F415295

General Info

Members Datasets Scaffolds Average Seq Length
342 194 684 134

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1783041|Ga0466967_1783041_37_555
Length 160
Sequence VTTSSTSATLEVGIALPAQEYTVTRADLVRYTGASGDRNPIHWSDRVATSVGLPGVIAHGMYTMALAARALDTWAGGPGRVREFGCKFTKPVIVPDDDTGAVVRVGGTVKAVDGPLVSVTLEVTCGDDKVLGMPKAVIDLSGTDATKGTTEEQGPGSAGG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
36 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
109 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
177 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
191 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
192 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
193 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
194 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 1.17
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 9.36
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1783041 3300045976 Bacteria 613
2 LJQas_1012533 3300000549 Bacteria 1002
3 Ga0070683_100008226 3300005329 Bacteria 8862
4 Ga0070683_100841869 3300005329 Bacteria 880
5 Ga0070683_101868918 3300005329 Bacteria 577
6 Ga0070670_102168406 3300005331 Bacteria 512
7 Ga0070680_100198218 3300005336 Bacteria 1693
8 Ga0070680_101724257 3300005336 Bacteria 543
9 Ga0070682_100210775 3300005337 Bacteria 1377
10 Ga0070689_100071648 3300005340 Bacteria 2708
11 Ga0070689_101913860 3300005340 Bacteria 542
12 Ga0070671_101391672 3300005355 Bacteria 620
13 Ga0070714_100013063 3300005435 Bacteria 6646
14 Ga0070694_100923025 3300005444 Bacteria 722
15 Ga0070663_100394225 3300005455 Bacteria 1130
16 Ga0070681_10112214 3300005458 Bacteria 2666
17 Ga0070681_10255478 3300005458 Bacteria 1665
18 Ga0070679_100832960 3300005530 Bacteria 866
19 Ga0070684_100019734 3300005535 Bacteria 5579
20 Ga0070684_100345687 3300005535 Bacteria 1368
21 Ga0070684_100348123 3300005535 Bacteria 1363
22 Ga0070684_100482882 3300005535 Bacteria 1147
23 Ga0070684_101105926 3300005535 Bacteria 745
24 Ga0068853_100965461 3300005539 Bacteria 820
25 Ga0068853_102327978 3300005539 Bacteria 519
26 Ga0070686_100569207 3300005544 Bacteria 889
27 Ga0070665_101351466 3300005548 Bacteria 722
28 Ga0070704_100862923 3300005549 Bacteria 812
29 Ga0070664_100052049 3300005564 Bacteria 3467
30 Ga0070664_100279737 3300005564 Bacteria 1505
31 Ga0070664_101647813 3300005564 Bacteria 608
32 Ga0068857_100054089 3300005577 Bacteria 3562
33 Ga0068857_100137989 3300005577 Bacteria 2203
34 Ga0068864_100045390 3300005618 Bacteria 3769
35 Ga0068861_101118984 3300005719 Bacteria 758
36 Ga0068861_101802256 3300005719 Bacteria 607
37 Ga0068863_100069400 3300005841 Bacteria 3332
38 Ga0081539_10064078 3300005985 Bacteria 2002
39 Ga0075432_10045309 3300006058 Bacteria 1543
40 Ga0070712_100317136 3300006175 Bacteria 1266
41 Ga0075428_100001967 3300006844 Bacteria 22115
42 Ga0075428_100045436 3300006844 Bacteria 4825
43 Ga0075430_100116201 3300006846 Bacteria 2230
44 Ga0075431_101109477 3300006847 Bacteria 756
45 Ga0075431_101467976 3300006847 Bacteria 641
