F415505

General Info

Members Datasets Scaffolds Average Seq Length
343 172 686 311

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10105787|Ga0070717_101057874
Length 333
Sequence MTPAAAIPLFVASIALMLVASAVFAGRLDRIGQRLGLPEALLGLLTALAADAPEISSAIAALVQHEHAVAVGVVVGSNAFNLAAMLGISAVVAGQVRARHETLELEAFVGLWLLAVMLAVAAGRLGATVGAVLAAAVVVPYVALLAAGPRLARRLPLDAAGARFVHRSFGEAHRRARPLDSRREAVGAAFVLLLALCLIVAGSVGAVRAATDLAQAWSVPDALVGVVVLAVLTSLPNAWTGVRFGLQGRGSALTSETLNSNSINIVAGLVVPAALGALVAFPGLAVFDLAWLVGMTTAALVLFGKRAGGGRAAGTLLIVLYAVFLAVQFAKLA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
74 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
75 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 11.37
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 11.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10105787 3300006028 Bacteria 2395
2 rootH2_10226388 3300003320 Bacteria 2986
3 Ga0070683_100092877 3300005329 Bacteria 2834
4 Ga0070682_100281779 3300005337 Unclassified 1212
5 Ga0068868_100384787 3300005338 Bacteria 1208
6 Ga0070660_100024623 3300005339 Bacteria 4465
7 Ga0070709_10043230 3300005434 Bacteria 2785
8 Ga0070709_10053253 3300005434 Bacteria 2547
9 Ga0070709_10244635 3300005434 Unclassified 1289
10 Ga0070714_100012344 3300005435 Bacteria 6819
11 Ga0070714_100106721 3300005435 Bacteria 2474
12 Ga0070714_100109946 3300005435 Bacteria 2439
13 Ga0070714_100150723 3300005435 Unclassified 2095
14 Ga0070713_100092691 3300005436 Bacteria 2601
15 Ga0070713_100127091 3300005436 Bacteria 2244
16 Ga0070713_100378988 3300005436 Unclassified 1318
17 Ga0070710_10028029 3300005437 Bacteria 3009
18 Ga0070710_10071224 3300005437 Bacteria 2004
19 Ga0070711_100132819 3300005439 Bacteria 1856
20 Ga0070711_100156677 3300005439 Unclassified 1723
21 Ga0070694_100091486 3300005444 Bacteria 2135
22 Ga0070694_100132164 3300005444 Bacteria 1804
23 Ga0070678_100016722 3300005456 Bacteria 4701
24 Ga0070681_10107979 3300005458 Bacteria 2723
25 Ga0070707_100001296 3300005468 Bacteria 24594
26 Ga0070707_100015560 3300005468 Bacteria 7138
27 Ga0070707_100454878 3300005468 Bacteria 1241
28 Ga0070698_100019245 3300005471 Bacteria 7173
29 Ga0070679_100186088 3300005530 Bacteria 2047
30 Ga0070684_100016072 3300005535 Bacteria 6112
31 Ga0070684_100143073 3300005535 Unclassified 2164
32 Ga0070686_100135107 3300005544 Bacteria 1710
33 Ga0070695_100010323 3300005545 Bacteria 5574
34 Ga0070695_100116201 3300005545 Bacteria 1824
35 Ga0070696_100096913 3300005546 Bacteria 2108
36 Ga0070693_100023607 3300005547 Bacteria 3289
37 Ga0068855_100386072 3300005563 Bacteria 1537
38 Ga0070664_100045220 3300005564 Bacteria 3718
39 Ga0068856_100305225 3300005614 Bacteria 1609
40 Ga0068856_100365353 3300005614 Bacteria 1462
41 Ga0068863_100271331 3300005841 Bacteria 1642
42 Ga0070717_10003402 3300006028 Bacteria 11383
43 Ga0070717_10036966 3300006028 Bacteria 3963
44 Ga0070717_10264490 3300006028 Bacteria 1522
45 Ga0070715_10003145 3300006163 Bacteria 5192
46 Ga0070716_100201801 3300006173 Unclassified 1322
47 Ga0070712_100013144 3300006175 Bacteria 5281
48 Ga0070712_100190588 3300006175 Bacteria 1604
49 Ga0070712_100270267 3300006175 Bacteria 1365
50 Ga0070712_100432499 3300006175 Bacteria 1093
51 Ga0075431_100041716 3300006847 Bacteria 4732
52 Ga0075433_10009485 3300006852 Bacteria 7779
53 Ga0075433_10019741 3300006852 Bacteria 5623
