F415563

General Info

Members Datasets Scaffolds Average Seq Length
343 171 686 221

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10174377|Ga0105241_101743772
Length 251
Sequence MSFGAGIGLRSAARLAIGICPCQSSAPQARDMGLADPELKGAVIAVDGPAASGKGTVARALARHFNLPHMDTGLLYRAVALKLWRWGGDPGNQFEALRACDDLGFDPADPELRSEPVSKIASMISAYPAVRTALLERQQDFAGQPGGAVLDGRDIGTVIAPQADVKLFVTATAEVRAKRRLRELEGRGMAAHYEDVLADIRSRDARDSGRDVAPLKQAADALLLDTSSLTPEQAIAEAFRLADERLARAEP

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 2.92
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10174377 3300009174 Bacteria 1778
2 MBSR1b_contig_1028661 2162886012 Bacteria 891
3 JGI24741J21665_1004304 3300001915 Bacteria 3184
4 JGI24740J21852_10002865 3300001979 Bacteria 7710
5 JGI24740J21852_10022625 3300001979 Bacteria 2160
6 JGI24735J21928_10047106 3300002067 Bacteria 1250
7 rootL2_10218169 3300003322 Bacteria 1268
8 Ga0065712_10006158 3300005290 Bacteria 4222
9 Ga0070658_10022647 3300005327 Bacteria 5041
10 Ga0070658_10064949 3300005327 Bacteria 2978
11 Ga0070658_10070564 3300005327 Bacteria 2861
12 Ga0070658_10139943 3300005327 Bacteria 2021
13 Ga0070658_10861636 3300005327 Bacteria 787
14 Ga0070676_10049438 3300005328 Bacteria 2462
15 Ga0070676_10067386 3300005328 Bacteria 2140
16 Ga0070683_100011889 3300005329 Bacteria 7547
17 Ga0070683_100118160 3300005329 Bacteria 2504
18 Ga0070670_100002367 3300005331 Bacteria 15536
19 Ga0070670_100045109 3300005331 Bacteria 3789
20 Ga0070670_100323974 3300005331 Bacteria 1350
21 Ga0070666_10092814 3300005335 Bacteria 2076
22 Ga0070666_10131162 3300005335 Bacteria 1741
23 Ga0070680_100002495 3300005336 Bacteria 13637
24 Ga0070680_100303332 3300005336 Bacteria 1354
25 Ga0070680_100572708 3300005336 Bacteria 968
26 Ga0070682_100296493 3300005337 Bacteria 1185
27 Ga0068868_100087917 3300005338 Bacteria 2500
28 Ga0070660_100033735 3300005339 Bacteria 3861
29 Ga0070660_100104238 3300005339 Bacteria 2250
30 Ga0070660_100108675 3300005339 Bacteria 2204
31 Ga0070692_10001630 3300005345 Bacteria 8270
32 Ga0070692_10040454 3300005345 Bacteria 2385
33 Ga0070668_100094978 3300005347 Bacteria 2355
34 Ga0070669_100009838 3300005353 Bacteria 6811
35 Ga0070669_100020149 3300005353 Bacteria 4762
36 Ga0070669_100140346 3300005353 Bacteria 1862
37 Ga0070669_100598073 3300005353 Bacteria 924
38 Ga0070675_100007522 3300005354 Bacteria 8418
39 Ga0070675_100070412 3300005354 Bacteria 2899
40 Ga0070675_100327803 3300005354 Bacteria 1353
41 Ga0070671_100004901 3300005355 Bacteria 10652
42 Ga0070671_100060107 3300005355 Bacteria 3164
43 Ga0070671_100442416 3300005355 Bacteria 1115
44 Ga0070674_100261058 3300005356 Bacteria 1365
45 Ga0070673_100019033 3300005364 Bacteria 4924
46 Ga0070673_100032582 3300005364 Bacteria 3926
47 Ga0070659_100407366 3300005366 Bacteria 1149
48 Ga0070667_100126490 3300005367 Bacteria 2227
49 Ga0070714_100692881 3300005435 Bacteria 983
50 Ga0070713_100185365 3300005436 Bacteria 1873
51 Ga0070663_100021810 3300005455 Bacteria 4267
52 Ga0070663_100027199 3300005455 Bacteria 3881
53 Ga0070663_100078110 3300005455 Bacteria 2425
54 Ga0070663_100199775 3300005455 Bacteria 1560
55 Ga0070663_100309676 3300005455 Bacteria 1267
56 Ga0070678_100245961 3300005456 Bacteria 1498
57 Ga0070662_100065123 3300005457 Bacteria 2671