46 Ga0075429_100733175 3300006880 Bacteria 866
47 Ga0068865_101735333 3300006881 Bacteria 563
48 Ga0111539_10179613 3300009094 Bacteria 2472
49 Ga0105241_12355022 3300009174 Bacteria 531
50 Ga0105248_10012261 3300009177 Bacteria 9453
51 Ga0157319_1008075 3300012497 Bacteria 797
52 Ga0157324_1000883 3300012506 Bacteria 1529
53 Ga0157371_10486472 3300013102 Bacteria 910
54 Ga0157369_10110465 3300013105 Bacteria 2923
55 Ga0157369_12488128 3300013105 Bacteria 524
56 Ga0157372_10176340 3300013307 Bacteria 2474
57 Ga0157372_10341179 3300013307 Bacteria 1745
58 Ga0157372_12911825 3300013307 Bacteria 548
59 Ga0163163_10078736 3300014325 Bacteria 3293
60 Ga0163163_10661906 3300014325 Bacteria 1108
61 Ga0157380_10714926 3300014326 Bacteria 1008
62 Ga0157380_11056638 3300014326 Bacteria 849
63 Ga0182008_10150076 3300014497 Bacteria 1169
64 Ga0157379_11021025 3300014968 Bacteria 789
65 Ga0157379_11759266 3300014968 Bacteria 608
66 Ga0206354_11072603 3300020081 Bacteria 710
67 Ga0206353_11970998 3300020082 Bacteria 1469
68 Ga0207699_10027337 3300025906 Bacteria 3157
69 Ga0207707_10225039 3300025912 Bacteria 1633
70 Ga0207707_10701208 3300025912 Bacteria 850
71 Ga0207693_10143719 3300025915 Bacteria 1876
72 Ga0207660_10165170 3300025917 Bacteria 1710
73 Ga0207649_10454792 3300025920 Bacteria 967
74 Ga0207649_10687462 3300025920 Bacteria 793
75 Ga0207652_10469045 3300025921 Bacteria 1134
76 Ga0207650_10940551 3300025925 Bacteria 734
77 Ga0207650_10974499 3300025925 Bacteria 721
78 Ga0207687_10145782 3300025927 Bacteria 1801
79 Ga0207664_10023641 3300025929 Bacteria 4607
80 Ga0207669_10337283 3300025937 Bacteria 1160
81 Ga0207704_11324651 3300025938 Bacteria 616
82 Ga0207665_11314952 3300025939 Bacteria 576
83 Ga0207711_10173330 3300025941 Bacteria 1959
84 Ga0207661_10021111 3300025944 Bacteria 4878
85 Ga0207661_10626463 3300025944 Bacteria 988
86 Ga0207661_11416893 3300025944 Bacteria 638
87 Ga0207661_11488029 3300025944 Bacteria 621
88 Ga0207679_10107796 3300025945 Bacteria 2192
89 Ga0207679_11295868 3300025945 Bacteria 669
90 Ga0207703_10140706 3300026035 Bacteria 2094
91 Ga0207678_10269912 3300026067 Bacteria 1459
92 Ga0207678_10657803 3300026067 Bacteria 921
93 Ga0207708_10600024 3300026075 Bacteria 933
94 Ga0207702_11682028 3300026078 Bacteria 627
95 Ga0207641_10311672 3300026088 Bacteria 1489
96 Ga0207676_10007701 3300026095 Bacteria 7653
97 Ga0207674_10131432 3300026116 Bacteria 2466
98 Ga0207674_10161203 3300026116 Bacteria 2197
99 Ga0207698_11319245 3300026142 Bacteria 736
100 Ga0207428_10191872 3300027907 Bacteria 1540
101 Ga0268266_11583388 3300028379 Bacteria 631
102 Ga0268264_10361911 3300028381 Bacteria 1384
103 Ga0316181_1083895 3300030744 Bacteria 1514
104 Ga0316182_1183761 3300030745 Bacteria 1230
105 Ga0307408_100345532 3300031548 Bacteria 1261
106 Ga0307514_10369968 3300031649 Bacteria 751
107 Ga0307405_10360705 3300031731 Bacteria 1124
108 Ga0307405_10402088 3300031731 Bacteria 1072
109 Ga0307413_10220776 3300031824 Bacteria 1384
110 Ga0307413_10245417 3300031824 Bacteria 1325
111 Ga0307413_10320377 3300031824 Bacteria 1184