54 Ga0075433_10075399 3300006852 Bacteria 2968
55 Ga0075434_100003194 3300006871 Bacteria 14611
56 Ga0075434_100263291 3300006871 Bacteria 1743
57 Ga0075436_100001428 3300006914 Bacteria 16229
58 Ga0075436_100008602 3300006914 Bacteria 6976
59 Ga0075435_100006338 3300007076 Bacteria 8359
60 Ga0105240_10012439 3300009093 Bacteria 11747
61 Ga0105240_10375507 3300009093 Unclassified 1607
62 Ga0105245_10106552 3300009098 Unclassified 2601
63 Ga0105245_10206367 3300009098 Bacteria 1889
64 Ga0114129_10021583 3300009147 Bacteria 9140
65 Ga0114129_10032700 3300009147 Bacteria 7349
66 Ga0105243_10067568 3300009148 Bacteria 2878
67 Ga0105242_10126199 3300009176 Bacteria 2203
68 Ga0105242_10343235 3300009176 Bacteria 1377
69 Ga0105248_10026241 3300009177 Bacteria 6483
70 Ga0105237_10232722 3300009545 Bacteria 1843
71 Ga0157370_10397282 3300013104 Unclassified 1269
72 Ga0157369_10238542 3300013105 Bacteria 1899
73 Ga0157372_10028464 3300013307 Bacteria 6098
74 Ga0157377_10235022 3300014745 Bacteria 1180
75 Ga0157379_10468973 3300014968 Unclassified 1164
76 Ga0157376_10021908 3300014969 Unclassified 4970
77 Ga0207653_10005366 3300025885 Bacteria 4006
78 Ga0207692_10050636 3300025898 Bacteria 2102
79 Ga0207685_10020075 3300025905 Unclassified 2214
80 Ga0207685_10087872 3300025905 Bacteria 1302
81 Ga0207699_10115514 3300025906 Unclassified 1727
82 Ga0207684_10169365 3300025910 Bacteria 1883
83 Ga0207684_10316846 3300025910 Bacteria 1344
84 Ga0207654_10061164 3300025911 Bacteria 2202
85 Ga0207707_10130119 3300025912 Bacteria 2202
86 Ga0207695_10032733 3300025913 Bacteria 5685
87 Ga0207693_10000867 3300025915 Bacteria 27046
88 Ga0207693_10002862 3300025915 Bacteria 14949
89 Ga0207693_10005534 3300025915 Bacteria 10508
90 Ga0207693_10033578 3300025915 Bacteria 4048
91 Ga0207693_10286067 3300025915 Unclassified 1292
92 Ga0207693_10295473 3300025915 Bacteria 1269
93 Ga0207663_10028812 3300025916 Bacteria 3255
94 Ga0207660_10013656 3300025917 Bacteria 5325
95 Ga0207657_10001757 3300025919 Bacteria 23391
96 Ga0207652_10114620 3300025921 Bacteria 2393
97 Ga0207646_10001221 3300025922 Bacteria 32278
98 Ga0207700_10039259 3300025928 Bacteria 3444
99 Ga0207700_10131408 3300025928 Bacteria 2044
100 Ga0207700_10182274 3300025928 Unclassified 1759
101 Ga0207700_10303831 3300025928 Bacteria 1379
102 Ga0207664_10026734 3300025929 Bacteria 4364
103 Ga0207664_10048299 3300025929 Bacteria 3346
104 Ga0207664_10058983 3300025929 Bacteria 3055
105 Ga0207664_10152151 3300025929 Bacteria 1966
106 Ga0207665_10000490 3300025939 Bacteria 26757
107 Ga0207665_10017001 3300025939 Bacteria 4778
108 Ga0207665_10019175 3300025939 Bacteria 4495
109 Ga0207661_10139596 3300025944 Bacteria 2084
110 Ga0207661_10174224 3300025944 Unclassified 1875
111 Ga0207667_10297741 3300025949 Unclassified 1648
112 Ga0207677_10105425 3300026023 Bacteria 2086
113 Ga0207702_10130517 3300026078 Unclassified 2261
114 Ga0207676_10247867 3300026095 Bacteria 1602
115 Ga0207428_10027184 3300027907 Bacteria 4765
116 Ga0265336_10014239 3300028666 Bacteria 2638
117 Ga0265338_10000634 3300028800 Bacteria 60990
118 Ga0265338_10009865 3300028800 Bacteria 11306
119 Ga0265338_10207417 3300028800 Bacteria 1473
120 Ga0373948_0007402 3300034817 Bacteria 1845
121 Ga0373958_0013373 3300034819 Bacteria 1421
122 Ga0373929_0044292 3300035085 Bacteria 999
123 Ga0373940_0006652 3300035088 Bacteria 2577
