F415505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 172 | 686 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10105787|Ga0070717_101057874 |
| Length | 333 |
| Sequence | MTPAAAIPLFVASIALMLVASAVFAGRLDRIGQRLGLPEALLGLLTALAADAPEISSAIAALVQHEHAVAVGVVVGSNAFNLAAMLGISAVVAGQVRARHETLELEAFVGLWLLAVMLAVAAGRLGATVGAVLAAAVVVPYVALLAAGPRLARRLPLDAAGARFVHRSFGEAHRRARPLDSRREAVGAAFVLLLALCLIVAGSVGAVRAATDLAQAWSVPDALVGVVVLAVLTSLPNAWTGVRFGLQGRGSALTSETLNSNSINIVAGLVVPAALGALVAFPGLAVFDLAWLVGMTTAALVLFGKRAGGGRAAGTLLIVLYAVFLAVQFAKLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 71 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 74 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 75 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 76 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 77 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 78 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 79 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 80 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 81 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 82 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 85 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 86 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 87 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 88 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 89 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 90 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 91 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 92 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 95 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 96 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 97 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 98 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 99 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 102 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 171 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 172 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 11.37 |
| Rhizosphere | 88.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10105787 | 3300006028 | Bacteria | 2395 |
| 2 | rootH2_10226388 | 3300003320 | Bacteria | 2986 |
| 3 | Ga0070683_100092877 | 3300005329 | Bacteria | 2834 |
| 4 | Ga0070682_100281779 | 3300005337 | Unclassified | 1212 |
| 5 | Ga0068868_100384787 | 3300005338 | Bacteria | 1208 |
| 6 | Ga0070660_100024623 | 3300005339 | Bacteria | 4465 |
| 7 | Ga0070709_10043230 | 3300005434 | Bacteria | 2785 |
| 8 | Ga0070709_10053253 | 3300005434 | Bacteria | 2547 |
| 9 | Ga0070709_10244635 | 3300005434 | Unclassified | 1289 |
| 10 | Ga0070714_100012344 | 3300005435 | Bacteria | 6819 |
| 11 | Ga0070714_100106721 | 3300005435 | Bacteria | 2474 |
| 12 | Ga0070714_100109946 | 3300005435 | Bacteria | 2439 |
| 13 | Ga0070714_100150723 | 3300005435 | Unclassified | 2095 |
| 14 | Ga0070713_100092691 | 3300005436 | Bacteria | 2601 |
| 15 | Ga0070713_100127091 | 3300005436 | Bacteria | 2244 |
| 16 | Ga0070713_100378988 | 3300005436 | Unclassified | 1318 |
| 17 | Ga0070710_10028029 | 3300005437 | Bacteria | 3009 |
| 18 | Ga0070710_10071224 | 3300005437 | Bacteria | 2004 |
| 19 | Ga0070711_100132819 | 3300005439 | Bacteria | 1856 |
| 20 | Ga0070711_100156677 | 3300005439 | Unclassified | 1723 |
| 21 | Ga0070694_100091486 | 3300005444 | Bacteria | 2135 |
| 22 | Ga0070694_100132164 | 3300005444 | Bacteria | 1804 |
| 23 | Ga0070678_100016722 | 3300005456 | Bacteria | 4701 |
| 24 | Ga0070681_10107979 | 3300005458 | Bacteria | 2723 |
| 25 | Ga0070707_100001296 | 3300005468 | Bacteria | 24594 |
| 26 | Ga0070707_100015560 | 3300005468 | Bacteria | 7138 |
| 27 | Ga0070707_100454878 | 3300005468 | Bacteria | 1241 |
| 28 | Ga0070698_100019245 | 3300005471 | Bacteria | 7173 |
| 29 | Ga0070679_100186088 | 3300005530 | Bacteria | 2047 |
| 30 | Ga0070684_100016072 | 3300005535 | Bacteria | 6112 |
| 31 | Ga0070684_100143073 | 3300005535 | Unclassified | 2164 |
| 32 | Ga0070686_100135107 | 3300005544 | Bacteria | 1710 |
| 33 | Ga0070695_100010323 | 3300005545 | Bacteria | 5574 |
| 34 | Ga0070695_100116201 | 3300005545 | Bacteria | 1824 |
| 35 | Ga0070696_100096913 | 3300005546 | Bacteria | 2108 |
| 36 | Ga0070693_100023607 | 3300005547 | Bacteria | 3289 |
| 37 | Ga0068855_100386072 | 3300005563 | Bacteria | 1537 |
| 38 | Ga0070664_100045220 | 3300005564 | Bacteria | 3718 |
| 39 | Ga0068856_100305225 | 3300005614 | Bacteria | 1609 |