112 Ga0307413_10320901 3300031824 Bacteria 1183
113 Ga0307410_10850908 3300031852 Bacteria 779
114 Ga0307406_10716006 3300031901 Bacteria 837
115 Ga0307407_10017624 3300031903 Bacteria 3590
116 Ga0307407_10062000 3300031903 Bacteria 2188
117 Ga0307407_10076524 3300031903 Bacteria 2010
118 Ga0307407_10482290 3300031903 Bacteria 906
119 Ga0307407_10557722 3300031903 Bacteria 848
120 Ga0307412_10040118 3300031911 Bacteria 3028
121 Ga0307412_10082596 3300031911 Bacteria 2225
122 Ga0307412_10111489 3300031911 Bacteria 1954
123 Ga0307409_100024146 3300031995 Bacteria 4233
124 Ga0307409_100041219 3300031995 Bacteria 3446
125 Ga0307409_100169689 3300031995 Bacteria 1919
126 Ga0307409_100290633 3300031995 Bacteria 1516
127 Ga0307409_100321889 3300031995 Bacteria 1447
128 Ga0307409_101522506 3300031995 Bacteria 696
129 Ga0307409_102895094 3300031995 Bacteria 507
130 Ga0307416_100123115 3300032002 Bacteria 2317
131 Ga0307416_101195347 3300032002 Bacteria 866
132 Ga0307416_102667970 3300032002 Bacteria 597
133 Ga0307414_10350607 3300032004 Bacteria 1267
134 Ga0307414_11446395 3300032004 Bacteria 639
135 Ga0307411_10112105 3300032005 Bacteria 1954
136 Ga0307411_10839338 3300032005 Bacteria 812
137 Ga0307415_100006711 3300032126 Bacteria 6233
138 Ga0307415_100236570 3300032126 Bacteria 1474
139 Ga0307415_100236742 3300032126 Bacteria 1474
140 Ga0307415_100662801 3300032126 Bacteria 937
141 Ga0307415_101456231 3300032126 Bacteria 654
142 Ga0316583_10274522 3300032133 Bacteria 583
143 Ga0373950_0113991 3300034818 Bacteria 593
144 Ga0373944_0235240 3300035089 Bacteria 672
145 Ga0373952_0021414 3300035092 Bacteria 1365
146 Ga0373956_0001257 3300035119 Bacteria 10488
147 Ga0373942_0030536 3300035207 Bacteria 1420
148 Ga0373961_0228299 3300035241 Bacteria 666
149 Ga0395899_0238229 3300037312 Bacteria 1253
150 Ga0395900_0065984 3300037418 Bacteria 3719
151 Ga0395900_0504245 3300037418 Bacteria 1160
152 Ga0395900_1047290 3300037418 Bacteria 734
153 Ga0395898_0655130 3300037466 Bacteria 992
154 Ga0395905_0319868 3300037471 Bacteria 1441
155 Ga0395901_0045940 3300038443 Bacteria 4534
156 Ga0395901_0101482 3300038443 Bacteria 3019
157 Ga0436365_1566860 3300039437 Bacteria 2746
158 Ga0439461_0006279 3300041410 Bacteria 2065
159 Ga0439465_0042620 3300041413 Bacteria 1471
160 Ga0451793_0835062 3300041452 Bacteria 672
161 Ga0451800_1514498 3300041459 Bacteria 545
162 Ga0451807_2479699 3300041486 Bacteria 1046
163 Ga0451839_0466487 3300041496 Bacteria 514
164 Ga0451853_1767178 3300041512 Bacteria 971
165 Ga0439431_0003692 3300041997 Bacteria 3382
166 Ga0450911_045370 3300042115 Bacteria 571
167 Ga0450906_025899 3300042145 Bacteria 1042
168 Ga0439446_0104057 3300042156 Bacteria 900
169 Ga0439434_0006560 3300042435 Bacteria 3399
170 Ga0466972_0177850 3300044658 Bacteria 998
171 Ga0466965_0184620 3300044683 Bacteria 1101
172 Ga0466966_0089537 3300044684 Bacteria 1911
173 Ga0466961_0013224 3300044693 Bacteria 5281
174 Ga0466961_0464493 3300044693 Bacteria 765
175 Ga0466963_0867590 3300044694 Bacteria 636