124 Ga0373952_0007842 3300035092 Bacteria 2011
125 Ga0373945_0009593 3300035116 Bacteria 3174
126 Ga0373961_0003134 3300035241 Bacteria 4132
127 Ga0373931_0008068 3300035691 Bacteria 4983
128 Ga0373947_0007867 3300035725 Bacteria 6155
129 Ga0373937_0007877 3300036401 Bacteria 9236
130 Ga0373925_0002672 3300037068 Bacteria 14141
131 Ga0395900_0066849 3300037418 Unclassified 3694
132 Ga0395900_0148091 3300037418 Bacteria 2400
133 Ga0395898_0097399 3300037466 Bacteria 2825
134 Ga0395898_0229191 3300037466 Bacteria 1772
135 Ga0395905_0275786 3300037471 Bacteria 1567
136 Ga0395901_0052167 3300038443 Bacteria 4251
137 Ga0466969_0002679 3300044656 Bacteria 9515
138 Ga0466972_0039640 3300044658 Bacteria 2298
139 Ga0466965_0038467 3300044683 Bacteria 2350
140 Ga0466965_0038927 3300044683 Bacteria 2336
141 Ga0466965_0096197 3300044683 Bacteria 1511
142 Ga0466966_0041375 3300044684 Bacteria 2961
143 Ga0466961_0002794 3300044693 Bacteria 10856
144 Ga0466961_0026003 3300044693 Unclassified 3763
145 Ga0466961_0250993 3300044693 Bacteria 1086
146 Ga0466963_0000189 3300044694 Bacteria 25856
147 Ga0466963_0000997 3300044694 Bacteria 14602
148 Ga0466963_0006341 3300044694 Bacteria 6993
149 Ga0466963_0006447 3300044694 Bacteria 6940
150 Ga0466963_0007750 3300044694 Bacteria 6418
151 Ga0466963_0008197 3300044694 Bacteria 6261
152 Ga0466963_0025182 3300044694 Bacteria 3792
153 Ga0466963_0032904 3300044694 Bacteria 3361
154 Ga0466963_0044409 3300044694 Bacteria 2925
155 Ga0466963_0079494 3300044694 Bacteria 2218
156 Ga0466963_0120958 3300044694 Bacteria 1802
157 Ga0466964_0002642 3300044706 Bacteria 6418
158 Ga0466964_0003844 3300044706 Bacteria 5511
159 Ga0466964_0013619 3300044706 Bacteria 3085
160 Ga0466964_0023029 3300044706 Bacteria 2419
161 Ga0466964_0027281 3300044706 Bacteria 2242
162 Ga0466964_0028101 3300044706 Bacteria 2214
163 Ga0466964_0033501 3300044706 Bacteria 2047
164 Ga0466964_0112437 3300044706 Unclassified 1216
165 Ga0466971_0005051 3300044719 Bacteria 5713
166 Ga0466968_0007477 3300044735 Bacteria 4155
167 Ga0466968_0021429 3300044735 Bacteria 2618
168 Ga0466968_0075710 3300044735 Bacteria 1472
169 Ga0466970_0040190 3300044765 Bacteria 2484
170 Ga0466957_0008650 3300044842 Bacteria 5796
171 Ga0466957_0015017 3300044842 Bacteria 4517
172 Ga0466957_0044460 3300044842 Bacteria 2691
173 Ga0466957_0049407 3300044842 Bacteria 2558
174 Ga0466957_0076955 3300044842 Bacteria 2072
175 Ga0466957_0201882 3300044842 Unclassified 1306
176 Ga0466957_0237586 3300044842 Unclassified 1208
177 Ga0466960_0002376 3300044901 Bacteria 7080
178 Ga0466960_0016298 3300044901 Bacteria 3220
179 Ga0466960_0107413 3300044901 Unclassified 1445
180 Ga0466959_0008552 3300045049 Bacteria 7243
181 Ga0466959_0056073 3300045049 Bacteria 2875
182 Ga0466958_0001083 3300045836 Bacteria 12522
183 Ga0466958_0003928 3300045836 Bacteria 7792
184 Ga0466958_0011610 3300045836 Bacteria 4964
185 Ga0466958_0012546 3300045836 Bacteria 4803
186 Ga0466958_0027264 3300045836 Bacteria 3381
187 Ga0466958_0057212 3300045836 Bacteria 2370
188 Ga0466958_0068808 3300045836 Bacteria 2164
189 Ga0466967_0017166 3300045976 Bacteria 5736
190 Ga0466967_0019743 3300045976 Bacteria 5426
191 Ga0466967_0024108 3300045976 Bacteria 4997
192 Ga0466967_0030883 3300045976 Bacteria 4501
193 Ga0466967_0079173 3300045976 Bacteria 2962
194 Ga0466967_0107349 3300045976 Bacteria 2560