| 40 | Ga0068856_100365353 | 3300005614 | Bacteria | 1462 |
| 41 | Ga0068863_100271331 | 3300005841 | Bacteria | 1642 |
| 42 | Ga0070717_10003402 | 3300006028 | Bacteria | 11383 |
| 43 | Ga0070717_10036966 | 3300006028 | Bacteria | 3963 |
| 44 | Ga0070717_10264490 | 3300006028 | Bacteria | 1522 |
| 45 | Ga0070715_10003145 | 3300006163 | Bacteria | 5192 |
| 46 | Ga0070716_100201801 | 3300006173 | Unclassified | 1322 |
| 47 | Ga0070712_100013144 | 3300006175 | Bacteria | 5281 |
| 48 | Ga0070712_100190588 | 3300006175 | Bacteria | 1604 |
| 49 | Ga0070712_100270267 | 3300006175 | Bacteria | 1365 |
| 50 | Ga0070712_100432499 | 3300006175 | Bacteria | 1093 |
| 51 | Ga0075431_100041716 | 3300006847 | Bacteria | 4732 |
| 52 | Ga0075433_10009485 | 3300006852 | Bacteria | 7779 |
| 53 | Ga0075433_10019741 | 3300006852 | Bacteria | 5623 |
| 54 | Ga0075433_10075399 | 3300006852 | Bacteria | 2968 |
| 55 | Ga0075434_100003194 | 3300006871 | Bacteria | 14611 |
| 56 | Ga0075434_100263291 | 3300006871 | Bacteria | 1743 |
| 57 | Ga0075436_100001428 | 3300006914 | Bacteria | 16229 |
| 58 | Ga0075436_100008602 | 3300006914 | Bacteria | 6976 |
| 59 | Ga0075435_100006338 | 3300007076 | Bacteria | 8359 |
| 60 | Ga0105240_10012439 | 3300009093 | Bacteria | 11747 |
| 61 | Ga0105240_10375507 | 3300009093 | Unclassified | 1607 |
| 62 | Ga0105245_10106552 | 3300009098 | Unclassified | 2601 |
| 63 | Ga0105245_10206367 | 3300009098 | Bacteria | 1889 |
| 64 | Ga0114129_10021583 | 3300009147 | Bacteria | 9140 |
| 65 | Ga0114129_10032700 | 3300009147 | Bacteria | 7349 |
| 66 | Ga0105243_10067568 | 3300009148 | Bacteria | 2878 |
| 67 | Ga0105242_10126199 | 3300009176 | Bacteria | 2203 |
| 68 | Ga0105242_10343235 | 3300009176 | Bacteria | 1377 |
| 69 | Ga0105248_10026241 | 3300009177 | Bacteria | 6483 |
| 70 | Ga0105237_10232722 | 3300009545 | Bacteria | 1843 |
| 71 | Ga0157370_10397282 | 3300013104 | Unclassified | 1269 |
| 72 | Ga0157369_10238542 | 3300013105 | Bacteria | 1899 |
| 73 | Ga0157372_10028464 | 3300013307 | Bacteria | 6098 |
| 74 | Ga0157377_10235022 | 3300014745 | Bacteria | 1180 |
| 75 | Ga0157379_10468973 | 3300014968 | Unclassified | 1164 |
| 76 | Ga0157376_10021908 | 3300014969 | Unclassified | 4970 |
| 77 | Ga0207653_10005366 | 3300025885 | Bacteria | 4006 |
| 78 | Ga0207692_10050636 | 3300025898 | Bacteria | 2102 |
| 79 | Ga0207685_10020075 | 3300025905 | Unclassified | 2214 |
| 80 | Ga0207685_10087872 | 3300025905 | Bacteria | 1302 |
| 81 | Ga0207699_10115514 | 3300025906 | Unclassified | 1727 |
| 82 | Ga0207684_10169365 | 3300025910 | Bacteria | 1883 |
| 83 | Ga0207684_10316846 | 3300025910 | Bacteria | 1344 |
| 84 | Ga0207654_10061164 | 3300025911 | Bacteria | 2202 |
| 85 | Ga0207707_10130119 | 3300025912 | Bacteria | 2202 |
| 86 | Ga0207695_10032733 | 3300025913 | Bacteria | 5685 |
| 87 | Ga0207693_10000867 | 3300025915 | Bacteria | 27046 |
| 88 | Ga0207693_10002862 | 3300025915 | Bacteria | 14949 |
| 89 | Ga0207693_10005534 | 3300025915 | Bacteria | 10508 |
| 90 | Ga0207693_10033578 | 3300025915 | Bacteria | 4048 |
| 91 | Ga0207693_10286067 | 3300025915 | Unclassified | 1292 |
| 92 | Ga0207693_10295473 | 3300025915 | Bacteria | 1269 |
| 93 | Ga0207663_10028812 | 3300025916 | Bacteria | 3255 |
| 94 | Ga0207660_10013656 | 3300025917 | Bacteria | 5325 |
| 95 | Ga0207657_10001757 | 3300025919 | Bacteria | 23391 |
| 96 | Ga0207652_10114620 | 3300025921 | Bacteria | 2393 |
| 97 | Ga0207646_10001221 | 3300025922 | Bacteria | 32278 |
| 98 | Ga0207700_10039259 | 3300025928 | Bacteria | 3444 |
| 99 | Ga0207700_10131408 | 3300025928 | Bacteria | 2044 |
| 100 | Ga0207700_10182274 | 3300025928 | Unclassified | 1759 |
| 101 | Ga0207700_10303831 | 3300025928 | Bacteria | 1379 |
| 102 | Ga0207664_10026734 | 3300025929 | Bacteria | 4364 |
| 103 | Ga0207664_10048299 | 3300025929 | Bacteria | 3346 |
| 104 | Ga0207664_10058983 | 3300025929 | Bacteria | 3055 |
| 105 | Ga0207664_10152151 | 3300025929 | Bacteria | 1966 |
| 106 | Ga0207665_10000490 | 3300025939 | Bacteria | 26757 |
| 107 | Ga0207665_10017001 | 3300025939 | Bacteria | 4778 |
| 108 | Ga0207665_10019175 | 3300025939 | Bacteria | 4495 |
| 109 | Ga0207661_10139596 | 3300025944 | Bacteria | 2084 |
| 110 | Ga0207661_10174224 | 3300025944 | Unclassified | 1875 |
| 111 | Ga0207667_10297741 | 3300025949 | Unclassified | 1648 |
| 112 | Ga0207677_10105425 | 3300026023 | Bacteria | 2086 |
| 113 | Ga0207702_10130517 | 3300026078 | Unclassified | 2261 |
| 114 | Ga0207676_10247867 | 3300026095 | Bacteria | 1602 |