176 Ga0466971_0027357 3300044719 Bacteria 2554
177 Ga0466970_0201152 3300044765 Bacteria 1108
178 Ga0466970_0321220 3300044765 Bacteria 875
179 Ga0466957_0038239 3300044842 Bacteria 2891
180 Ga0466957_0612905 3300044842 Bacteria 763
181 Ga0466960_0015515 3300044901 Bacteria 3285
182 Ga0466960_0173311 3300044901 Bacteria 1165
183 Ga0466960_0192051 3300044901 Bacteria 1112
184 Ga0466960_1025597 3300044901 Bacteria 508
185 Ga0466959_0299411 3300045049 Bacteria 1101
186 Ga0466958_0063750 3300045836 Bacteria 2248
187 Ga0466958_0144754 3300045836 Bacteria 1497
188 Ga0466958_0885535 3300045836 Bacteria 582
189 Ga0466967_0004942 3300045976 Bacteria 9119
190 Ga0466967_0066911 3300045976 Bacteria 3203
191 Ga0466967_0072341 3300045976 Bacteria 3090
192 Ga0466967_0092295 3300045976 Bacteria 2753
193 Ga0466967_0154005 3300045976 Bacteria 2151
194 Ga0466967_0378707 3300045976 Bacteria 1374
195 Ga0466967_1057491 3300045976 Bacteria 808
196 Ga0495603_0665808 3300046455 Bacteria 595
197 Ga0495590_0437261 3300046457 Bacteria 505
198 Ga0495629_0046435 3300046459 Bacteria 3046
199 Ga0495653_0024825 3300046463 Bacteria 4824
200 Ga0495664_0112600 3300046477 Bacteria 1643
201 Ga0495594_0062607 3300046499 Bacteria 2060
202 Ga0495665_0208530 3300046531 Bacteria 1012
203 Ga0495658_0631003 3300046683 Bacteria 686
204 Ga0495581_0125422 3300047315 Bacteria 1495
205 Ga0495593_0123764 3300047673 Bacteria 1315
206 Ga0496100_0091927 3300048903 Bacteria 2072
207 Ga0496100_0708461 3300048903 Bacteria 786
208 Ga0496101_0067623 3300048904 Bacteria 2609
209 Ga0496102_0041994 3300048905 Bacteria 4143
210 Ga0496103_0010150 3300048906 Bacteria 5568
211 Ga0496103_0094300 3300048906 Bacteria 1891
212 Ga0496104_0024397 3300048907 Bacteria 5562
213 Ga0496105_0009472 3300048908 Bacteria 7621
214 Ga0496105_0260308 3300048908 Bacteria 1403
215 Ga0496106_0012352 3300048909 Bacteria 6304
216 Ga0496107_0116765 3300048910 Bacteria 1965
217 Ga0496108_0008977 3300048911 Bacteria 8102
218 Ga0496108_0105793 3300048911 Bacteria 2402
219 Ga0496108_1709872 3300048911 Bacteria 518
220 Ga0496108_1736479 3300048911 Bacteria 513
221 Ga0496109_0005077 3300048912 Bacteria 10996
222 Ga0496109_0910309 3300048912 Bacteria 817
223 Ga0496109_1020224 3300048912 Bacteria 765
224 Ga0496110_0006601 3300048913 Bacteria 9215
225 Ga0496110_0058280 3300048913 Bacteria 3401
226 Ga0496110_0587771 3300048913 Bacteria 1011
227 Ga0496110_0918933 3300048913 Bacteria 781
228 Ga0496111_0011519 3300048914 Bacteria 5962
229 Ga0496111_0046828 3300048914 Bacteria 3114
230 Ga0496112_0007121 3300048915 Bacteria 9894
231 Ga0496112_0294602 3300048915 Bacteria 1568
232 Ga0496112_0409296 3300048915 Bacteria 1296
233 Ga0496113_0022447 3300048916 Bacteria 4464
234 Ga0496113_0023266 3300048916 Bacteria 4393
235 Ga0501317_004285 3300049533 Bacteria 1476
236 Ga0501318_003630 3300049534 Bacteria 1429
237 Ga0501031_0100284 3300049568 Bacteria 1889
238 Ga0501031_0157657 3300049568 Bacteria 1484
239 Ga0501031_0229982 3300049568 Bacteria 1207
240 Ga0501031_0257832 3300049568 Bacteria 1133
241 Ga0501031_0389633 3300049568 Bacteria 901