195 Ga0466967_0164544 3300045976 Bacteria 2084
196 Ga0466967_0179082 3300045976 Bacteria 1998
197 Ga0466967_0179274 3300045976 Bacteria 1997
198 Ga0466967_0223186 3300045976 Bacteria 1791
199 Ga0466967_0361517 3300045976 Bacteria 1406
200 Ga0466967_0381031 3300045976 Unclassified 1369
201 Ga0495592_0002063 3300046454 Bacteria 14153
202 Ga0495592_0090339 3300046454 Bacteria 2197
203 Ga0495592_0098999 3300046454 Unclassified 2080
204 Ga0495592_0129557 3300046454 Bacteria 1766
205 Ga0495629_0069900 3300046459 Unclassified 2450
206 Ga0495629_0079665 3300046459 Bacteria 2287
207 Ga0495629_0204628 3300046459 Bacteria 1364
208 Ga0495641_0049937 3300046461 Bacteria 1913
209 Ga0495651_0011043 3300046462 Bacteria 6951
210 Ga0495651_0046559 3300046462 Bacteria 3356
211 Ga0495653_0008537 3300046463 Bacteria 8403
212 Ga0495582_0009735 3300046473 Bacteria 5293
213 Ga0495639_0002608 3300046475 Bacteria 7845
214 Ga0495662_0157240 3300046476 Bacteria 1119
215 Ga0495664_0081816 3300046477 Bacteria 1936
216 Ga0495664_0135846 3300046477 Bacteria 1490
217 Ga0495585_0054230 3300046492 Unclassified 2217
218 Ga0495607_0029532 3300046501 Bacteria 3373
219 Ga0495608_0015258 3300046511 Bacteria 5331
220 Ga0495608_0108827 3300046511 Bacteria 1782
221 Ga0495608_0239354 3300046511 Bacteria 1134
222 Ga0495618_0002917 3300046514 Bacteria 10836
223 Ga0495618_0073221 3300046514 Bacteria 2181
224 Ga0495618_0141829 3300046514 Bacteria 1536
225 Ga0495628_0009335 3300046516 Bacteria 8374
226 Ga0495628_0043661 3300046516 Bacteria 3569
227 Ga0495630_0125584 3300046517 Bacteria 1947
228 Ga0495630_0165541 3300046517 Bacteria 1683
229 Ga0495644_0014215 3300046523 Bacteria 3049
230 Ga0495652_0019819 3300046529 Bacteria 5985
231 Ga0495652_0028593 3300046529 Bacteria 4903
232 Ga0495652_0041380 3300046529 Bacteria 3978
233 Ga0495652_0084315 3300046529 Bacteria 2613
234 Ga0495652_0119778 3300046529 Bacteria 2101
235 Ga0495652_0199302 3300046529 Bacteria 1520
236 Ga0495665_0022972 3300046531 Bacteria 3349
237 Ga0495586_0057955 3300046535 Bacteria 2102
238 Ga0495587_0005987 3300046536 Bacteria 7928
239 Ga0495645_0000103 3300046543 Bacteria 58974
240 Ga0495645_0053673 3300046543 Bacteria 2929
241 Ga0495667_0044839 3300046559 Bacteria 2928
242 Ga0495667_0048503 3300046559 Bacteria 2804
243 Ga0495667_0062952 3300046559 Bacteria 2430
244 Ga0495634_0041895 3300046642 Bacteria 3108
245 Ga0495635_0021443 3300046663 Bacteria 4502
246 Ga0495635_0217315 3300046663 Bacteria 1294
247 Ga0495599_0000934 3300046678 Bacteria 16326
248 Ga0495599_0024905 3300046678 Bacteria 3742
249 Ga0495623_0001101 3300046679 Bacteria 18274
250 Ga0495646_0003300 3300046680 Bacteria 10047
251 Ga0495647_0019396 3300046681 Bacteria 2431
252 Ga0495647_0025276 3300046681 Bacteria 2169
253 Ga0495647_0097527 3300046681 Bacteria 1213
254 Ga0495613_0115315 3300046689 Bacteria 1933
255 Ga0495613_0311332 3300046689 Bacteria 1088
256 Ga0495624_0036795 3300046690 Unclassified 3153
257 Ga0495624_0048266 3300046690 Bacteria 2703
258 Ga0495600_0171708 3300046809 Bacteria 1399
259 Ga0495604_0006850 3300047317 Bacteria 9029
260 Ga0495604_0045972 3300047317 Bacteria 3405
261 Ga0495674_0144851 3300047319 Bacteria 1995
262 Ga0495674_0226701 3300047319 Bacteria 1543
263 Ga0495674_0263338 3300047319 Bacteria 1416
264 Ga0495676_0013688 3300047321 Bacteria 7278
265 Ga0495676_0094832 3300047321 Bacteria 2222
