 3300025919 Bacteria 2300
147 Ga0207657_10167210 3300025919 Bacteria 1783
148 Ga0207649_10197991 3300025920 Bacteria 1417
149 Ga0207652_10084343 3300025921 Bacteria 2783
150 Ga0207681_10397061 3300025923 Bacteria 1113
151 Ga0207659_10060980 3300025926 Bacteria 2717
152 Ga0207687_10011871 3300025927 Bacteria 5699
153 Ga0207687_10030505 3300025927 Bacteria 3636
154 Ga0207687_10041562 3300025927 Bacteria 3158
155 Ga0207664_10241425 3300025929 Bacteria 1573
156 Ga0207690_10128945 3300025932 Bacteria 1848
157 Ga0207706_10073107 3300025933 Bacteria 3015
158 Ga0207669_10546917 3300025937 Bacteria 934
159 Ga0207704_10016810 3300025938 Bacteria 3771
160 Ga0207665_10822907 3300025939 Bacteria 734
161 Ga0207691_10807974 3300025940 Bacteria 788
162 Ga0207711_10003875 3300025941 Bacteria 12871
163 Ga0207689_10031938 3300025942 Bacteria 4379
164 Ga0207689_10048033 3300025942 Bacteria 3521
165 Ga0207661_10010209 3300025944 Bacteria 6751
166 Ga0207661_10508073 3300025944 Bacteria 1101
167 Ga0207679_10188744 3300025945 Bacteria 1711
168 Ga0207667_10390916 3300025949 Bacteria 1416
169 Ga0207667_11443235 3300025949 Bacteria 661
170 Ga0207668_10237131 3300025972 Bacteria 1474
171 Ga0207640_10049171 3300025981 Bacteria 2729
172 Ga0207640_10649906 3300025981 Bacteria 898
173 Ga0207678_10234404 3300026067 Bacteria 1572
174 Ga0207708_10003322 3300026075 Bacteria 11843
175 Ga0207702_10990910 3300026078 Bacteria 834
176 Ga0207648_10007961 3300026089 Bacteria 10336
177 Ga0207676_11606129 3300026095 Bacteria 648
178 Ga0207674_10172787 3300026116 Bacteria 2114
179 Ga0207675_100128545 3300026118 Bacteria 2401
180 Ga0207683_10016368 3300026121 Bacteria 6311
181 Ga0207698_10050713 3300026142 Bacteria 3168
182 Ga0207698_10294560 3300026142 Bacteria 1508
183 Ga0207428_10001549 3300027907 Bacteria 24010
184 Ga0207428_10080935 3300027907 Bacteria 2537
185 Ga0268264_10402802 3300028381 Bacteria 1315
186 Ga0307408_100520606 3300031548 Unclassified 1044
187 Ga0307405_10003371 3300031731 Bacteria 7324
188 Ga0307405_10502390 3300031731 Bacteria 972
189 Ga0307405_11321689 3300031731 Bacteria 628
190 Ga0307413_10001845 3300031824 Bacteria 8340
191 Ga0307413_10181581 3300031824 Bacteria 1501
192 Ga0307413_10240436 3300031824 Bacteria 1336
193 Ga0307413_10263649 3300031824 Bacteria 1286
194 Ga0307413_10467063 3300031824 Bacteria 1005
195 Ga0307410_10002464 3300031852 Bacteria 8941
196 Ga0307410_10276820 3300031852 Bacteria 1315
197 Ga0307410_10292419 3300031852 Bacteria 1282
198 Ga0307410_10623956 3300031852 Bacteria 901
199 Ga0307410_11177270 3300031852 Bacteria 667
200 Ga0307406_10018047 3300031901 Unclassified 4116
201 Ga0307406_10026920 3300031901 Bacteria 3459
202 Ga0307406_10072216 3300031901 Bacteria 2265
203 Ga0307406_10116299 3300031901 Bacteria 1850
204 Ga0307406_10139204 3300031901 Bacteria 1715
205 Ga0307406_10268520 3300031901 Bacteria 1295
206 Ga0307406_10280995 3300031901 Bacteria 1270
207 Ga0307406_10462426 3300031901 Bacteria 1020
208 Ga0307407_10078579 3300031903 Bacteria 1988
209 Ga0307407_10117769 3300031903 Unclassified 1678
210 Ga0307407_10290231 3300031903 Bacteria 1136