| 115 | Ga0207428_10027184 | 3300027907 | Bacteria | 4765 |
| 116 | Ga0265336_10014239 | 3300028666 | Bacteria | 2638 |
| 117 | Ga0265338_10000634 | 3300028800 | Bacteria | 60990 |
| 118 | Ga0265338_10009865 | 3300028800 | Bacteria | 11306 |
| 119 | Ga0265338_10207417 | 3300028800 | Bacteria | 1473 |
| 120 | Ga0373948_0007402 | 3300034817 | Bacteria | 1845 |
| 121 | Ga0373958_0013373 | 3300034819 | Bacteria | 1421 |
| 122 | Ga0373929_0044292 | 3300035085 | Bacteria | 999 |
| 123 | Ga0373940_0006652 | 3300035088 | Bacteria | 2577 |
| 124 | Ga0373952_0007842 | 3300035092 | Bacteria | 2011 |
| 125 | Ga0373945_0009593 | 3300035116 | Bacteria | 3174 |
| 126 | Ga0373961_0003134 | 3300035241 | Bacteria | 4132 |
| 127 | Ga0373931_0008068 | 3300035691 | Bacteria | 4983 |
| 128 | Ga0373947_0007867 | 3300035725 | Bacteria | 6155 |
| 129 | Ga0373937_0007877 | 3300036401 | Bacteria | 9236 |
| 130 | Ga0373925_0002672 | 3300037068 | Bacteria | 14141 |
| 131 | Ga0395900_0066849 | 3300037418 | Unclassified | 3694 |
| 132 | Ga0395900_0148091 | 3300037418 | Bacteria | 2400 |
| 133 | Ga0395898_0097399 | 3300037466 | Bacteria | 2825 |
| 134 | Ga0395898_0229191 | 3300037466 | Bacteria | 1772 |
| 135 | Ga0395905_0275786 | 3300037471 | Bacteria | 1567 |
| 136 | Ga0395901_0052167 | 3300038443 | Bacteria | 4251 |
| 137 | Ga0466969_0002679 | 3300044656 | Bacteria | 9515 |
| 138 | Ga0466972_0039640 | 3300044658 | Bacteria | 2298 |
| 139 | Ga0466965_0038467 | 3300044683 | Bacteria | 2350 |
| 140 | Ga0466965_0038927 | 3300044683 | Bacteria | 2336 |
| 141 | Ga0466965_0096197 | 3300044683 | Bacteria | 1511 |
| 142 | Ga0466966_0041375 | 3300044684 | Bacteria | 2961 |
| 143 | Ga0466961_0002794 | 3300044693 | Bacteria | 10856 |
| 144 | Ga0466961_0026003 | 3300044693 | Unclassified | 3763 |
| 145 | Ga0466961_0250993 | 3300044693 | Bacteria | 1086 |
| 146 | Ga0466963_0000189 | 3300044694 | Bacteria | 25856 |
| 147 | Ga0466963_0000997 | 3300044694 | Bacteria | 14602 |
| 148 | Ga0466963_0006341 | 3300044694 | Bacteria | 6993 |
| 149 | Ga0466963_0006447 | 3300044694 | Bacteria | 6940 |
| 150 | Ga0466963_0007750 | 3300044694 | Bacteria | 6418 |
| 151 | Ga0466963_0008197 | 3300044694 | Bacteria | 6261 |
| 152 | Ga0466963_0025182 | 3300044694 | Bacteria | 3792 |
| 153 | Ga0466963_0032904 | 3300044694 | Bacteria | 3361 |
| 154 | Ga0466963_0044409 | 3300044694 | Bacteria | 2925 |
| 155 | Ga0466963_0079494 | 3300044694 | Bacteria | 2218 |
| 156 | Ga0466963_0120958 | 3300044694 | Bacteria | 1802 |
| 157 | Ga0466964_0002642 | 3300044706 | Bacteria | 6418 |
| 158 | Ga0466964_0003844 | 3300044706 | Bacteria | 5511 |
| 159 | Ga0466964_0013619 | 3300044706 | Bacteria | 3085 |
| 160 | Ga0466964_0023029 | 3300044706 | Bacteria | 2419 |
| 161 | Ga0466964_0027281 | 3300044706 | Bacteria | 2242 |
| 162 | Ga0466964_0028101 | 3300044706 | Bacteria | 2214 |
| 163 | Ga0466964_0033501 | 3300044706 | Bacteria | 2047 |
| 164 | Ga0466964_0112437 | 3300044706 | Unclassified | 1216 |
| 165 | Ga0466971_0005051 | 3300044719 | Bacteria | 5713 |
| 166 | Ga0466968_0007477 | 3300044735 | Bacteria | 4155 |
| 167 | Ga0466968_0021429 | 3300044735 | Bacteria | 2618 |
| 168 | Ga0466968_0075710 | 3300044735 | Bacteria | 1472 |
| 169 | Ga0466970_0040190 | 3300044765 | Bacteria | 2484 |
| 170 | Ga0466957_0008650 | 3300044842 | Bacteria | 5796 |
| 171 | Ga0466957_0015017 | 3300044842 | Bacteria | 4517 |
| 172 | Ga0466957_0044460 | 3300044842 | Bacteria | 2691 |
| 173 | Ga0466957_0049407 | 3300044842 | Bacteria | 2558 |
| 174 | Ga0466957_0076955 | 3300044842 | Bacteria | 2072 |
| 175 | Ga0466957_0201882 | 3300044842 | Unclassified | 1306 |
| 176 | Ga0466957_0237586 | 3300044842 | Unclassified | 1208 |
| 177 | Ga0466960_0002376 | 3300044901 | Bacteria | 7080 |
| 178 | Ga0466960_0016298 | 3300044901 | Bacteria | 3220 |
| 179 | Ga0466960_0107413 | 3300044901 | Unclassified | 1445 |
| 180 | Ga0466959_0008552 | 3300045049 | Bacteria | 7243 |
| 181 | Ga0466959_0056073 | 3300045049 | Bacteria | 2875 |
| 182 | Ga0466958_0001083 | 3300045836 | Bacteria | 12522 |
| 183 | Ga0466958_0003928 | 3300045836 | Bacteria | 7792 |
| 184 | Ga0466958_0011610 | 3300045836 | Bacteria | 4964 |
| 185 | Ga0466958_0012546 | 3300045836 | Bacteria | 4803 |
| 186 | Ga0466958_0027264 | 3300045836 | Bacteria | 3381 |
| 187 | Ga0466958_0057212 | 3300045836 | Bacteria | 2370 |
| 188 | Ga0466958_0068808 | 3300045836 | Bacteria | 2164 |
| 189 | Ga0466967_0017166 | 3300045976 | Bacteria | 5736 |