266 Ga0495676_0127332 3300047321 Bacteria 1844
267 Ga0495680_0005889 3300047322 Bacteria 11467
268 Ga0495680_0027700 3300047322 Bacteria 4651
269 Ga0495680_0129618 3300047322 Bacteria 1855
270 Ga0495675_0001253 3300047444 Bacteria 15376
271 Ga0495684_0048043 3300047471 Unclassified 3263
272 Ga0495593_0005910 3300047673 Bacteria 7208
273 Ga0495602_0003272 3300048088 Bacteria 16735
274 Ga0495602_0083053 3300048088 Bacteria 2685
275 Ga0496100_0133650 3300048903 Bacteria 1750
276 Ga0496101_0020826 3300048904 Bacteria 4498
277 Ga0496101_0029308 3300048904 Bacteria 3849
278 Ga0496101_0124499 3300048904 Unclassified 1952
279 Ga0496102_0015167 3300048905 Bacteria 6707
280 Ga0496103_0084387 3300048906 Bacteria 2001
281 Ga0496103_0190254 3300048906 Bacteria 1319
282 Ga0496104_0004776 3300048907 Bacteria 11799
283 Ga0496104_0150023 3300048907 Unclassified 2238
284 Ga0496104_0189926 3300048907 Bacteria 1965
285 Ga0496105_0004781 3300048908 Bacteria 10224
286 Ga0496105_0042399 3300048908 Bacteria 3751
287 Ga0496105_0075237 3300048908 Bacteria 2789
288 Ga0496105_0120788 3300048908 Bacteria 2160
289 Ga0496106_0024689 3300048909 Bacteria 4470
290 Ga0496107_0069877 3300048910 Unclassified 2549
291 Ga0496107_0252744 3300048910 Bacteria 1311
292 Ga0496107_0262315 3300048910 Bacteria 1285
293 Ga0496108_0008759 3300048911 Bacteria 8202
294 Ga0496108_0079451 3300048911 Bacteria 2777
295 Ga0496108_0144330 3300048911 Bacteria 2051
296 Ga0496109_0011297 3300048912 Bacteria 7669
297 Ga0496109_0038021 3300048912 Unclassified 4350
298 Ga0496109_0060623 3300048912 Bacteria 3457
299 Ga0496111_0097506 3300048914 Bacteria 2158
300 Ga0496111_0211951 3300048914 Bacteria 1439
301 Ga0496112_0032605 3300048915 Bacteria 5059
302 Ga0496112_0069257 3300048915 Bacteria 3485
303 Ga0496112_0141280 3300048915 Bacteria 2377
304 Ga0496112_0312834 3300048915 Bacteria 1515
305 Ga0496113_0069682 3300048916 Bacteria 2671
306 Ga0496113_0267351 3300048916 Bacteria 1366
307 Ga0496114_0018392 3300048917 Bacteria 5650
308 Ga0496114_0027339 3300048917 Bacteria 4672
309 Ga0496114_0036926 3300048917 Unclassified 4039
310 Ga0496115_0005506 3300048918 Bacteria 9215
311 Ga0496115_0145291 3300048918 Bacteria 1957
312 Ga0496115_0201867 3300048918 Bacteria 1642
313 Ga0496115_0273819 3300048918 Bacteria 1386
314 Ga0501067_0001144 3300049583 Bacteria 14395
315 Ga0501067_0038921 3300049583 Bacteria 2640
316 Ga0501069_0003298 3300049585 Bacteria 8280
317 Ga0501069_0043258 3300049585 Bacteria 2492
318 Ga0501070_0247174 3300049586 Bacteria 1460
319 nmdc:mga05p37_20675_c1 3300050507 Bacteria 7965
320 nmdc:mga05p37_33871_c1 3300050507 Bacteria 6257
321 nmdc:mga06r32_23582_c1 3300050510 Bacteria 5696
322 nmdc:mga0n895_122365_c1 3300050512 Bacteria 2624
323 nmdc:mga0n895_123844_c1 3300050512 Bacteria 2608
324 nmdc:mga0n895_42383_c1 3300050512 Bacteria 4428
325 nmdc:mga0rr50_268274_c1 3300050513 Bacteria 1422
326 nmdc:mga0rr50_270060_c1 3300050513 Unclassified 1417
327 nmdc:mga0rr50_95626_c1 3300050513 Bacteria 2323
328 nmdc:mga08x19_29746_c1 3300050514 Bacteria 3428
329 nmdc:mga0a205_84458_c1 3300050515 Bacteria 3067
330 Ga0495601_0002499 3300053077 Bacteria 10463
331 Ga0495601_0133239 3300053077 Bacteria 1619
332 Ga0495601_0200326 3300053077 Bacteria 1304
333 Ga0495601_0218553 3300053077 Bacteria 1244
334 Ga0495612_0011817 3300053078 Bacteria 3520