58 Ga0070662_100091684 3300005457 Bacteria 2282
59 Ga0070681_10052034 3300005458 Bacteria 4084
60 Ga0070681_10368674 3300005458 Bacteria 1346
61 Ga0070685_10428161 3300005466 Bacteria 922
62 Ga0070679_100000947 3300005530 Bacteria 25222
63 Ga0070672_100012856 3300005543 Bacteria 5897
64 Ga0070672_100080108 3300005543 Bacteria 2616
65 Ga0070665_100000493 3300005548 Bacteria 56564
66 Ga0070665_100004805 3300005548 Bacteria 14043
67 Ga0068855_100027896 3300005563 Bacteria 6753
68 Ga0068855_100275594 3300005563 Bacteria 1870
69 Ga0070664_100004937 3300005564 Bacteria 10687
70 Ga0070664_100158785 3300005564 Bacteria 1999
71 Ga0070664_100716727 3300005564 Bacteria 933
72 Ga0068857_100040853 3300005577 Bacteria 4112
73 Ga0068854_100034517 3300005578 Bacteria 3534
74 Ga0068856_100006690 3300005614 Bacteria 11300
75 Ga0068856_100692820 3300005614 Bacteria 1039
76 Ga0068852_100005188 3300005616 Bacteria 9290
77 Ga0068852_100403277 3300005616 Bacteria 1345
78 Ga0068864_100229387 3300005618 Bacteria 1717
79 Ga0068851_10208119 3300005834 Bacteria 1094
80 Ga0068863_101053357 3300005841 Bacteria 817
81 Ga0081539_10018076 3300005985 Bacteria 4910
82 Ga0070717_10008174 3300006028 Bacteria 7808
83 Ga0075364_10316450 3300006051 Bacteria 1063
84 Ga0070716_100046080 3300006173 Bacteria 2452
85 Ga0075370_10343661 3300006353 Bacteria 891
86 Ga0075433_10015005 3300006852 Bacteria 6343
87 Ga0105245_10024382 3300009098 Bacteria 5311
88 Ga0105243_10424824 3300009148 Bacteria 1241
89 Ga0105241_10181007 3300009174 Bacteria 1748
90 Ga0105242_10191194 3300009176 Bacteria 1812
91 Ga0105248_10004982 3300009177 Bacteria 14683
92 Ga0105248_10012913 3300009177 Bacteria 9210
93 Ga0105249_10074655 3300009553 Bacteria 3139
94 Ga0105249_10805032 3300009553 Bacteria 1004
95 Ga0105249_10873405 3300009553 Bacteria 966
96 Ga0105246_10093550 3300011119 Bacteria 2172
97 Ga0157373_10120590 3300013100 Bacteria 1843
98 Ga0157373_10232614 3300013100 Bacteria 1302
99 Ga0157371_10032593 3300013102 Bacteria 3749
100 Ga0157371_10192432 3300013102 Bacteria 1461
101 Ga0157371_10308219 3300013102 Bacteria 1147
102 Ga0157370_10058187 3300013104 Bacteria 3674
103 Ga0157370_10253166 3300013104 Bacteria 1629
104 Ga0157369_10048460 3300013105 Bacteria 4611
105 Ga0157369_10172804 3300013105 Bacteria 2276
106 Ga0163162_10186841 3300013306 Bacteria 2199
107 Ga0163162_10426103 3300013306 Bacteria 1459
108 Ga0157372_10463204 3300013307 Bacteria 1477
109 Ga0157375_10029047 3300013308 Bacteria 5195
110 Ga0157380_10043082 3300014326 Bacteria 3531
111 Ga0157377_10042180 3300014745 Bacteria 2533
112 Ga0157379_10177440 3300014968 Bacteria 1924
113 Ga0206354_11554392 3300020081 Bacteria 2081
114 Ga0206353_10739279 3300020082 Bacteria 3312
115 Ga0207680_10339628 3300025903 Bacteria 1053
116 Ga0207647_10001089 3300025904 Bacteria 20923
117 Ga0207647_10023364 3300025904 Bacteria 4089
118 Ga0207647_10033679 3300025904 Bacteria 3278
119 Ga0207647_10124289 3300025904 Bacteria 1519
120 Ga0207645_10284923 3300025907 Bacteria 1098
121 Ga0207705_10009542 3300025909 Bacteria 7061
122 Ga0207705_10095631 3300025909 Bacteria 2180
123 Ga0207705_10100512 3300025909 Bacteria 2127
124 Ga0207705_10266077 3300025909 Bacteria 1310
125 Ga0207654_10061760 3300025911 Bacteria 2193
126 Ga0207707_10182708 3300025912 Bacteria 1830