242 Ga0501031_0546103 3300049568 Bacteria 746
243 Ga0501032_0011727 3300049569 Bacteria 6283
244 Ga0501032_0122520 3300049569 Bacteria 1718
245 Ga0501032_0685073 3300049569 Bacteria 650
246 Ga0501033_0001049 3300049570 Bacteria 25208
247 Ga0501033_1135678 3300049570 Bacteria 519
248 Ga0501034_0002829 3300049571 Bacteria 20228
249 Ga0501036_0000701 3300049572 Bacteria 24728
250 Ga0501036_0010170 3300049572 Bacteria 7753
251 Ga0501036_0429057 3300049572 Bacteria 1102
252 Ga0501036_0456086 3300049572 Bacteria 1065
253 Ga0501036_0512959 3300049572 Bacteria 997
254 Ga0501036_0537828 3300049572 Bacteria 971
255 Ga0501037_0005051 3300049573 Bacteria 9601
256 Ga0501037_0006638 3300049573 Bacteria 8462
257 Ga0501038_0001733 3300049574 Bacteria 20297
258 Ga0501038_0006331 3300049574 Bacteria 10953
259 Ga0501038_0451606 3300049574 Bacteria 988
260 Ga0501039_0005449 3300049575 Bacteria 9623
261 Ga0501039_0361177 3300049575 Bacteria 1141
262 Ga0501039_0855307 3300049575 Bacteria 709
263 Ga0501040_0138121 3300049576 Bacteria 1716
264 Ga0501040_0260111 3300049576 Bacteria 1239
265 Ga0501040_0375040 3300049576 Bacteria 1020
266 Ga0501040_0764415 3300049576 Bacteria 699
267 Ga0501041_0293223 3300049577 Bacteria 1025
268 Ga0501041_0438604 3300049577 Bacteria 829
269 Ga0501042_0006611 3300049578 Bacteria 7544
270 Ga0501042_0012381 3300049578 Bacteria 5777
271 Ga0501042_0440970 3300049578 Bacteria 944
272 Ga0501042_0534169 3300049578 Bacteria 852
273 Ga0501042_0592583 3300049578 Bacteria 806
274 Ga0501043_0036189 3300049579 Bacteria 3883
275 Ga0501043_0069581 3300049579 Bacteria 2764
276 Ga0501043_0144723 3300049579 Bacteria 1861
277 Ga0501043_0693233 3300049579 Bacteria 745
278 Ga0501046_0000770 3300049580 Bacteria 31019
279 Ga0501046_0015781 3300049580 Bacteria 6338
280 Ga0501046_0415935 3300049580 Bacteria 970
281 Ga0501046_0975176 3300049580 Bacteria 589
282 Ga0501047_0029546 3300049581 Bacteria 5284
283 Ga0501047_0046906 3300049581 Bacteria 4174
284 Ga0501047_0338892 3300049581 Bacteria 1341
285 Ga0501048_0018989 3300049582 Bacteria 5051
286 Ga0501048_0191799 3300049582 Bacteria 1448
287 Ga0501048_0457728 3300049582 Bacteria 914
288 Ga0501048_1156259 3300049582 Bacteria 557
289 Ga0501067_0025243 3300049583 Bacteria 3294
290 Ga0501068_0076448 3300049584 Bacteria 2049
291 Ga0501068_0095087 3300049584 Bacteria 1842
292 Ga0501068_0113566 3300049584 Bacteria 1686
293 Ga0501069_0019895 3300049585 Bacteria 3632
294 Ga0501069_0088306 3300049585 Bacteria 1752
295 Ga0501070_0037966 3300049586 Bacteria 4020
296 Ga0501071_0073503 3300049587 Bacteria 2494
297 Ga0501071_0295945 3300049587 Bacteria 1226
298 Ga0501071_0376112 3300049587 Bacteria 1083
299 Ga0501072_0010714 3300049588 Bacteria 6984
300 Ga0501072_0651066 3300049588 Bacteria 829
301 Ga0501072_0885059 3300049588 Bacteria 698
302 Ga0501072_1229533 3300049588 Bacteria 581
303 Ga0501072_1393236 3300049588 Bacteria 542
304 Ga0501074_0125391 3300049590 Bacteria 1837
305 Ga0501076_0078418 3300049592 Bacteria 2651
306 Ga0501076_0611816 3300049592 Bacteria 899