211 Ga0307407_10445677 3300031903 Bacteria 938
212 Ga0307412_10012360 3300031911 Unclassified 4974
213 Ga0307409_100059862 3300031995 Bacteria 2966
214 Ga0307409_100069250 3300031995 Bacteria 2794
215 Ga0307409_100162408 3300031995 Bacteria 1955
216 Ga0307409_100182996 3300031995 Bacteria 1857
217 Ga0307409_100256770 3300031995 Bacteria 1601
218 Ga0307409_100461163 3300031995 Bacteria 1228
219 Ga0307409_100482678 3300031995 Bacteria 1203
220 Ga0307409_100734454 3300031995 Bacteria 990
221 Ga0307416_100025754 3300032002 Unclassified 4319
222 Ga0307416_100416209 3300032002 Bacteria 1386
223 Ga0307416_100452750 3300032002 Bacteria 1336
224 Ga0307416_100495997 3300032002 Bacteria 1284
225 Ga0307416_100522888 3300032002 Bacteria 1255
226 Ga0307416_101025553 3300032002 Bacteria 928
227 Ga0307416_101482503 3300032002 Bacteria 784
228 Ga0307414_10017960 3300032004 Bacteria 4339
229 Ga0307414_10026564 3300032004 Bacteria 3728
230 Ga0307414_10027634 3300032004 Unclassified 3669
231 Ga0307414_10269439 3300032004 Bacteria 1425
232 Ga0307411_10015180 3300032005 Unclassified 4317
233 Ga0307411_10026172 3300032005 Bacteria 3509
234 Ga0307411_10969150 3300032005 Bacteria 760
235 Ga0307415_100012141 3300032126 Unclassified 4969
236 Ga0307415_100066934 3300032126 Bacteria 2509
237 Ga0307415_100076553 3300032126 Bacteria 2372
238 Ga0307415_100076658 3300032126 Bacteria 2371
239 Ga0307415_100106847 3300032126 Bacteria 2067
240 Ga0307415_100115537 3300032126 Bacteria 2000
241 Ga0307415_100192820 3300032126 Bacteria 1609
242 Ga0307415_100207097 3300032126 Bacteria 1561
243 Ga0307415_100296363 3300032126 Bacteria 1338
244 Ga0395901_0004825 3300038443 Bacteria 13607
245 Ga0439436_0043130 3300041404 Bacteria 1288
246 Ga0439448_0024439 3300042005 Unclassified 1889
247 Ga0439450_152099 3300042008 Unclassified 607
248 Ga0439463_002953 3300042016 Bacteria 4315
249 Ga0439463_034256 3300042016 Bacteria 1284
250 Ga0450888_004630 3300042126 Bacteria 1442
251 Ga0450900_022637 3300042136 Bacteria 884
252 Ga0439444_0042991 3300042437 Bacteria 894
253 Ga0439464_0010355 3300042439 Bacteria 2461
254 Ga0439464_0024422 3300042439 Unclassified 1671
255 Ga0450901_029077 3300042533 Bacteria 607
256 Ga0466961_0224590 3300044693 Bacteria 1157
257 Ga0466961_0234145 3300044693 Bacteria 1130
258 Ga0466964_0118969 3300044706 Bacteria 1188
259 Ga0466968_0092385 3300044735 Bacteria 1343
260 Ga0466970_0509669 3300044765 Bacteria 693
261 Ga0466960_0024117 3300044901 Bacteria 2741
262 Ga0466959_0464328 3300045049 Bacteria 858
263 Ga0466958_0241210 3300045836 Bacteria 1155
264 Ga0466958_0259432 3300045836 Bacteria 1112
265 Ga0466967_0126638 3300045976 Bacteria 2366
266 Ga0466967_1260258 3300045976 Bacteria 736
267 Ga0495616_0119420 3300046513 Bacteria 1219
268 Ga0495631_0252253 3300046518 Bacteria 752
269 Ga0495637_0115919 3300046520 Bacteria 1035
270 Ga0495661_0219109 3300046665 Bacteria 987
271 Ga0495669_0138639 3300046684 Bacteria 1148
272 Ga0495670_0050077 3300046691 Bacteria 2091
273 Ga0495589_0266593 3300046794 Bacteria 798
274 Ga0495593_0442187 3300047673 Bacteria 651
275 Ga0496100_0068679 3300048903 Bacteria 2357