127 Ga0207707_10441779 3300025912 Bacteria 1114
128 Ga0207671_10202794 3300025914 Bacteria 1549
129 Ga0207657_10000856 3300025919 Bacteria 32149
130 Ga0207657_10004734 3300025919 Bacteria 14366
131 Ga0207657_10145099 3300025919 Bacteria 1937
132 Ga0207657_10171107 3300025919 Bacteria 1760
133 Ga0207657_10242745 3300025919 Bacteria 1438
134 Ga0207649_10104731 3300025920 Bacteria 1879
135 Ga0207649_10133781 3300025920 Bacteria 1688
136 Ga0207652_10000920 3300025921 Bacteria 27721
137 Ga0207652_10427582 3300025921 Bacteria 1194
138 Ga0207681_10054796 3300025923 Bacteria 2713
139 Ga0207681_10098198 3300025923 Bacteria 2106
140 Ga0207681_10139386 3300025923 Bacteria 1804
141 Ga0207681_10260155 3300025923 Bacteria 1358
142 Ga0207681_10475974 3300025923 Bacteria 1019
143 Ga0207650_10015829 3300025925 Bacteria 5259
144 Ga0207650_10051630 3300025925 Bacteria 3043
145 Ga0207650_10138503 3300025925 Bacteria 1911
146 Ga0207659_10022359 3300025926 Bacteria 4210
147 Ga0207687_10035350 3300025927 Bacteria 3398
148 Ga0207664_10001771 3300025929 Bacteria 14225
149 Ga0207644_10111923 3300025931 Bacteria 2065
150 Ga0207644_10153313 3300025931 Bacteria 1785
151 Ga0207644_10186887 3300025931 Bacteria 1627
152 Ga0207690_10001017 3300025932 Bacteria 17943
153 Ga0207690_10006803 3300025932 Bacteria 6782
154 Ga0207706_10009912 3300025933 Bacteria 8736
155 Ga0207706_10014821 3300025933 Bacteria 7057
156 Ga0207706_10019162 3300025933 Bacteria 6154
157 Ga0207706_10182862 3300025933 Bacteria 1841
158 Ga0207665_10034397 3300025939 Bacteria 3362
159 Ga0207691_10009509 3300025940 Bacteria 9335
160 Ga0207691_10217008 3300025940 Bacteria 1660
161 Ga0207711_10007122 3300025941 Bacteria 9371
162 Ga0207711_10056120 3300025941 Bacteria 3383
163 Ga0207679_10002664 3300025945 Bacteria 11026
164 Ga0207679_10556536 3300025945 Bacteria 1030
165 Ga0207667_10038410 3300025949 Bacteria 5114
166 Ga0207667_10267045 3300025949 Bacteria 1749
167 Ga0207667_10522842 3300025949 Bacteria 1202
168 Ga0207651_10017748 3300025960 Bacteria 4212
169 Ga0207651_10053992 3300025960 Bacteria 2750
170 Ga0207712_10001307 3300025961 Bacteria 17068
171 Ga0207668_10295408 3300025972 Bacteria 1335
172 Ga0207640_10047803 3300025981 Bacteria 2762
173 Ga0207658_10064276 3300025986 Bacteria 2752
174 Ga0207658_10562416 3300025986 Bacteria 1021
175 Ga0207639_10022594 3300026041 Bacteria 4532
176 Ga0207678_10000439 3300026067 Bacteria 37786
177 Ga0207678_10061585 3300026067 Bacteria 3227
178 Ga0207678_10204832 3300026067 Bacteria 1687
179 Ga0207678_10225929 3300026067 Bacteria 1603
180 Ga0207702_10006938 3300026078 Bacteria 9699
181 Ga0207641_10715548 3300026088 Unclassified 987
182 Ga0207676_10174113 3300026095 Bacteria 1878
183 Ga0207674_10000410 3300026116 Bacteria 55768
184 Ga0207674_10056786 3300026116 Bacteria 3972
185 Ga0207674_10082103 3300026116 Bacteria 3225
186 Ga0207683_10325272 3300026121 Bacteria 1409
187 Ga0207698_10188049 3300026142 Bacteria 1836
188 Ga0209974_10028579 3300027876 Bacteria 1847
189 Ga0268266_10000181 3300028379 Bacteria 112266
190 Ga0268266_10004977 3300028379 Bacteria 12565
191 Ga0268265_10822246 3300028380 Bacteria 907
192 Ga0268264_10509021 3300028381 Bacteria 1175
193 Ga0307513_10302905 3300031456 Bacteria 1364
194 Ga0307408_100451527 3300031548 Bacteria 1115