307 Ga0501076_0656881 3300049592 Bacteria 865
308 Ga0501076_1277207 3300049592 Bacteria 604
309 Ga0501076_1371309 3300049592 Bacteria 581
310 Ga0501259_037201 3300049688 Bacteria 944
311 Ga0501221_203609 3300049704 Bacteria 551
312 Ga0501079_0437318 3300049741 Bacteria 1027
313 Ga0501079_1233075 3300049741 Bacteria 589
314 Ga0501081_0530405 3300049743 Bacteria 879
315 Ga0501271_040825 3300049768 Bacteria 604
316 Ga0501271_071110 3300049768 Bacteria 503
317 Ga0501276_030570 3300049773 Bacteria 561
318 Ga0501035_0037207 3300049822 Bacteria 4408
319 Ga0501035_1267204 3300049822 Bacteria 570
320 Ga0501044_0019401 3300049823 Bacteria 7275
321 Ga0501044_0024160 3300049823 Bacteria 6456
322 Ga0501044_0594671 3300049823 Bacteria 1000
323 Ga0501045_0222028 3300049824 Bacteria 1407
324 Ga0501045_0789078 3300049824 Bacteria 700
325 nmdc:mga03n38_67254_c1 3300050490 Bacteria 1648
326 nmdc:mga0qj67_155421_c1 3300050509 Bacteria 1856
327 nmdc:mga06r32_155247_c1 3300050510 Bacteria 2270
328 nmdc:mga06r32_262955_c1 3300050510 Bacteria 1713
329 nmdc:mga08y16_345368_c1 3300050511 Bacteria 1529
330 nmdc:mga0n895_322613_c1 3300050512 Bacteria 1565
331 Ga0500627_0305206 3300053158 Bacteria 694
332 Ga0501084_0793124 3300054114 Bacteria 798
333 Ga0501084_1618962 3300054114 Bacteria 541
334 Ga0501082_0551585 3300060353 Bacteria 1008
335 Ga0530510_0080604 3300061734 Bacteria 2369
336 Ga0530510_0134947 3300061734 Bacteria 1817
337 Ga0530510_1092701 3300061734 Bacteria 611
338 2774394883 2773857762 Bacteria 5971770
339 2809194264 2808606439 Bacteria 5952208
340 2812349016 2811994878 Bacteria 5992952
341 2891973228 2891968417 Bacteria 5821697
342 2917741195 2917736166 Bacteria 9690793
343 Ga0466967_1783041
344 LJQas_1012533
345 Ga0070683_100008226
346 Ga0070683_100841869
347 Ga0070683_101868918
348 Ga0070670_102168406
349 Ga0070680_100198218
350 Ga0070680_101724257
351 Ga0070682_100210775
352 Ga0070689_100071648
353 Ga0070689_101913860
354 Ga0070671_101391672
355 Ga0070714_100013063
356 Ga0070694_100923025
357 Ga0070663_100394225
358 Ga0070681_10112214
359 Ga0070681_10255478
360 Ga0070679_100832960
361 Ga0070684_100019734
362 Ga0070684_100345687
363 Ga0070684_100348123
364 Ga0070684_100482882
365 Ga0070684_101105926
366 Ga0068853_100965461
367 Ga0068853_102327978
368 Ga0070686_100569207
369 Ga0070665_101351466
370 Ga0070704_100862923
371 Ga0070664_100052049
372 Ga0070664_100279737
373 Ga0070664_101647813
374 Ga0068857_100054089
375 Ga0068857_100137989
376 Ga0068864_100045390
377 Ga0068861_101118984
378 Ga0068861_101802256
379 Ga0068863_100069400
380 Ga0081539_10064078
381 Ga0075432_10045309
382 Ga0070712_100317136
383 Ga0075428_100001967
384 Ga0075428_100045436
385 Ga0075430_100116201
386 Ga0075431_101109477
387 Ga0075431_101467976
388 Ga0075429_100733175
389 Ga0068865_101735333
390 Ga0111539_10179613
391 Ga0105241_12355022
392 Ga0105248_10012261
393 Ga0157319_1008075
394 Ga0157324_1000883
395 Ga0157371_10486472
396 Ga0157369_10110465
397 Ga0157369_12488128
398 Ga0157372_10176340
399 Ga0157372_10341179
400 Ga0157372_12911825
401 Ga0163163_10078736