276 Ga0496101_0004258 3300048904 Bacteria 8973
277 Ga0496102_0048297 3300048905 Bacteria 3869
278 Ga0496102_1232162 3300048905 Bacteria 668
279 Ga0496103_0031591 3300048906 Bacteria 3227
280 Ga0496104_0292561 3300048907 Bacteria 1541
281 Ga0496106_0026578 3300048909 Bacteria 4310
282 Ga0496108_0140677 3300048911 Bacteria 2079
283 Ga0496109_0036120 3300048912 Bacteria 4459
284 Ga0496112_0607362 3300048915 Bacteria 1025
285 Ga0496113_0031244 3300048916 Bacteria 3863
286 Ga0496114_0028139 3300048917 Bacteria 4609
287 Ga0496114_0717258 3300048917 Bacteria 876
288 Ga0496125_0495234 3300048928 Bacteria 689
289 Ga0501305_087529 3300049161 Bacteria 566
290 Ga0501315_050880 3300049531 Bacteria 650
291 Ga0501317_045439 3300049533 Bacteria 683
292 Ga0501318_009382 3300049534 Bacteria 1066
293 Ga0501318_054224 3300049534 Bacteria 602
294 Ga0501321_002544 3300049537 Bacteria 1592
295 Ga0501325_016034 3300049541 Bacteria 745
296 Ga0501325_016915 3300049541 Bacteria 733
297 Ga0501038_0836814 3300049574 Bacteria 682
298 Ga0501047_0021922 3300049581 Bacteria 6134
299 Ga0501068_0003121 3300049584 Bacteria 8861
300 Ga0501070_0017179 3300049586 Bacteria 6073
301 Ga0501070_0310539 3300049586 Bacteria 1284
302 Ga0501249_172624 3300049679 Bacteria 555
303 Ga0501080_0085776 3300049742 Bacteria 2926
304 Ga0501035_0901526 3300049822 Bacteria 700
305 Ga0501044_0129299 3300049823 Bacteria 2521
306 nmdc:mga0yw44_616873_c1 3300050492 Bacteria 737
307 nmdc:mga05p37_1198_c1 3300050507 Bacteria 29987
308 nmdc:mga05p37_154_c1 3300050507 Bacteria 65419
309 nmdc:mga05p37_315337_c1 3300050507 Bacteria 1852
310 nmdc:mga05p37_374018_c1 3300050507 Bacteria 1671
311 nmdc:mga09592_118894_c1 3300050508 Bacteria 2268
312 nmdc:mga09592_36_c3 3300050508 Bacteria 51356
313 nmdc:mga09592_51705_c1 3300050508 Bacteria 3467
314 nmdc:mga09592_62425_c1 3300050508 Bacteria 3152
315 nmdc:mga09592_686296_c1 3300050508 Bacteria 872
316 nmdc:mga0qj67_1027_c1 3300050509 Bacteria 19309
317 nmdc:mga0qj67_42_c1 3300050509 Bacteria 46863
318 nmdc:mga06r32_288313_c1 3300050510 Bacteria 1628
319 nmdc:mga06r32_42_c2 3300050510 Bacteria 56690
320 nmdc:mga06r32_46962_c1 3300050510 Bacteria 4123
321 nmdc:mga08y16_8308_c1 3300050511 Bacteria 10866
322 nmdc:mga08y16_95378_c1 3300050511 Bacteria 3099
323 nmdc:mga0n895_149697_c1 3300050512 Bacteria 2364
324 nmdc:mga0n895_86620_c1 3300050512 Bacteria 3129
325 nmdc:mga0rr50_195884_c1 3300050513 Bacteria 1658
326 nmdc:mga0rr50_29752_c1 3300050513 Bacteria 3857
327 nmdc:mga08x19_2060_c1 3300050514 Bacteria 12328
328 nmdc:mga08x19_720017_c1 3300050514 Bacteria 708
329 nmdc:mga0a205_134815_c1 3300050515 Bacteria 2370
330 nmdc:mga0a205_2957_c1 3300050515 Bacteria 15068
331 Ga0500646_0000038 3300053090 Bacteria 37529
332 Ga0500646_0011797 3300053090 Bacteria 2250
333 Ga0500583_0013318 3300053092 Bacteria 3177
334 Ga0500566_0002108 3300053094 Bacteria 11733
335 Ga0500641_0023095 3300053096 Bacteria 2388
336 Ga0590075_053141 3300059424 Bacteria 1040
337 2676477291 2675903058 Bacteria 6822861
338 2799183549 2799112218 Bacteria 4315149
339 2827633697 2827628540 Bacteria 6858585
340 2837183900 2837183177 Bacteria 4637169