335 Ga0495612_0020189 3300053078 Bacteria 2670
336 Ga0495595_0067196 3300053084 Bacteria 1689
337 Ga0495619_0155954 3300053085 Bacteria 1575
338 Ga0500566_0150026 3300053094 Unclassified 1227
339 Ga0466962_0005276 3300061719 Bacteria 6208
340 Ga0466962_0012104 3300061719 Bacteria 4148
341 Ga0466962_0014747 3300061719 Bacteria 3767
342 Ga0466962_0050591 3300061719 Bacteria 1986
343 Ga0530510_0025852 3300061734 Bacteria 4199
344 Ga0070717_10105787
345 rootH2_10226388
346 Ga0070683_100092877
347 Ga0070682_100281779
348 Ga0068868_100384787
349 Ga0070660_100024623
350 Ga0070709_10043230
351 Ga0070709_10053253
352 Ga0070709_10244635
353 Ga0070714_100012344
354 Ga0070714_100106721
355 Ga0070714_100109946
356 Ga0070714_100150723
357 Ga0070713_100092691
358 Ga0070713_100127091
359 Ga0070713_100378988
360 Ga0070710_10028029
361 Ga0070710_10071224
362 Ga0070711_100132819
363 Ga0070711_100156677
364 Ga0070694_100091486
365 Ga0070694_100132164
366 Ga0070678_100016722
367 Ga0070681_10107979
368 Ga0070707_100001296
369 Ga0070707_100015560
370 Ga0070707_100454878
371 Ga0070698_100019245
372 Ga0070679_100186088
373 Ga0070684_100016072
374 Ga0070684_100143073
375 Ga0070686_100135107
376 Ga0070695_100010323
377 Ga0070695_100116201
378 Ga0070696_100096913
379 Ga0070693_100023607
380 Ga0068855_100386072
381 Ga0070664_100045220
382 Ga0068856_100305225
383 Ga0068856_100365353
384 Ga0068863_100271331
385 Ga0070717_10003402
386 Ga0070717_10036966
387 Ga0070717_10264490
388 Ga0070715_10003145
389 Ga0070716_100201801
390 Ga0070712_100013144
391 Ga0070712_100190588
392 Ga0070712_100270267
393 Ga0070712_100432499
394 Ga0075431_100041716
395 Ga0075433_10009485
396 Ga0075433_10019741
397 Ga0075433_10075399
398 Ga0075434_100003194
399 Ga0075434_100263291
400 Ga0075436_100001428
401 Ga0075436_100008602
402 Ga0075435_100006338
403 Ga0105240_10012439
404 Ga0105240_10375507
405 Ga0105245_10106552
406 Ga0105245_10206367
407 Ga0114129_10021583
408 Ga0114129_10032700
409 Ga0105243_10067568
410 Ga0105242_10126199
411 Ga0105242_10343235
412 Ga0105248_10026241
413 Ga0105237_10232722
414 Ga0157370_10397282
415 Ga0157369_10238542
416 Ga0157372_10028464
417 Ga0157377_10235022
418 Ga0157379_10468973
419 Ga0157376_10021908
420 Ga0207653_10005366
421 Ga0207692_10050636
422 Ga0207685_10020075
423 Ga0207685_10087872
424 Ga0207699_10115514
425 Ga0207684_10169365
426 Ga0207684_10316846
427 Ga0207654_10061164
428 Ga0207707_10130119
429 Ga0207695_10032733
430 Ga0207693_10000867
431 Ga0207693_10002862
432 Ga0207693_10005534
433 Ga0207693_10033578
434 Ga0207693_10286067
435 Ga0207693_10295473
436 Ga0207663_10028812
437 Ga0207660_10013656
438 Ga0207657_10001757
439 Ga0207652_10114620
440 Ga0207646_10001221
441 Ga0207700_10039259
442 Ga0207700_10131408
443 Ga0207700_10182274
444 Ga0207700_10303831
445 Ga0207664_10026734
446 Ga0207664_10048299
447 Ga0207664_10058983
448 Ga0207664_10152151
449 Ga0207665_10000490
450 Ga0207665_10017001
451 Ga0207665_10019175
452 Ga0207661_10139596
453 Ga0207661_10174224
454 Ga0207667_10297741
455 Ga0207677_10105425
456 Ga0207702_10130517
457 Ga0207676_10247867
458 Ga0207428_10027184
459 Ga0265336_10014239
460 Ga0265338_10000634
461 Ga0265338_10009865
462 Ga0265338_10207417
463 Ga0373948_0007402
464 Ga0373958_0013373
465 Ga0373929_0044292
466 Ga0373940_0006652
467 Ga0373952_0007842
468 Ga0373945_0009593
469 Ga0373961_0003134