402 Ga0163163_10661906
403 Ga0157380_10714926
404 Ga0157380_11056638
405 Ga0182008_10150076
406 Ga0157379_11021025
407 Ga0157379_11759266
408 Ga0206354_11072603
409 Ga0206353_11970998
410 Ga0207699_10027337
411 Ga0207707_10225039
412 Ga0207707_10701208
413 Ga0207693_10143719
414 Ga0207660_10165170
415 Ga0207649_10454792
416 Ga0207649_10687462
417 Ga0207652_10469045
418 Ga0207650_10940551
419 Ga0207650_10974499
420 Ga0207687_10145782
421 Ga0207664_10023641
422 Ga0207669_10337283
423 Ga0207704_11324651
424 Ga0207665_11314952
425 Ga0207711_10173330
426 Ga0207661_10021111
427 Ga0207661_10626463
428 Ga0207661_11416893
429 Ga0207661_11488029
430 Ga0207679_10107796
431 Ga0207679_11295868
432 Ga0207703_10140706
433 Ga0207678_10269912
434 Ga0207678_10657803
435 Ga0207708_10600024
436 Ga0207702_11682028
437 Ga0207641_10311672
438 Ga0207676_10007701
439 Ga0207674_10131432
440 Ga0207674_10161203
441 Ga0207698_11319245
442 Ga0207428_10191872
443 Ga0268266_11583388
444 Ga0268264_10361911
445 Ga0316181_1083895
446 Ga0316182_1183761
447 Ga0307408_100345532
448 Ga0307514_10369968
449 Ga0307405_10360705
450 Ga0307405_10402088
451 Ga0307413_10220776
452 Ga0307413_10245417
453 Ga0307413_10320377
454 Ga0307413_10320901
455 Ga0307410_10850908
456 Ga0307406_10716006
457 Ga0307407_10017624
458 Ga0307407_10062000
459 Ga0307407_10076524
460 Ga0307407_10482290
461 Ga0307407_10557722
462 Ga0307412_10040118
463 Ga0307412_10082596
464 Ga0307412_10111489
465 Ga0307409_100024146
466 Ga0307409_100041219
467 Ga0307409_100169689
468 Ga0307409_100290633
469 Ga0307409_100321889
470 Ga0307409_101522506
471 Ga0307409_102895094
472 Ga0307416_100123115
473 Ga0307416_101195347
474 Ga0307416_102667970
475 Ga0307414_10350607
476 Ga0307414_11446395
477 Ga0307411_10112105
478 Ga0307411_10839338
479 Ga0307415_100006711
480 Ga0307415_100236570
481 Ga0307415_100236742
482 Ga0307415_100662801
483 Ga0307415_101456231
484 Ga0316583_10274522
485 Ga0373950_0113991
486 Ga0373944_0235240
487 Ga0373952_0021414
488 Ga0373956_0001257
489 Ga0373942_0030536
490 Ga0373961_0228299
491 Ga0395899_0238229
492 Ga0395900_0065984
493 Ga0395900_0504245
494 Ga0395900_1047290
495 Ga0395898_0655130
496 Ga0395905_0319868
497 Ga0395901_0045940
498 Ga0395901_0101482
499 Ga0436365_1566860
500 Ga0439461_0006279
501 Ga0439465_0042620
502 Ga0451793_0835062
503 Ga0451800_1514498
504 Ga0451807_2479699
505 Ga0451839_0466487
506 Ga0451853_1767178
507 Ga0439431_0003692
508 Ga0450911_045370
509 Ga0450906_025899
510 Ga0439446_0104057
511 Ga0439434_0006560
512 Ga0466972_0177850
513 Ga0466965_0184620
514 Ga0466966_0089537
515 Ga0466961_0013224
516 Ga0466961_0464493
517 Ga0466963_0867590
518 Ga0466971_0027357
519 Ga0466970_0201152
520 Ga0466970_0321220
521 Ga0466957_0038239
522 Ga0466957_0612905
523 Ga0466960_0015515
524 Ga0466960_0173311
525 Ga0466960_0192051
526 Ga0466960_1025597
527 Ga0466959_0299411
528 Ga0466958_0063750
529 Ga0466958_0144754
530 Ga0466958_0885535
531 Ga0466967_0004942
532 Ga0466967_0066911
533 Ga0466967_0072341
534 Ga0466967_0092295
535 Ga0466967_0154005