| 190 | Ga0466967_0019743 | 3300045976 | Bacteria | 5426 |
| 191 | Ga0466967_0024108 | 3300045976 | Bacteria | 4997 |
| 192 | Ga0466967_0030883 | 3300045976 | Bacteria | 4501 |
| 193 | Ga0466967_0079173 | 3300045976 | Bacteria | 2962 |
| 194 | Ga0466967_0107349 | 3300045976 | Bacteria | 2560 |
| 195 | Ga0466967_0164544 | 3300045976 | Bacteria | 2084 |
| 196 | Ga0466967_0179082 | 3300045976 | Bacteria | 1998 |
| 197 | Ga0466967_0179274 | 3300045976 | Bacteria | 1997 |
| 198 | Ga0466967_0223186 | 3300045976 | Bacteria | 1791 |
| 199 | Ga0466967_0361517 | 3300045976 | Bacteria | 1406 |
| 200 | Ga0466967_0381031 | 3300045976 | Unclassified | 1369 |
| 201 | Ga0495592_0002063 | 3300046454 | Bacteria | 14153 |
| 202 | Ga0495592_0090339 | 3300046454 | Bacteria | 2197 |
| 203 | Ga0495592_0098999 | 3300046454 | Unclassified | 2080 |
| 204 | Ga0495592_0129557 | 3300046454 | Bacteria | 1766 |
| 205 | Ga0495629_0069900 | 3300046459 | Unclassified | 2450 |
| 206 | Ga0495629_0079665 | 3300046459 | Bacteria | 2287 |
| 207 | Ga0495629_0204628 | 3300046459 | Bacteria | 1364 |
| 208 | Ga0495641_0049937 | 3300046461 | Bacteria | 1913 |
| 209 | Ga0495651_0011043 | 3300046462 | Bacteria | 6951 |
| 210 | Ga0495651_0046559 | 3300046462 | Bacteria | 3356 |
| 211 | Ga0495653_0008537 | 3300046463 | Bacteria | 8403 |
| 212 | Ga0495582_0009735 | 3300046473 | Bacteria | 5293 |
| 213 | Ga0495639_0002608 | 3300046475 | Bacteria | 7845 |
| 214 | Ga0495662_0157240 | 3300046476 | Bacteria | 1119 |
| 215 | Ga0495664_0081816 | 3300046477 | Bacteria | 1936 |
| 216 | Ga0495664_0135846 | 3300046477 | Bacteria | 1490 |
| 217 | Ga0495585_0054230 | 3300046492 | Unclassified | 2217 |
| 218 | Ga0495607_0029532 | 3300046501 | Bacteria | 3373 |
| 219 | Ga0495608_0015258 | 3300046511 | Bacteria | 5331 |
| 220 | Ga0495608_0108827 | 3300046511 | Bacteria | 1782 |
| 221 | Ga0495608_0239354 | 3300046511 | Bacteria | 1134 |
| 222 | Ga0495618_0002917 | 3300046514 | Bacteria | 10836 |
| 223 | Ga0495618_0073221 | 3300046514 | Bacteria | 2181 |
| 224 | Ga0495618_0141829 | 3300046514 | Bacteria | 1536 |
| 225 | Ga0495628_0009335 | 3300046516 | Bacteria | 8374 |
| 226 | Ga0495628_0043661 | 3300046516 | Bacteria | 3569 |
| 227 | Ga0495630_0125584 | 3300046517 | Bacteria | 1947 |
| 228 | Ga0495630_0165541 | 3300046517 | Bacteria | 1683 |
| 229 | Ga0495644_0014215 | 3300046523 | Bacteria | 3049 |
| 230 | Ga0495652_0019819 | 3300046529 | Bacteria | 5985 |
| 231 | Ga0495652_0028593 | 3300046529 | Bacteria | 4903 |
| 232 | Ga0495652_0041380 | 3300046529 | Bacteria | 3978 |
| 233 | Ga0495652_0084315 | 3300046529 | Bacteria | 2613 |
| 234 | Ga0495652_0119778 | 3300046529 | Bacteria | 2101 |
| 235 | Ga0495652_0199302 | 3300046529 | Bacteria | 1520 |
| 236 | Ga0495665_0022972 | 3300046531 | Bacteria | 3349 |
| 237 | Ga0495586_0057955 | 3300046535 | Bacteria | 2102 |
| 238 | Ga0495587_0005987 | 3300046536 | Bacteria | 7928 |
| 239 | Ga0495645_0000103 | 3300046543 | Bacteria | 58974 |
| 240 | Ga0495645_0053673 | 3300046543 | Bacteria | 2929 |
| 241 | Ga0495667_0044839 | 3300046559 | Bacteria | 2928 |
| 242 | Ga0495667_0048503 | 3300046559 | Bacteria | 2804 |
| 243 | Ga0495667_0062952 | 3300046559 | Bacteria | 2430 |
| 244 | Ga0495634_0041895 | 3300046642 | Bacteria | 3108 |
| 245 | Ga0495635_0021443 | 3300046663 | Bacteria | 4502 |
| 246 | Ga0495635_0217315 | 3300046663 | Bacteria | 1294 |
| 247 | Ga0495599_0000934 | 3300046678 | Bacteria | 16326 |
| 248 | Ga0495599_0024905 | 3300046678 | Bacteria | 3742 |
| 249 | Ga0495623_0001101 | 3300046679 | Bacteria | 18274 |
| 250 | Ga0495646_0003300 | 3300046680 | Bacteria | 10047 |
| 251 | Ga0495647_0019396 | 3300046681 | Bacteria | 2431 |
| 252 | Ga0495647_0025276 | 3300046681 | Bacteria | 2169 |
| 253 | Ga0495647_0097527 | 3300046681 | Bacteria | 1213 |
| 254 | Ga0495613_0115315 | 3300046689 | Bacteria | 1933 |
| 255 | Ga0495613_0311332 | 3300046689 | Bacteria | 1088 |
| 256 | Ga0495624_0036795 | 3300046690 | Unclassified | 3153 |
| 257 | Ga0495624_0048266 | 3300046690 | Bacteria | 2703 |
| 258 | Ga0495600_0171708 | 3300046809 | Bacteria | 1399 |
| 259 | Ga0495604_0006850 | 3300047317 | Bacteria | 9029 |
| 260 | Ga0495604_0045972 | 3300047317 | Bacteria | 3405 |
| 261 | Ga0495674_0144851 | 3300047319 | Bacteria | 1995 |
| 262 | Ga0495674_0226701 | 3300047319 | Bacteria | 1543 |
| 263 | Ga0495674_0263338 | 3300047319 | Bacteria | 1416 |
| 264 | Ga0495676_0013688 | 3300047321 | Bacteria | 7278 |