341 2873315136 2873314349 Bacteria 8512634
342 2884694092 2884693830 Bacteria 11273186
343 2895444551 2895442618 Bacteria 11027144
344 Ga0439446_0070036
345 JGI24033J26618_1037200
346 JGI25407J50210_10083971
347 Ga0070658_10272891
348 Ga0070683_100205140
349 Ga0070683_100287731
350 Ga0068869_101032990
351 Ga0070680_100090781
352 Ga0070682_100296158
353 Ga0070660_100209527
354 Ga0070692_10149077
355 Ga0070675_100119036
356 Ga0070674_100030832
357 Ga0070688_100324765
358 Ga0070659_100045161
359 Ga0070659_100151971
360 Ga0070667_100714204
361 Ga0070713_100378530
362 Ga0070701_10059492
363 Ga0070705_100384377
364 Ga0070700_100175594
365 Ga0070694_100054036
366 Ga0070663_100425948
367 Ga0070663_101029300
368 Ga0070678_100878044
369 Ga0070662_100149200
370 Ga0068867_100011531
371 Ga0070679_100077123
372 Ga0070679_101053233
373 Ga0070684_100106929
374 Ga0070684_100433140
375 Ga0070684_100709549
376 Ga0068853_100087643
377 Ga0070672_100632158
378 Ga0070686_100001029
379 Ga0070704_100037293
380 Ga0068855_100006757
381 Ga0070664_100193497
382 Ga0068854_100180545
383 Ga0070702_100111659
384 Ga0068852_100105424
385 Ga0068859_101093145
386 Ga0068864_101664076
387 Ga0068861_100099450
388 Ga0068861_100527506
389 Ga0068863_100686239
390 Ga0068858_100091274
391 Ga0068860_100242611
392 Ga0068860_100556317
393 Ga0068862_101031259
394 Ga0081455_10003739
395 Ga0081455_10012295
396 Ga0081455_10042245
397 Ga0081455_10214175
398 Ga0081538_10000192
399 Ga0081538_10007801
400 Ga0081540_1032693
401 Ga0081540_1221647
402 Ga0081539_10000662
403 Ga0081539_10014916
404 Ga0075363_100046948
405 Ga0075432_10000337
406 Ga0097621_100036537
407 Ga0075428_100000074
408 Ga0075428_100001119
409 Ga0075428_100012920
410 Ga0075428_100024855
411 Ga0075428_100096523
412 Ga0075428_100297117
413 Ga0075428_100305935
414 Ga0075430_100002877
415 Ga0075430_100004118
416 Ga0075431_100003975
417 Ga0075431_100009944
418 Ga0075431_100129052
419 Ga0075433_10002770
420 Ga0075433_10113424
421 Ga0075434_100000897
422 Ga0075434_100206775
423 Ga0075429_100000048
424 Ga0075429_100007657
425 Ga0075429_100121151
426 Ga0075429_100581701
427 Ga0075436_100015043
428 Ga0097620_101093057
429 Ga0075435_100006646
430 Ga0075435_100095323
431 Ga0111539_10003170
432 Ga0105245_10021498
433 Ga0105245_10028363
434 Ga0105245_10395554
435 Ga0114129_10002321
436 Ga0114129_10003209
437 Ga0114129_10729906
438 Ga0105243_10273363
439 Ga0105242_10102180
440 Ga0105242_10593167
441 Ga0105242_11592841
442 Ga0105248_10033464
443 Ga0105248_10061610
444 Ga0105249_10448024
445 Ga0105249_10530906
446 Ga0105239_10094140
447 Ga0105246_10038225
448 Ga0157344_1007665
449 Ga0157370_10214922
450 Ga0157369_10012484
451 Ga0157374_10046562
452 Ga0157378_10001199
453 Ga0157378_11568850
454 Ga0163162_10419471
455 Ga0163162_10726704
456 Ga0157372_10368094
457 Ga0157372_10668336
458 Ga0157375_10001763
459 Ga0157375_11851694
460 Ga0157377_10004740
461 Ga0157377_10076328
462 Ga0157379_10024661
463 Ga0163161_10199042
464 Ga0197907_11015224
465 Ga0197907_11016203
466 Ga0197907_11226266
467 Ga0206356_11524221
468 Ga0206356_11593343
469 Ga0206349_1063901
470 Ga0206349_1487846