195 Ga0307405_10209906 3300031731 Bacteria 1421
196 Ga0307405_10230577 3300031731 Bacteria 1365
197 Ga0307405_10515121 3300031731 Bacteria 961
198 Ga0307413_10013678 3300031824 Bacteria 4090
199 Ga0307413_10161534 3300031824 Bacteria 1574
200 Ga0307413_10676674 3300031824 Bacteria 854
201 Ga0307410_10000542 3300031852 Bacteria 15510
202 Ga0307410_10005347 3300031852 Bacteria 6786
203 Ga0307410_10013415 3300031852 Bacteria 4780
204 Ga0307410_10086799 3300031852 Bacteria 2211
205 Ga0307410_10208752 3300031852 Bacteria 1495
206 Ga0307410_10216444 3300031852 Bacteria 1471
207 Ga0307410_10265960 3300031852 Bacteria 1339
208 Ga0307406_10296668 3300031901 Bacteria 1240
209 Ga0307407_10017843 3300031903 Bacteria 3573
210 Ga0307412_10179469 3300031911 Bacteria 1591
211 Ga0307409_100002615 3300031995 Bacteria 9469
212 Ga0307409_100062814 3300031995 Bacteria 2909
213 Ga0307409_100084111 3300031995 Bacteria 2582
214 Ga0307409_100126074 3300031995 Bacteria 2178
215 Ga0307409_100357229 3300031995 Bacteria 1381
216 Ga0307409_100426715 3300031995 Bacteria 1273
217 Ga0307416_100042242 3300032002 Bacteria 3558
218 Ga0307416_100048038 3300032002 Bacteria 3383
219 Ga0307416_100053444 3300032002 Bacteria 3241
220 Ga0307416_100072688 3300032002 Bacteria 2864
221 Ga0307416_100227811 3300032002 Bacteria 1794
222 Ga0307414_10003067 3300032004 Bacteria 8865
223 Ga0307414_10036808 3300032004 Bacteria 3271
224 Ga0307414_10084823 3300032004 Bacteria 2331
225 Ga0307414_10135071 3300032004 Bacteria 1922
226 Ga0307414_10345666 3300032004 Bacteria 1275
227 Ga0307411_10001446 3300032005 Bacteria 9709
228 Ga0307411_10005296 3300032005 Bacteria 6319
229 Ga0307411_10013251 3300032005 Bacteria 4540
230 Ga0307411_10145277 3300032005 Bacteria 1755
231 Ga0307411_10271612 3300032005 Bacteria 1345
232 Ga0307411_10456853 3300032005 Bacteria 1070
233 Ga0307415_100002736 3300032126 Bacteria 8813
234 Ga0373935_0017372 3300035692 Bacteria 4364
235 Ga0373927_0160163 3300035695 Bacteria 1474
236 Ga0373947_0101537 3300035725 Bacteria 1808
237 Ga0316584_0045427 3300036712 Bacteria 3279
238 Ga0373925_0013731 3300037068 Bacteria 5862
239 Ga0395899_0003344 3300037312 Bacteria 12709
240 Ga0395899_0005912 3300037312 Bacteria 9499
241 Ga0395899_0006389 3300037312 Bacteria 9129
242 Ga0395899_0231449 3300037312 Bacteria 1276
243 Ga0395899_0461039 3300037312 Bacteria 830
244 Ga0395900_0001171 3300037418 Bacteria 32731
245 Ga0395900_0002717 3300037418 Bacteria 19339
246 Ga0395900_0003741 3300037418 Bacteria 16339
247 Ga0395900_0010349 3300037418 Bacteria 9543
248 Ga0395900_0012347 3300037418 Bacteria 8740
249 Ga0395900_0023526 3300037418 Bacteria 6304
250 Ga0395900_0078186 3300037418 Bacteria 3399
251 Ga0395900_0147479 3300037418 Bacteria 2405
252 Ga0395900_0224056 3300037418 Bacteria 1894
253 Ga0395900_0644987 3300037418 Bacteria 996
254 Ga0395898_0001741 3300037466 Bacteria 28718
255 Ga0395898_0003587 3300037466 Bacteria 17305
256 Ga0395898_0006315 3300037466 Bacteria 12661
257 Ga0395898_0058372 3300037466 Bacteria 3756
258 Ga0395898_0079806 3300037466 Bacteria 3156
259 Ga0395898_0166444 3300037466 Bacteria 2108
260 Ga0395898_0218668 3300037466 Bacteria 1817
261 Ga0395905_0001433 3300037471 Bacteria 28692
262 Ga0395905_0004708 3300037471 Bacteria 14097