| 265 | Ga0495676_0094832 | 3300047321 | Bacteria | 2222 |
| 266 | Ga0495676_0127332 | 3300047321 | Bacteria | 1844 |
| 267 | Ga0495680_0005889 | 3300047322 | Bacteria | 11467 |
| 268 | Ga0495680_0027700 | 3300047322 | Bacteria | 4651 |
| 269 | Ga0495680_0129618 | 3300047322 | Bacteria | 1855 |
| 270 | Ga0495675_0001253 | 3300047444 | Bacteria | 15376 |
| 271 | Ga0495684_0048043 | 3300047471 | Unclassified | 3263 |
| 272 | Ga0495593_0005910 | 3300047673 | Bacteria | 7208 |
| 273 | Ga0495602_0003272 | 3300048088 | Bacteria | 16735 |
| 274 | Ga0495602_0083053 | 3300048088 | Bacteria | 2685 |
| 275 | Ga0496100_0133650 | 3300048903 | Bacteria | 1750 |
| 276 | Ga0496101_0020826 | 3300048904 | Bacteria | 4498 |
| 277 | Ga0496101_0029308 | 3300048904 | Bacteria | 3849 |
| 278 | Ga0496101_0124499 | 3300048904 | Unclassified | 1952 |
| 279 | Ga0496102_0015167 | 3300048905 | Bacteria | 6707 |
| 280 | Ga0496103_0084387 | 3300048906 | Bacteria | 2001 |
| 281 | Ga0496103_0190254 | 3300048906 | Bacteria | 1319 |
| 282 | Ga0496104_0004776 | 3300048907 | Bacteria | 11799 |
| 283 | Ga0496104_0150023 | 3300048907 | Unclassified | 2238 |
| 284 | Ga0496104_0189926 | 3300048907 | Bacteria | 1965 |
| 285 | Ga0496105_0004781 | 3300048908 | Bacteria | 10224 |
| 286 | Ga0496105_0042399 | 3300048908 | Bacteria | 3751 |
| 287 | Ga0496105_0075237 | 3300048908 | Bacteria | 2789 |
| 288 | Ga0496105_0120788 | 3300048908 | Bacteria | 2160 |
| 289 | Ga0496106_0024689 | 3300048909 | Bacteria | 4470 |
| 290 | Ga0496107_0069877 | 3300048910 | Unclassified | 2549 |
| 291 | Ga0496107_0252744 | 3300048910 | Bacteria | 1311 |
| 292 | Ga0496107_0262315 | 3300048910 | Bacteria | 1285 |
| 293 | Ga0496108_0008759 | 3300048911 | Bacteria | 8202 |
| 294 | Ga0496108_0079451 | 3300048911 | Bacteria | 2777 |
| 295 | Ga0496108_0144330 | 3300048911 | Bacteria | 2051 |
| 296 | Ga0496109_0011297 | 3300048912 | Bacteria | 7669 |
| 297 | Ga0496109_0038021 | 3300048912 | Unclassified | 4350 |
| 298 | Ga0496109_0060623 | 3300048912 | Bacteria | 3457 |
| 299 | Ga0496111_0097506 | 3300048914 | Bacteria | 2158 |
| 300 | Ga0496111_0211951 | 3300048914 | Bacteria | 1439 |
| 301 | Ga0496112_0032605 | 3300048915 | Bacteria | 5059 |
| 302 | Ga0496112_0069257 | 3300048915 | Bacteria | 3485 |
| 303 | Ga0496112_0141280 | 3300048915 | Bacteria | 2377 |
| 304 | Ga0496112_0312834 | 3300048915 | Bacteria | 1515 |
| 305 | Ga0496113_0069682 | 3300048916 | Bacteria | 2671 |
| 306 | Ga0496113_0267351 | 3300048916 | Bacteria | 1366 |
| 307 | Ga0496114_0018392 | 3300048917 | Bacteria | 5650 |
| 308 | Ga0496114_0027339 | 3300048917 | Bacteria | 4672 |
| 309 | Ga0496114_0036926 | 3300048917 | Unclassified | 4039 |
| 310 | Ga0496115_0005506 | 3300048918 | Bacteria | 9215 |
| 311 | Ga0496115_0145291 | 3300048918 | Bacteria | 1957 |
| 312 | Ga0496115_0201867 | 3300048918 | Bacteria | 1642 |
| 313 | Ga0496115_0273819 | 3300048918 | Bacteria | 1386 |
| 314 | Ga0501067_0001144 | 3300049583 | Bacteria | 14395 |
| 315 | Ga0501067_0038921 | 3300049583 | Bacteria | 2640 |
| 316 | Ga0501069_0003298 | 3300049585 | Bacteria | 8280 |
| 317 | Ga0501069_0043258 | 3300049585 | Bacteria | 2492 |
| 318 | Ga0501070_0247174 | 3300049586 | Bacteria | 1460 |
| 319 | nmdc:mga05p37_20675_c1 | 3300050507 | Bacteria | 7965 |
| 320 | nmdc:mga05p37_33871_c1 | 3300050507 | Bacteria | 6257 |
| 321 | nmdc:mga06r32_23582_c1 | 3300050510 | Bacteria | 5696 |
| 322 | nmdc:mga0n895_122365_c1 | 3300050512 | Bacteria | 2624 |
| 323 | nmdc:mga0n895_123844_c1 | 3300050512 | Bacteria | 2608 |
| 324 | nmdc:mga0n895_42383_c1 | 3300050512 | Bacteria | 4428 |
| 325 | nmdc:mga0rr50_268274_c1 | 3300050513 | Bacteria | 1422 |
| 326 | nmdc:mga0rr50_270060_c1 | 3300050513 | Unclassified | 1417 |
| 327 | nmdc:mga0rr50_95626_c1 | 3300050513 | Bacteria | 2323 |
| 328 | nmdc:mga08x19_29746_c1 | 3300050514 | Bacteria | 3428 |
| 329 | nmdc:mga0a205_84458_c1 | 3300050515 | Bacteria | 3067 |
| 330 | Ga0495601_0002499 | 3300053077 | Bacteria | 10463 |
| 331 | Ga0495601_0133239 | 3300053077 | Bacteria | 1619 |
| 332 | Ga0495601_0200326 | 3300053077 | Bacteria | 1304 |
| 333 | Ga0495601_0218553 | 3300053077 | Bacteria | 1244 |
| 334 | Ga0495612_0011817 | 3300053078 | Bacteria | 3520 |
| 335 | Ga0495612_0020189 | 3300053078 | Bacteria | 2670 |
| 336 | Ga0495595_0067196 | 3300053084 | Bacteria | 1689 |
| 337 | Ga0495619_0155954 | 3300053085 | Bacteria | 1575 |
| 338 | Ga0500566_0150026 | 3300053094 | Unclassified | 1227 |
| 339 | Ga0466962_0005276 | 3300061719 | Bacteria | 6208 |