470 Ga0373931_0008068
471 Ga0373947_0007867
472 Ga0373937_0007877
473 Ga0373925_0002672
474 Ga0395900_0066849
475 Ga0395900_0148091
476 Ga0395898_0097399
477 Ga0395898_0229191
478 Ga0395905_0275786
479 Ga0395901_0052167
480 Ga0466969_0002679
481 Ga0466972_0039640
482 Ga0466965_0038467
483 Ga0466965_0038927
484 Ga0466965_0096197
485 Ga0466966_0041375
486 Ga0466961_0002794
487 Ga0466961_0026003
488 Ga0466961_0250993
489 Ga0466963_0000189
490 Ga0466963_0000997
491 Ga0466963_0006341
492 Ga0466963_0006447
493 Ga0466963_0007750
494 Ga0466963_0008197
495 Ga0466963_0025182
496 Ga0466963_0032904
497 Ga0466963_0044409
498 Ga0466963_0079494
499 Ga0466963_0120958
500 Ga0466964_0002642
501 Ga0466964_0003844
502 Ga0466964_0013619
503 Ga0466964_0023029
504 Ga0466964_0027281
505 Ga0466964_0028101
506 Ga0466964_0033501
507 Ga0466964_0112437
508 Ga0466971_0005051
509 Ga0466968_0007477
510 Ga0466968_0021429
511 Ga0466968_0075710
512 Ga0466970_0040190
513 Ga0466957_0008650
514 Ga0466957_0015017
515 Ga0466957_0044460
516 Ga0466957_0049407
517 Ga0466957_0076955
518 Ga0466957_0201882
519 Ga0466957_0237586
520 Ga0466960_0002376
521 Ga0466960_0016298
522 Ga0466960_0107413
523 Ga0466959_0008552
524 Ga0466959_0056073
525 Ga0466958_0001083
526 Ga0466958_0003928
527 Ga0466958_0011610
528 Ga0466958_0012546
529 Ga0466958_0027264
530 Ga0466958_0057212
531 Ga0466958_0068808
532 Ga0466967_0017166
533 Ga0466967_0019743
534 Ga0466967_0024108
535 Ga0466967_0030883
536 Ga0466967_0079173
537 Ga0466967_0107349
538 Ga0466967_0164544
539 Ga0466967_0179082
540 Ga0466967_0179274
541 Ga0466967_0223186
542 Ga0466967_0361517
543 Ga0466967_0381031
544 Ga0495592_0002063
545 Ga0495592_0090339
546 Ga0495592_0098999
547 Ga0495592_0129557
548 Ga0495629_0069900
549 Ga0495629_0079665
550 Ga0495629_0204628
551 Ga0495641_0049937
552 Ga0495651_0011043
553 Ga0495651_0046559
554 Ga0495653_0008537
555 Ga0495582_0009735
556 Ga0495639_0002608
557 Ga0495662_0157240
558 Ga0495664_0081816
559 Ga0495664_0135846
560 Ga0495585_0054230
561 Ga0495607_0029532
562 Ga0495608_0015258
563 Ga0495608_0108827
564 Ga0495608_0239354
565 Ga0495618_0002917
566 Ga0495618_0073221
567 Ga0495618_0141829
568 Ga0495628_0009335
569 Ga0495628_0043661
570 Ga0495630_0125584
571 Ga0495630_0165541
572 Ga0495644_0014215
573 Ga0495652_0019819
574 Ga0495652_0028593
575 Ga0495652_0041380
576 Ga0495652_0084315
577 Ga0495652_0119778
578 Ga0495652_0199302
579 Ga0495665_0022972
580 Ga0495586_0057955
581 Ga0495587_0005987
582 Ga0495645_0000103
583 Ga0495645_0053673
584 Ga0495667_0044839
585 Ga0495667_0048503
586 Ga0495667_0062952
587 Ga0495634_0041895
588 Ga0495635_0021443
589 Ga0495635_0217315
590 Ga0495599_0000934
591 Ga0495599_0024905
592 Ga0495623_0001101
593 Ga0495646_0003300
594 Ga0495647_0019396
595 Ga0495647_0025276
596 Ga0495647_0097527
597 Ga0495613_0115315
598 Ga0495613_0311332
599 Ga0495624_0036795
600 Ga0495624_0048266
601 Ga0495600_0171708
602 Ga0495604_0006850
603 Ga0495604_0045972
604 Ga0495674_0144851
605 Ga0495674_0226701
606 Ga0495674_0263338
607 Ga0495676_0013688
608 Ga0495676_0094832
609 Ga0495676_0127332
610 Ga0495680_0005889
611 Ga0495680_0027700
612 Ga0495680_0129618
613 Ga0495675_0001253
614 Ga0495684_0048043
615 Ga0495593_0005910
616 Ga0495602_0003272
617 Ga0495602_0083053
618 Ga0496100_0133650
619 Ga0496101_0020826
620 Ga0496101_0029308
621 Ga0496101_0124499
622 Ga0496102_0015167