471 Ga0206355_1334045
472 Ga0206351_10508886
473 Ga0206352_10738300
474 Ga0206352_10949719
475 Ga0206350_10018177
476 Ga0206350_10344064
477 Ga0206350_10697522
478 Ga0206350_11503242
479 Ga0206353_10598329
480 Ga0154015_1690038
481 Ga0224712_10073026
482 Ga0224712_10128999
483 Ga0224712_10497847
484 Ga0207705_10119787
485 Ga0207705_10130445
486 Ga0207705_10401285
487 Ga0207707_10235034
488 Ga0207660_10109300
489 Ga0207657_10108050
490 Ga0207657_10167210
491 Ga0207649_10197991
492 Ga0207652_10084343
493 Ga0207681_10397061
494 Ga0207659_10060980
495 Ga0207687_10011871
496 Ga0207687_10030505
497 Ga0207687_10041562
498 Ga0207664_10241425
499 Ga0207690_10128945
500 Ga0207706_10073107
501 Ga0207669_10546917
502 Ga0207704_10016810
503 Ga0207665_10822907
504 Ga0207691_10807974
505 Ga0207711_10003875
506 Ga0207689_10031938
507 Ga0207689_10048033
508 Ga0207661_10010209
509 Ga0207661_10508073
510 Ga0207679_10188744
511 Ga0207667_10390916
512 Ga0207667_11443235
513 Ga0207668_10237131
514 Ga0207640_10049171
515 Ga0207640_10649906
516 Ga0207678_10234404
517 Ga0207708_10003322
518 Ga0207702_10990910
519 Ga0207648_10007961
520 Ga0207676_11606129
521 Ga0207674_10172787
522 Ga0207675_100128545
523 Ga0207683_10016368
524 Ga0207698_10050713
525 Ga0207698_10294560
526 Ga0207428_10001549
527 Ga0207428_10080935
528 Ga0268264_10402802
529 Ga0307408_100520606
530 Ga0307405_10003371
531 Ga0307405_10502390
532 Ga0307405_11321689
533 Ga0307413_10001845
534 Ga0307413_10181581
535 Ga0307413_10240436
536 Ga0307413_10263649
537 Ga0307413_10467063
538 Ga0307410_10002464
539 Ga0307410_10276820
540 Ga0307410_10292419
541 Ga0307410_10623956
542 Ga0307410_11177270
543 Ga0307406_10018047
544 Ga0307406_10026920
545 Ga0307406_10072216
546 Ga0307406_10116299
547 Ga0307406_10139204
548 Ga0307406_10268520
549 Ga0307406_10280995
550 Ga0307406_10462426
551 Ga0307407_10078579
552 Ga0307407_10117769
553 Ga0307407_10290231
554 Ga0307407_10445677
555 Ga0307412_10012360
556 Ga0307409_100059862
557 Ga0307409_100069250
558 Ga0307409_100162408
559 Ga0307409_100182996
560 Ga0307409_100256770
561 Ga0307409_100461163
562 Ga0307409_100482678
563 Ga0307409_100734454
564 Ga0307416_100025754
565 Ga0307416_100416209
566 Ga0307416_100452750
567 Ga0307416_100495997
568 Ga0307416_100522888
569 Ga0307416_101025553
570 Ga0307416_101482503
571 Ga0307414_10017960
572 Ga0307414_10026564
573 Ga0307414_10027634
574 Ga0307414_10269439
575 Ga0307411_10015180
576 Ga0307411_10026172
577 Ga0307411_10969150
578 Ga0307415_100012141
579 Ga0307415_100066934
580 Ga0307415_100076553
581 Ga0307415_100076658
582 Ga0307415_100106847
583 Ga0307415_100115537
584 Ga0307415_100192820
585 Ga0307415_100207097
586 Ga0307415_100296363
587 Ga0395901_0004825
588 Ga0439436_0043130
589 Ga0439448_0024439
590 Ga0439450_152099
591 Ga0439463_002953
592 Ga0439463_034256
593 Ga0450888_004630
594 Ga0450900_022637
595 Ga0439444_0042991
596 Ga0439464_0010355
597 Ga0439464_0024422
598 Ga0450901_029077
599 Ga0466961_0224590
600 Ga0466961_0234145
601 Ga0466964_0118969
602 Ga0466968_0092385
603 Ga0466970_0509669
604 Ga0466960_0024117
605 Ga0466959_0464328
606 Ga0466958_0241210