| 340 | Ga0466962_0012104 | 3300061719 | Bacteria | 4148 |
| 341 | Ga0466962_0014747 | 3300061719 | Bacteria | 3767 |
| 342 | Ga0466962_0050591 | 3300061719 | Bacteria | 1986 |
| 343 | Ga0530510_0025852 | 3300061734 | Bacteria | 4199 |
| 344 | Ga0070717_10105787 | |||
| 345 | rootH2_10226388 | |||
| 346 | Ga0070683_100092877 | |||
| 347 | Ga0070682_100281779 | |||
| 348 | Ga0068868_100384787 | |||
| 349 | Ga0070660_100024623 | |||
| 350 | Ga0070709_10043230 | |||
| 351 | Ga0070709_10053253 | |||
| 352 | Ga0070709_10244635 | |||
| 353 | Ga0070714_100012344 | |||
| 354 | Ga0070714_100106721 | |||
| 355 | Ga0070714_100109946 | |||
| 356 | Ga0070714_100150723 | |||
| 357 | Ga0070713_100092691 | |||
| 358 | Ga0070713_100127091 | |||
| 359 | Ga0070713_100378988 | |||
| 360 | Ga0070710_10028029 | |||
| 361 | Ga0070710_10071224 | |||
| 362 | Ga0070711_100132819 | |||
| 363 | Ga0070711_100156677 | |||
| 364 | Ga0070694_100091486 | |||
| 365 | Ga0070694_100132164 | |||
| 366 | Ga0070678_100016722 | |||
| 367 | Ga0070681_10107979 | |||
| 368 | Ga0070707_100001296 | |||
| 369 | Ga0070707_100015560 | |||
| 370 | Ga0070707_100454878 | |||
| 371 | Ga0070698_100019245 | |||
| 372 | Ga0070679_100186088 | |||
| 373 | Ga0070684_100016072 | |||
| 374 | Ga0070684_100143073 | |||
| 375 | Ga0070686_100135107 | |||
| 376 | Ga0070695_100010323 | |||
| 377 | Ga0070695_100116201 | |||
| 378 | Ga0070696_100096913 | |||
| 379 | Ga0070693_100023607 | |||
| 380 | Ga0068855_100386072 | |||
| 381 | Ga0070664_100045220 | |||
| 382 | Ga0068856_100305225 | |||
| 383 | Ga0068856_100365353 | |||
| 384 | Ga0068863_100271331 | |||
| 385 | Ga0070717_10003402 | |||
| 386 | Ga0070717_10036966 | |||
| 387 | Ga0070717_10264490 | |||
| 388 | Ga0070715_10003145 | |||
| 389 | Ga0070716_100201801 | |||
| 390 | Ga0070712_100013144 | |||
| 391 | Ga0070712_100190588 | |||
| 392 | Ga0070712_100270267 | |||
| 393 | Ga0070712_100432499 | |||
| 394 | Ga0075431_100041716 | |||
| 395 | Ga0075433_10009485 | |||
| 396 | Ga0075433_10019741 | |||
| 397 | Ga0075433_10075399 | |||
| 398 | Ga0075434_100003194 | |||
| 399 | Ga0075434_100263291 | |||
| 400 | Ga0075436_100001428 | |||
| 401 | Ga0075436_100008602 | |||
| 402 | Ga0075435_100006338 | |||
| 403 | Ga0105240_10012439 | |||
| 404 | Ga0105240_10375507 | |||
| 405 | Ga0105245_10106552 | |||
| 406 | Ga0105245_10206367 | |||
| 407 | Ga0114129_10021583 | |||
| 408 | Ga0114129_10032700 | |||
| 409 | Ga0105243_10067568 | |||
| 410 | Ga0105242_10126199 | |||
| 411 | Ga0105242_10343235 | |||
| 412 | Ga0105248_10026241 | |||
| 413 | Ga0105237_10232722 | |||
| 414 | Ga0157370_10397282 | |||
| 415 | Ga0157369_10238542 | |||
| 416 | Ga0157372_10028464 | |||
| 417 | Ga0157377_10235022 | |||
| 418 | Ga0157379_10468973 | |||
| 419 | Ga0157376_10021908 | |||
| 420 | Ga0207653_10005366 | |||
| 421 | Ga0207692_10050636 | |||
| 422 | Ga0207685_10020075 | |||
| 423 | Ga0207685_10087872 | |||
| 424 | Ga0207699_10115514 | |||
| 425 | Ga0207684_10169365 | |||
| 426 | Ga0207684_10316846 | |||
| 427 | Ga0207654_10061164 | |||
| 428 | Ga0207707_10130119 | |||
| 429 | Ga0207695_10032733 | |||
| 430 | Ga0207693_10000867 | |||
| 431 | Ga0207693_10002862 | |||
| 432 | Ga0207693_10005534 | |||
| 433 | Ga0207693_10033578 | |||
| 434 | Ga0207693_10286067 | |||
| 435 | Ga0207693_10295473 | |||
| 436 | Ga0207663_10028812 | |||
| 437 | Ga0207660_10013656 | |||
| 438 | Ga0207657_10001757 | |||
| 439 | Ga0207652_10114620 | |||
| 440 | Ga0207646_10001221 | |||
| 441 | Ga0207700_10039259 | |||
| 442 | Ga0207700_10131408 | |||
| 443 | Ga0207700_10182274 | |||
| 444 | Ga0207700_10303831 | |||
| 445 | Ga0207664_10026734 | |||
| 446 | Ga0207664_10048299 | |||
| 447 | Ga0207664_10058983 | |||
| 448 | Ga0207664_10152151 | |||
| 449 | Ga0207665_10000490 | |||
| 450 | Ga0207665_10017001 | |||
| 451 | Ga0207665_10019175 | |||
| 452 | Ga0207661_10139596 | |||
| 453 | Ga0207661_10174224 | |||
| 454 | Ga0207667_10297741 | |||
| 455 | Ga0207677_10105425 | |||
| 456 | Ga0207702_10130517 | |||
| 457 | Ga0207676_10247867 | |||
| 458 | Ga0207428_10027184 | |||
| 459 | Ga0265336_10014239 | |||
| 460 | Ga0265338_10000634 | |||
| 461 | Ga0265338_10009865 | |||
| 462 | Ga0265338_10207417 | |||
| 463 | Ga0373948_0007402 | |||
| 464 | Ga0373958_0013373 | |||
| 465 | Ga0373929_0044292 | |||
| 466 | Ga0373940_0006652 | |||
| 467 | Ga0373952_0007842 | |||
| 468 | Ga0373945_0009593 | |||
| 469 | Ga0373961_0003134 | |||
| 470 | Ga0373931_0008068 | |||