263 Ga0395905_0034078 3300037471 Bacteria 4780
264 Ga0395905_0037616 3300037471 Bacteria 4542
265 Ga0395905_0057809 3300037471 Bacteria 3627
266 Ga0395905_0061380 3300037471 Bacteria 3516
267 Ga0395905_0102209 3300037471 Bacteria 2690
268 Ga0395905_0106947 3300037471 Bacteria 2626
269 Ga0395905_0161485 3300037471 Bacteria 2106
270 Ga0395905_0343741 3300037471 Bacteria 1383
271 Ga0395905_0502847 3300037471 Bacteria 1112
272 Ga0395905_0611580 3300037471 Bacteria 992
273 Ga0395905_0904420 3300037471 Bacteria 785
274 Ga0395901_0004686 3300038443 Bacteria 13789
275 Ga0395901_0005560 3300038443 Bacteria 12752
276 Ga0395901_0008610 3300038443 Bacteria 10310
277 Ga0395901_0018492 3300038443 Bacteria 7114
278 Ga0395901_0030623 3300038443 Bacteria 5544
279 Ga0395901_0221483 3300038443 Bacteria 1977
280 Ga0395901_0305289 3300038443 Bacteria 1649
281 Ga0395901_0313593 3300038443 Bacteria 1624
282 Ga0395901_0437055 3300038443 Bacteria 1340
283 Ga0395901_0570045 3300038443 Bacteria 1145
284 Ga0395901_0586177 3300038443 Bacteria 1126
285 Ga0395901_0964594 3300038443 Bacteria 830
286 Ga0395901_1019286 3300038443 Bacteria 802
287 Ga0439438_077122 3300041405 Bacteria 820
288 Ga0439465_0029757 3300041413 Bacteria 1736
289 Ga0439465_0060053 3300041413 Bacteria 1259
290 Ga0439432_028286 3300042006 Bacteria 1826
291 Ga0439432_057619 3300042006 Bacteria 1202
292 Ga0439432_095040 3300042006 Bacteria 895
293 Ga0439449_0033021 3300042007 Bacteria 1929
294 Ga0439452_048523 3300042010 Bacteria 979
295 Ga0466972_0025045 3300044658 Bacteria 2960
296 Ga0466965_0195780 3300044683 Bacteria 1070
297 Ga0466966_0034283 3300044684 Bacteria 3283
298 Ga0466961_0056532 3300044693 Bacteria 2500
299 Ga0466961_0103626 3300044693 Bacteria 1791
300 Ga0466963_0016314 3300044694 Bacteria 4617
301 Ga0466963_0072542 3300044694 Bacteria 2319
302 Ga0466964_0001944 3300044706 Bacteria 7242
303 Ga0466964_0019716 3300044706 Bacteria 2594
304 Ga0466964_0222212 3300044706 Bacteria 918
305 Ga0466971_0120177 3300044719 Bacteria 1216
306 Ga0466971_0209781 3300044719 Bacteria 921
307 Ga0466970_0004249 3300044765 Bacteria 7049
308 Ga0466957_0302445 3300044842 Bacteria 1075
309 Ga0466959_0029179 3300045049 Bacteria 4088
310 Ga0466958_0022542 3300045836 Bacteria 3690
311 Ga0466958_0098131 3300045836 Bacteria 1819
312 Ga0466967_0008585 3300045976 Bacteria 7506
313 Ga0466967_0015726 3300045976 Bacteria 5943
314 Ga0466967_0036520 3300045976 Bacteria 4195
315 Ga0466967_0227858 3300045976 Bacteria 1773
316 Ga0466967_0318860 3300045976 Bacteria 1498
317 Ga0466967_0339676 3300045976 Bacteria 1452
318 Ga0495663_0014424 3300046525 Bacteria 2214
319 Ga0495598_0000490 3300046537 Bacteria 7273
320 Ga0495621_0001893 3300046539 Bacteria 5498
321 Ga0495669_0002325 3300046684 Bacteria 7788
322 Ga0495669_0083480 3300046684 Bacteria 1468
323 Ga0495670_0226960 3300046691 Bacteria 992
324 Ga0496102_0134175 3300048905 Bacteria 2319
325 Ga0496103_0155134 3300048906 Bacteria 1467
326 Ga0496109_0143759 3300048912 Bacteria 2231
327 Ga0496110_0001561 3300048913 Bacteria 16696
328 Ga0496111_0004139 3300048914 Bacteria 9115
329 Ga0496111_0260023 3300048914 Bacteria 1288
330 Ga0496112_0004459 3300048915 Bacteria 11869
331 Ga0496113_0003506 3300048916 Bacteria 9411
332 Ga0496113_0135045 3300048916 Bacteria 1938