623 Ga0496103_0084387
624 Ga0496103_0190254
625 Ga0496104_0004776
626 Ga0496104_0150023
627 Ga0496104_0189926
628 Ga0496105_0004781
629 Ga0496105_0042399
630 Ga0496105_0075237
631 Ga0496105_0120788
632 Ga0496106_0024689
633 Ga0496107_0069877
634 Ga0496107_0252744
635 Ga0496107_0262315
636 Ga0496108_0008759
637 Ga0496108_0079451
638 Ga0496108_0144330
639 Ga0496109_0011297
640 Ga0496109_0038021
641 Ga0496109_0060623
642 Ga0496111_0097506
643 Ga0496111_0211951
644 Ga0496112_0032605
645 Ga0496112_0069257
646 Ga0496112_0141280
647 Ga0496112_0312834
648 Ga0496113_0069682
649 Ga0496113_0267351
650 Ga0496114_0018392
651 Ga0496114_0027339
652 Ga0496114_0036926
653 Ga0496115_0005506
654 Ga0496115_0145291
655 Ga0496115_0201867
656 Ga0496115_0273819
657 Ga0501067_0001144
658 Ga0501067_0038921
659 Ga0501069_0003298
660 Ga0501069_0043258
661 Ga0501070_0247174
662 nmdc:mga05p37_20675_c1
663 nmdc:mga05p37_33871_c1
664 nmdc:mga06r32_23582_c1
665 nmdc:mga0n895_122365_c1
666 nmdc:mga0n895_123844_c1
667 nmdc:mga0n895_42383_c1
668 nmdc:mga0rr50_268274_c1
669 nmdc:mga0rr50_270060_c1
670 nmdc:mga0rr50_95626_c1
671 nmdc:mga08x19_29746_c1
672 nmdc:mga0a205_84458_c1
673 Ga0495601_0002499
674 Ga0495601_0133239
675 Ga0495601_0200326
676 Ga0495601_0218553
677 Ga0495612_0011817
678 Ga0495612_0020189
679 Ga0495595_0067196
680 Ga0495619_0155954
681 Ga0500566_0150026
682 Ga0466962_0005276
683 Ga0466962_0012104
684 Ga0466962_0014747
685 Ga0466962_0050591
686 Ga0530510_0025852

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

187

330

0.88

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

5

147

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kpp-assembly1.cif.gz_A crystal structure of h+/ca2+ exchanger cax 0.7525 6 296
4kpp-assembly2.cif.gz_B crystal structure of h+/ca2+ exchanger cax 0.7361 6 296
4kpp-assembly1.cif.gz_A crystal structure of h+/ca2+ exchanger cax 0.718 6 296
4kjs-assembly2.cif.gz_B structure of native yfke 0.7133 10 299
4kpp-assembly2.cif.gz_B crystal structure of h+/ca2+ exchanger cax 0.7022 6 296
ID Description Score Start End Superfamily
af_P45394_41_312_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.7638 45 296 1.20.1420.30
af_Q769E5_118_423_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.7268 43 299 1.20.1420.30
af_C6KSN3_150_437_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.713 43 300 1.20.1420.30
af_P45394_41_312_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.7113 45 296 1.20.1420.30
af_P42839_561_901_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6978 45 299 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A538MRK9-F1-model_v4 Sodium/calcium exchanger membrane region domain-containing protein 0.901 3 303 GO:0005262
GO:0005886
GO:0006874
GO:0008273
AF-A0A538GMP3-F1-model_v4 Sodium/calcium exchanger membrane region domain-containing protein 0.8904 2 306 GO:0005262
GO:0005886
GO:0006874
GO:0008273
AF-A0A538GMP3-F1-model_v4 Sodium/calcium exchanger membrane region domain-containing protein 0.885 2 306 GO:0005262
GO:0005886
GO:0006874
GO:0008273
AF-A0A538MRK9-F1-model_v4 Sodium/calcium exchanger membrane region domain-containing protein 0.8839 3 303 GO:0005262
GO:0005886
GO:0006874
GO:0008273
AF-A0A358QLK9-F1-model_v4 Sodium/calcium exchanger membrane region domain-containing protein 0.8671 1 306 GO:0005262
GO:0005886
GO:0006874
GO:0008273

Map