| 471 | Ga0373947_0007867 | |||
| 472 | Ga0373937_0007877 | |||
| 473 | Ga0373925_0002672 | |||
| 474 | Ga0395900_0066849 | |||
| 475 | Ga0395900_0148091 | |||
| 476 | Ga0395898_0097399 | |||
| 477 | Ga0395898_0229191 | |||
| 478 | Ga0395905_0275786 | |||
| 479 | Ga0395901_0052167 | |||
| 480 | Ga0466969_0002679 | |||
| 481 | Ga0466972_0039640 | |||
| 482 | Ga0466965_0038467 | |||
| 483 | Ga0466965_0038927 | |||
| 484 | Ga0466965_0096197 | |||
| 485 | Ga0466966_0041375 | |||
| 486 | Ga0466961_0002794 | |||
| 487 | Ga0466961_0026003 | |||
| 488 | Ga0466961_0250993 | |||
| 489 | Ga0466963_0000189 | |||
| 490 | Ga0466963_0000997 | |||
| 491 | Ga0466963_0006341 | |||
| 492 | Ga0466963_0006447 | |||
| 493 | Ga0466963_0007750 | |||
| 494 | Ga0466963_0008197 | |||
| 495 | Ga0466963_0025182 | |||
| 496 | Ga0466963_0032904 | |||
| 497 | Ga0466963_0044409 | |||
| 498 | Ga0466963_0079494 | |||
| 499 | Ga0466963_0120958 | |||
| 500 | Ga0466964_0002642 | |||
| 501 | Ga0466964_0003844 | |||
| 502 | Ga0466964_0013619 | |||
| 503 | Ga0466964_0023029 | |||
| 504 | Ga0466964_0027281 | |||
| 505 | Ga0466964_0028101 | |||
| 506 | Ga0466964_0033501 | |||
| 507 | Ga0466964_0112437 | |||
| 508 | Ga0466971_0005051 | |||
| 509 | Ga0466968_0007477 | |||
| 510 | Ga0466968_0021429 | |||
| 511 | Ga0466968_0075710 | |||
| 512 | Ga0466970_0040190 | |||
| 513 | Ga0466957_0008650 | |||
| 514 | Ga0466957_0015017 | |||
| 515 | Ga0466957_0044460 | |||
| 516 | Ga0466957_0049407 | |||
| 517 | Ga0466957_0076955 | |||
| 518 | Ga0466957_0201882 | |||
| 519 | Ga0466957_0237586 | |||
| 520 | Ga0466960_0002376 | |||
| 521 | Ga0466960_0016298 | |||
| 522 | Ga0466960_0107413 | |||
| 523 | Ga0466959_0008552 | |||
| 524 | Ga0466959_0056073 | |||
| 525 | Ga0466958_0001083 | |||
| 526 | Ga0466958_0003928 | |||
| 527 | Ga0466958_0011610 | |||
| 528 | Ga0466958_0012546 | |||
| 529 | Ga0466958_0027264 | |||
| 530 | Ga0466958_0057212 | |||
| 531 | Ga0466958_0068808 | |||
| 532 | Ga0466967_0017166 | |||
| 533 | Ga0466967_0019743 | |||
| 534 | Ga0466967_0024108 | |||
| 535 | Ga0466967_0030883 | |||
| 536 | Ga0466967_0079173 | |||
| 537 | Ga0466967_0107349 | |||
| 538 | Ga0466967_0164544 | |||
| 539 | Ga0466967_0179082 | |||
| 540 | Ga0466967_0179274 | |||
| 541 | Ga0466967_0223186 | |||
| 542 | Ga0466967_0361517 | |||
| 543 | Ga0466967_0381031 | |||
| 544 | Ga0495592_0002063 | |||
| 545 | Ga0495592_0090339 | |||
| 546 | Ga0495592_0098999 | |||
| 547 | Ga0495592_0129557 | |||
| 548 | Ga0495629_0069900 | |||
| 549 | Ga0495629_0079665 | |||
| 550 | Ga0495629_0204628 | |||
| 551 | Ga0495641_0049937 | |||
| 552 | Ga0495651_0011043 | |||
| 553 | Ga0495651_0046559 | |||
| 554 | Ga0495653_0008537 | |||
| 555 | Ga0495582_0009735 | |||
| 556 | Ga0495639_0002608 | |||
| 557 | Ga0495662_0157240 | |||
| 558 | Ga0495664_0081816 | |||
| 559 | Ga0495664_0135846 | |||
| 560 | Ga0495585_0054230 | |||
| 561 | Ga0495607_0029532 | |||
| 562 | Ga0495608_0015258 | |||
| 563 | Ga0495608_0108827 | |||
| 564 | Ga0495608_0239354 | |||
| 565 | Ga0495618_0002917 | |||
| 566 | Ga0495618_0073221 | |||
| 567 | Ga0495618_0141829 | |||
| 568 | Ga0495628_0009335 | |||
| 569 | Ga0495628_0043661 | |||
| 570 | Ga0495630_0125584 | |||
| 571 | Ga0495630_0165541 | |||
| 572 | Ga0495644_0014215 | |||
| 573 | Ga0495652_0019819 | |||
| 574 | Ga0495652_0028593 | |||
| 575 | Ga0495652_0041380 | |||
| 576 | Ga0495652_0084315 | |||
| 577 | Ga0495652_0119778 | |||
| 578 | Ga0495652_0199302 | |||
| 579 | Ga0495665_0022972 | |||
| 580 | Ga0495586_0057955 | |||
| 581 | Ga0495587_0005987 | |||
| 582 | Ga0495645_0000103 | |||
| 583 | Ga0495645_0053673 | |||
| 584 | Ga0495667_0044839 | |||
| 585 | Ga0495667_0048503 | |||
| 586 | Ga0495667_0062952 | |||
| 587 | Ga0495634_0041895 | |||
| 588 | Ga0495635_0021443 | |||
| 589 | Ga0495635_0217315 | |||
| 590 | Ga0495599_0000934 | |||
| 591 | Ga0495599_0024905 | |||
| 592 | Ga0495623_0001101 | |||
| 593 | Ga0495646_0003300 | |||
| 594 | Ga0495647_0019396 | |||
| 595 | Ga0495647_0025276 | |||
| 596 | Ga0495647_0097527 | |||
| 597 | Ga0495613_0115315 | |||
| 598 | Ga0495613_0311332 | |||
| 599 | Ga0495624_0036795 | |||
| 600 | Ga0495624_0048266 | |||
| 601 | Ga0495600_0171708 | |||
| 602 | Ga0495604_0006850 | |||
| 603 | Ga0495604_0045972 | |||
| 604 | Ga0495674_0144851 | |||
| 605 | Ga0495674_0226701 | |||
| 606 | Ga0495674_0263338 | |||
| 607 | Ga0495676_0013688 | |||
| 608 | Ga0495676_0094832 | |||
| 609 | Ga0495676_0127332 | |||
| 610 | Ga0495680_0005889 | |||