333 Ga0496114_0022591 3300048917 Bacteria 5128
334 Ga0496117_0021451 3300048920 Bacteria 5224
335 Ga0496118_0013603 3300048921 Bacteria 7683
336 Ga0496121_0000035 3300048924 Bacteria 374316
337 Ga0496124_0286203 3300048927 Bacteria 1199
338 Ga0501072_0302831 3300049588 Bacteria 1271
339 nmdc:mga00v17_475934_c1 3300050491 Bacteria 810
340 nmdc:mga06r32_59957_c1 3300050510 Bacteria 3660
341 nmdc:mga0a205_18775_c1 3300050515 Bacteria 6509
342 Ga0500643_000135 3300053087 Bacteria 74911
343 Ga0590071_032599 3300059421 Bacteria 1244
344 Ga0105241_10174377
345 MBSR1b_contig_1028661
346 JGI24741J21665_1004304
347 JGI24740J21852_10002865
348 JGI24740J21852_10022625
349 JGI24735J21928_10047106
350 rootL2_10218169
351 Ga0065712_10006158
352 Ga0070658_10022647
353 Ga0070658_10064949
354 Ga0070658_10070564
355 Ga0070658_10139943
356 Ga0070658_10861636
357 Ga0070676_10049438
358 Ga0070676_10067386
359 Ga0070683_100011889
360 Ga0070683_100118160
361 Ga0070670_100002367
362 Ga0070670_100045109
363 Ga0070670_100323974
364 Ga0070666_10092814
365 Ga0070666_10131162
366 Ga0070680_100002495
367 Ga0070680_100303332
368 Ga0070680_100572708
369 Ga0070682_100296493
370 Ga0068868_100087917
371 Ga0070660_100033735
372 Ga0070660_100104238
373 Ga0070660_100108675
374 Ga0070692_10001630
375 Ga0070692_10040454
376 Ga0070668_100094978
377 Ga0070669_100009838
378 Ga0070669_100020149
379 Ga0070669_100140346
380 Ga0070669_100598073
381 Ga0070675_100007522
382 Ga0070675_100070412
383 Ga0070675_100327803
384 Ga0070671_100004901
385 Ga0070671_100060107
386 Ga0070671_100442416
387 Ga0070674_100261058
388 Ga0070673_100019033
389 Ga0070673_100032582
390 Ga0070659_100407366
391 Ga0070667_100126490
392 Ga0070714_100692881
393 Ga0070713_100185365
394 Ga0070663_100021810
395 Ga0070663_100027199
396 Ga0070663_100078110
397 Ga0070663_100199775
398 Ga0070663_100309676
399 Ga0070678_100245961
400 Ga0070662_100065123
401 Ga0070662_100091684
402 Ga0070681_10052034
403 Ga0070681_10368674
404 Ga0070685_10428161
405 Ga0070679_100000947
406 Ga0070672_100012856
407 Ga0070672_100080108
408 Ga0070665_100000493
409 Ga0070665_100004805
410 Ga0068855_100027896
411 Ga0068855_100275594
412 Ga0070664_100004937
413 Ga0070664_100158785
414 Ga0070664_100716727
415 Ga0068857_100040853
416 Ga0068854_100034517
417 Ga0068856_100006690
418 Ga0068856_100692820
419 Ga0068852_100005188
420 Ga0068852_100403277
421 Ga0068864_100229387
422 Ga0068851_10208119
423 Ga0068863_101053357
424 Ga0081539_10018076
425 Ga0070717_10008174
426 Ga0075364_10316450
427 Ga0070716_100046080
428 Ga0075370_10343661
429 Ga0075433_10015005
430 Ga0105245_10024382
431 Ga0105243_10424824
432 Ga0105241_10181007
433 Ga0105242_10191194
434 Ga0105248_10004982
435 Ga0105248_10012913
436 Ga0105249_10074655
437 Ga0105249_10805032
438 Ga0105249_10873405
439 Ga0105246_10093550
440 Ga0157373_10120590
441 Ga0157373_10232614
442 Ga0157371_10032593
443 Ga0157371_10192432
444 Ga0157371_10308219
445 Ga0157370_10058187
446 Ga0157370_10253166
447 Ga0157369_10048460
448 Ga0157369_10172804
449 Ga0163162_10186841
450 Ga0163162_10426103
451 Ga0157372_10463204
452 Ga0157375_10029047
453 Ga0157380_10043082
454 Ga0157377_10042180
455 Ga0157379_10177440
456 Ga0206354_11554392
457 Ga0206353_10739279
458 Ga0207680_10339628
459 Ga0207647_10001089