607 Ga0466958_0259432
608 Ga0466967_0126638
609 Ga0466967_1260258
610 Ga0495616_0119420
611 Ga0495631_0252253
612 Ga0495637_0115919
613 Ga0495661_0219109
614 Ga0495669_0138639
615 Ga0495670_0050077
616 Ga0495589_0266593
617 Ga0495593_0442187
618 Ga0496100_0068679
619 Ga0496101_0004258
620 Ga0496102_0048297
621 Ga0496102_1232162
622 Ga0496103_0031591
623 Ga0496104_0292561
624 Ga0496106_0026578
625 Ga0496108_0140677
626 Ga0496109_0036120
627 Ga0496112_0607362
628 Ga0496113_0031244
629 Ga0496114_0028139
630 Ga0496114_0717258
631 Ga0496125_0495234
632 Ga0501305_087529
633 Ga0501315_050880
634 Ga0501317_045439
635 Ga0501318_009382
636 Ga0501318_054224
637 Ga0501321_002544
638 Ga0501325_016034
639 Ga0501325_016915
640 Ga0501038_0836814
641 Ga0501047_0021922
642 Ga0501068_0003121
643 Ga0501070_0017179
644 Ga0501070_0310539
645 Ga0501249_172624
646 Ga0501080_0085776
647 Ga0501035_0901526
648 Ga0501044_0129299
649 nmdc:mga0yw44_616873_c1
650 nmdc:mga05p37_1198_c1
651 nmdc:mga05p37_154_c1
652 nmdc:mga05p37_315337_c1
653 nmdc:mga05p37_374018_c1
654 nmdc:mga09592_118894_c1
655 nmdc:mga09592_36_c3
656 nmdc:mga09592_51705_c1
657 nmdc:mga09592_62425_c1
658 nmdc:mga09592_686296_c1
659 nmdc:mga0qj67_1027_c1
660 nmdc:mga0qj67_42_c1
661 nmdc:mga06r32_288313_c1
662 nmdc:mga06r32_42_c2
663 nmdc:mga06r32_46962_c1
664 nmdc:mga08y16_8308_c1
665 nmdc:mga08y16_95378_c1
666 nmdc:mga0n895_149697_c1
667 nmdc:mga0n895_86620_c1
668 nmdc:mga0rr50_195884_c1
669 nmdc:mga0rr50_29752_c1
670 nmdc:mga08x19_2060_c1
671 nmdc:mga08x19_720017_c1
672 nmdc:mga0a205_134815_c1
673 nmdc:mga0a205_2957_c1
674 Ga0500646_0000038
675 Ga0500646_0011797
676 Ga0500583_0013318
677 Ga0500566_0002108
678 Ga0500641_0023095
679 Ga0590075_053141
680 2676477291
681 2799183549
682 2827633697
683 2837183900
684 2873315136
685 2884694092
686 2895444551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

5

128

0.9

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

5

41

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

8

129

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.8223 18 142
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8048 18 151
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8017 25 143
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7917 18 143
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.7909 25 143
ID Description Score Start End Superfamily
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.831 19 149 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8109 23 142 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8014 19 149 3.10.180.10
af_Q2G2A7_273_342_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7989 117 143 2.40.50.140
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7874 23 142 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7Y6CQR8-F1-model_v4 deleted 0.9499 18 147
AF-A0A650GD38-F1-model_v4 Catechol-2,3-dioxygenase (EC 1.13.11.2) 0.9469 18 181 GO:0018577
AF-A0A7K0U4G2-F1-model_v4 VOC family protein 0.9439 21 186
AF-A0A810N2E9-F1-model_v4 Uncharacterized protein 0.9304 112 186
AF-A0A536CZM3-F1-model_v4 VOC family protein 0.929 26 172

Map