| 611 | Ga0495680_0027700 | |||
| 612 | Ga0495680_0129618 | |||
| 613 | Ga0495675_0001253 | |||
| 614 | Ga0495684_0048043 | |||
| 615 | Ga0495593_0005910 | |||
| 616 | Ga0495602_0003272 | |||
| 617 | Ga0495602_0083053 | |||
| 618 | Ga0496100_0133650 | |||
| 619 | Ga0496101_0020826 | |||
| 620 | Ga0496101_0029308 | |||
| 621 | Ga0496101_0124499 | |||
| 622 | Ga0496102_0015167 | |||
| 623 | Ga0496103_0084387 | |||
| 624 | Ga0496103_0190254 | |||
| 625 | Ga0496104_0004776 | |||
| 626 | Ga0496104_0150023 | |||
| 627 | Ga0496104_0189926 | |||
| 628 | Ga0496105_0004781 | |||
| 629 | Ga0496105_0042399 | |||
| 630 | Ga0496105_0075237 | |||
| 631 | Ga0496105_0120788 | |||
| 632 | Ga0496106_0024689 | |||
| 633 | Ga0496107_0069877 | |||
| 634 | Ga0496107_0252744 | |||
| 635 | Ga0496107_0262315 | |||
| 636 | Ga0496108_0008759 | |||
| 637 | Ga0496108_0079451 | |||
| 638 | Ga0496108_0144330 | |||
| 639 | Ga0496109_0011297 | |||
| 640 | Ga0496109_0038021 | |||
| 641 | Ga0496109_0060623 | |||
| 642 | Ga0496111_0097506 | |||
| 643 | Ga0496111_0211951 | |||
| 644 | Ga0496112_0032605 | |||
| 645 | Ga0496112_0069257 | |||
| 646 | Ga0496112_0141280 | |||
| 647 | Ga0496112_0312834 | |||
| 648 | Ga0496113_0069682 | |||
| 649 | Ga0496113_0267351 | |||
| 650 | Ga0496114_0018392 | |||
| 651 | Ga0496114_0027339 | |||
| 652 | Ga0496114_0036926 | |||
| 653 | Ga0496115_0005506 | |||
| 654 | Ga0496115_0145291 | |||
| 655 | Ga0496115_0201867 | |||
| 656 | Ga0496115_0273819 | |||
| 657 | Ga0501067_0001144 | |||
| 658 | Ga0501067_0038921 | |||
| 659 | Ga0501069_0003298 | |||
| 660 | Ga0501069_0043258 | |||
| 661 | Ga0501070_0247174 | |||
| 662 | nmdc:mga05p37_20675_c1 | |||
| 663 | nmdc:mga05p37_33871_c1 | |||
| 664 | nmdc:mga06r32_23582_c1 | |||
| 665 | nmdc:mga0n895_122365_c1 | |||
| 666 | nmdc:mga0n895_123844_c1 | |||
| 667 | nmdc:mga0n895_42383_c1 | |||
| 668 | nmdc:mga0rr50_268274_c1 | |||
| 669 | nmdc:mga0rr50_270060_c1 | |||
| 670 | nmdc:mga0rr50_95626_c1 | |||
| 671 | nmdc:mga08x19_29746_c1 | |||
| 672 | nmdc:mga0a205_84458_c1 | |||
| 673 | Ga0495601_0002499 | |||
| 674 | Ga0495601_0133239 | |||
| 675 | Ga0495601_0200326 | |||
| 676 | Ga0495601_0218553 | |||
| 677 | Ga0495612_0011817 | |||
| 678 | Ga0495612_0020189 | |||
| 679 | Ga0495595_0067196 | |||
| 680 | Ga0495619_0155954 | |||
| 681 | Ga0500566_0150026 | |||
| 682 | Ga0466962_0005276 | |||
| 683 | Ga0466962_0012104 | |||
| 684 | Ga0466962_0014747 | |||
| 685 | Ga0466962_0050591 | |||
| 686 | Ga0530510_0025852 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kpp-assembly1.cif.gz_A | crystal structure of h+/ca2+ exchanger cax | 0.7525 | 6 | 296 |
| 4kpp-assembly2.cif.gz_B | crystal structure of h+/ca2+ exchanger cax | 0.7361 | 6 | 296 |
| 4kpp-assembly1.cif.gz_A | crystal structure of h+/ca2+ exchanger cax | 0.718 | 6 | 296 |
| 4kjs-assembly2.cif.gz_B | structure of native yfke | 0.7133 | 10 | 299 |
| 4kpp-assembly2.cif.gz_B | crystal structure of h+/ca2+ exchanger cax | 0.7022 | 6 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45394_41_312_1.20.1420.30 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region | 0.7638 | 45 | 296 | 1.20.1420.30 |
| af_Q769E5_118_423_1.20.1420.30 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region | 0.7268 | 43 | 299 | 1.20.1420.30 |
| af_C6KSN3_150_437_1.20.1420.30 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region | 0.713 | 43 | 300 | 1.20.1420.30 |
| af_P45394_41_312_1.20.1420.30 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region | 0.7113 | 45 | 296 | 1.20.1420.30 |
| af_P42839_561_901_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6978 | 45 | 299 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538MRK9-F1-model_v4 | Sodium/calcium exchanger membrane region domain-containing protein | 0.901 | 3 | 303 |
GO:0005262
GO:0005886 GO:0006874 GO:0008273 |
| AF-A0A538GMP3-F1-model_v4 | Sodium/calcium exchanger membrane region domain-containing protein | 0.8904 | 2 | 306 |
GO:0005262
GO:0005886 GO:0006874 GO:0008273 |
| AF-A0A538GMP3-F1-model_v4 | Sodium/calcium exchanger membrane region domain-containing protein | 0.885 | 2 | 306 |
GO:0005262
GO:0005886 GO:0006874 GO:0008273 |
| AF-A0A538MRK9-F1-model_v4 | Sodium/calcium exchanger membrane region domain-containing protein | 0.8839 | 3 | 303 |
GO:0005262
GO:0005886 GO:0006874 GO:0008273 |
| AF-A0A358QLK9-F1-model_v4 | Sodium/calcium exchanger membrane region domain-containing protein | 0.8671 | 1 | 306 |
GO:0005262
GO:0005886 GO:0006874 GO:0008273 |