460 Ga0207647_10023364
461 Ga0207647_10033679
462 Ga0207647_10124289
463 Ga0207645_10284923
464 Ga0207705_10009542
465 Ga0207705_10095631
466 Ga0207705_10100512
467 Ga0207705_10266077
468 Ga0207654_10061760
469 Ga0207707_10182708
470 Ga0207707_10441779
471 Ga0207671_10202794
472 Ga0207657_10000856
473 Ga0207657_10004734
474 Ga0207657_10145099
475 Ga0207657_10171107
476 Ga0207657_10242745
477 Ga0207649_10104731
478 Ga0207649_10133781
479 Ga0207652_10000920
480 Ga0207652_10427582
481 Ga0207681_10054796
482 Ga0207681_10098198
483 Ga0207681_10139386
484 Ga0207681_10260155
485 Ga0207681_10475974
486 Ga0207650_10015829
487 Ga0207650_10051630
488 Ga0207650_10138503
489 Ga0207659_10022359
490 Ga0207687_10035350
491 Ga0207664_10001771
492 Ga0207644_10111923
493 Ga0207644_10153313
494 Ga0207644_10186887
495 Ga0207690_10001017
496 Ga0207690_10006803
497 Ga0207706_10009912
498 Ga0207706_10014821
499 Ga0207706_10019162
500 Ga0207706_10182862
501 Ga0207665_10034397
502 Ga0207691_10009509
503 Ga0207691_10217008
504 Ga0207711_10007122
505 Ga0207711_10056120
506 Ga0207679_10002664
507 Ga0207679_10556536
508 Ga0207667_10038410
509 Ga0207667_10267045
510 Ga0207667_10522842
511 Ga0207651_10017748
512 Ga0207651_10053992
513 Ga0207712_10001307
514 Ga0207668_10295408
515 Ga0207640_10047803
516 Ga0207658_10064276
517 Ga0207658_10562416
518 Ga0207639_10022594
519 Ga0207678_10000439
520 Ga0207678_10061585
521 Ga0207678_10204832
522 Ga0207678_10225929
523 Ga0207702_10006938
524 Ga0207641_10715548
525 Ga0207676_10174113
526 Ga0207674_10000410
527 Ga0207674_10056786
528 Ga0207674_10082103
529 Ga0207683_10325272
530 Ga0207698_10188049
531 Ga0209974_10028579
532 Ga0268266_10000181
533 Ga0268266_10004977
534 Ga0268265_10822246
535 Ga0268264_10509021
536 Ga0307513_10302905
537 Ga0307408_100451527
538 Ga0307405_10209906
539 Ga0307405_10230577
540 Ga0307405_10515121
541 Ga0307413_10013678
542 Ga0307413_10161534
543 Ga0307413_10676674
544 Ga0307410_10000542
545 Ga0307410_10005347
546 Ga0307410_10013415
547 Ga0307410_10086799
548 Ga0307410_10208752
549 Ga0307410_10216444
550 Ga0307410_10265960
551 Ga0307406_10296668
552 Ga0307407_10017843
553 Ga0307412_10179469
554 Ga0307409_100002615
555 Ga0307409_100062814
556 Ga0307409_100084111
557 Ga0307409_100126074
558 Ga0307409_100357229
559 Ga0307409_100426715
560 Ga0307416_100042242
561 Ga0307416_100048038
562 Ga0307416_100053444
563 Ga0307416_100072688
564 Ga0307416_100227811
565 Ga0307414_10003067
566 Ga0307414_10036808
567 Ga0307414_10084823
568 Ga0307414_10135071
569 Ga0307414_10345666
570 Ga0307411_10001446
571 Ga0307411_10005296
572 Ga0307411_10013251
573 Ga0307411_10145277
574 Ga0307411_10271612
575 Ga0307411_10456853
576 Ga0307415_100002736
577 Ga0373935_0017372
578 Ga0373927_0160163
579 Ga0373947_0101537
580 Ga0316584_0045427
581 Ga0373925_0013731
582 Ga0395899_0003344
583 Ga0395899_0005912
584 Ga0395899_0006389
585 Ga0395899_0231449
586 Ga0395899_0461039
587 Ga0395900_0001171
588 Ga0395900_0002717
589 Ga0395900_0003741
590 Ga0395900_0010349
591 Ga0395900_0012347
592 Ga0395900_0023526
593 Ga0395900_0078186
594 Ga0395900_0147479
595 Ga0395900_0224056
596 Ga0395900_0644987
597 Ga0395898_0001741
598 Ga0395898_0003587
599 Ga0395898_0006315
600 Ga0395898_0058372
601 Ga0395898_0079806
602 Ga0395898_0166444
603 Ga0395898_0218668
604 Ga0395905_0001433
605 Ga0395905_0004708
606 Ga0395905_0034078
607 Ga0395905_0037616
608 Ga0395905_0057809
609 Ga0395905_0061380
610 Ga0395905_0102209
611 Ga0395905_0106947
612 Ga0395905_0161485
613 Ga0395905_0343741
614 Ga0395905_0502847
615 Ga0395905_0611580
616 Ga0395905_0904420
617 Ga0395901_0004686
618 Ga0395901_0005560
619 Ga0395901_0008610
620 Ga0395901_0018492
621 Ga0395901_0030623
622 Ga0395901_0221483
623 Ga0395901_0305289
624 Ga0395901_0313593
625 Ga0395901_0437055
626 Ga0395901_0570045
627 Ga0395901_0586177
628 Ga0395901_0964594
629 Ga0395901_1019286
630 Ga0439438_077122
631 Ga0439465_0029757
632 Ga0439465_0060053
633 Ga0439432_028286
634 Ga0439432_057619
635 Ga0439432_095040
636 Ga0439449_0033021
637 Ga0439452_048523
638 Ga0466972_0025045
639 Ga0466965_0195780
640 Ga0466966_0034283
641 Ga0466961_0056532
642 Ga0466961_0103626
643 Ga0466963_0016314
644 Ga0466963_0072542
645 Ga0466964_0001944
646 Ga0466964_0019716
647 Ga0466964_0222212
648 Ga0466971_0120177
649 Ga0466971_0209781
650 Ga0466970_0004249
651 Ga0466957_0302445
652 Ga0466959_0029179
653 Ga0466958_0022542
654 Ga0466958_0098131
655 Ga0466967_0008585
656 Ga0466967_0015726
657 Ga0466967_0036520
658 Ga0466967_0227858
659 Ga0466967_0318860
660 Ga0466967_0339676
661 Ga0495663_0014424
662 Ga0495598_0000490
663 Ga0495621_0001893
664 Ga0495669_0002325
665 Ga0495669_0083480
666 Ga0495670_0226960
667 Ga0496102_0134175
668 Ga0496103_0155134
669 Ga0496109_0143759
670 Ga0496110_0001561
671 Ga0496111_0004139
672 Ga0496111_0260023
673 Ga0496112_0004459
674 Ga0496113_0003506
675 Ga0496113_0135045
676 Ga0496114_0022591
677 Ga0496117_0021451
678 Ga0496118_0013603
679 Ga0496121_0000035
680 Ga0496124_0286203
681 Ga0501072_0302831
682 nmdc:mga00v17_475934_c1
683 nmdc:mga06r32_59957_c1
684 nmdc:mga0a205_18775_c1
685 Ga0500643_000135
686 Ga0590071_032599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

44

244

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8713 6 211
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8403 6 211
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8398 7 206
1cke-assembly1.cif.gz_A cmp kinase from escherichia coli free enzyme structure 0.8318 6 211
2fem-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli 0.8316 6 211
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8316 6 211 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8056 6 211 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7986 7 209 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7631 41 209 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7594 7 209 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A285M6Y7-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9571 4 212 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A1V1PJE3-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9364 44 212 GO:0005524
GO:0036430
GO:0036431
AF-A0A4V1SH17-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9315 7 213 GO:0005524
GO:0036430
GO:0036431
AF-A0A285M6Y7-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9311 4 212 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A3B0RXE6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.925 1 213 GO:0003866
GO:0005524
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431

Map