536 Ga0466967_0378707
537 Ga0466967_1057491
538 Ga0495603_0665808
539 Ga0495590_0437261
540 Ga0495629_0046435
541 Ga0495653_0024825
542 Ga0495664_0112600
543 Ga0495594_0062607
544 Ga0495665_0208530
545 Ga0495658_0631003
546 Ga0495581_0125422
547 Ga0495593_0123764
548 Ga0496100_0091927
549 Ga0496100_0708461
550 Ga0496101_0067623
551 Ga0496102_0041994
552 Ga0496103_0010150
553 Ga0496103_0094300
554 Ga0496104_0024397
555 Ga0496105_0009472
556 Ga0496105_0260308
557 Ga0496106_0012352
558 Ga0496107_0116765
559 Ga0496108_0008977
560 Ga0496108_0105793
561 Ga0496108_1709872
562 Ga0496108_1736479
563 Ga0496109_0005077
564 Ga0496109_0910309
565 Ga0496109_1020224
566 Ga0496110_0006601
567 Ga0496110_0058280
568 Ga0496110_0587771
569 Ga0496110_0918933
570 Ga0496111_0011519
571 Ga0496111_0046828
572 Ga0496112_0007121
573 Ga0496112_0294602
574 Ga0496112_0409296
575 Ga0496113_0022447
576 Ga0496113_0023266
577 Ga0501317_004285
578 Ga0501318_003630
579 Ga0501031_0100284
580 Ga0501031_0157657
581 Ga0501031_0229982
582 Ga0501031_0257832
583 Ga0501031_0389633
584 Ga0501031_0546103
585 Ga0501032_0011727
586 Ga0501032_0122520
587 Ga0501032_0685073
588 Ga0501033_0001049
589 Ga0501033_1135678
590 Ga0501034_0002829
591 Ga0501036_0000701
592 Ga0501036_0010170
593 Ga0501036_0429057
594 Ga0501036_0456086
595 Ga0501036_0512959
596 Ga0501036_0537828
597 Ga0501037_0005051
598 Ga0501037_0006638
599 Ga0501038_0001733
600 Ga0501038_0006331
601 Ga0501038_0451606
602 Ga0501039_0005449
603 Ga0501039_0361177
604 Ga0501039_0855307
605 Ga0501040_0138121
606 Ga0501040_0260111
607 Ga0501040_0375040
608 Ga0501040_0764415
609 Ga0501041_0293223
610 Ga0501041_0438604
611 Ga0501042_0006611
612 Ga0501042_0012381
613 Ga0501042_0440970
614 Ga0501042_0534169
615 Ga0501042_0592583
616 Ga0501043_0036189
617 Ga0501043_0069581
618 Ga0501043_0144723
619 Ga0501043_0693233
620 Ga0501046_0000770
621 Ga0501046_0015781
622 Ga0501046_0415935
623 Ga0501046_0975176
624 Ga0501047_0029546
625 Ga0501047_0046906
626 Ga0501047_0338892
627 Ga0501048_0018989
628 Ga0501048_0191799
629 Ga0501048_0457728
630 Ga0501048_1156259
631 Ga0501067_0025243
632 Ga0501068_0076448
633 Ga0501068_0095087
634 Ga0501068_0113566
635 Ga0501069_0019895
636 Ga0501069_0088306
637 Ga0501070_0037966
638 Ga0501071_0073503
639 Ga0501071_0295945
640 Ga0501071_0376112
641 Ga0501072_0010714
642 Ga0501072_0651066
643 Ga0501072_0885059
644 Ga0501072_1229533
645 Ga0501072_1393236
646 Ga0501074_0125391
647 Ga0501076_0078418
648 Ga0501076_0611816
649 Ga0501076_0656881
650 Ga0501076_1277207
651 Ga0501076_1371309
652 Ga0501259_037201
653 Ga0501221_203609
654 Ga0501079_0437318
655 Ga0501079_1233075
656 Ga0501081_0530405
657 Ga0501271_040825
658 Ga0501271_071110
659 Ga0501276_030570
660 Ga0501035_0037207
661 Ga0501035_1267204
662 Ga0501044_0019401
663 Ga0501044_0024160
664 Ga0501044_0594671
665 Ga0501045_0222028
666 Ga0501045_0789078
667 nmdc:mga03n38_67254_c1
668 nmdc:mga0qj67_155421_c1
669 nmdc:mga06r32_155247_c1
670 nmdc:mga06r32_262955_c1
671 nmdc:mga08y16_345368_c1
672 nmdc:mga0n895_322613_c1
673 Ga0500627_0305206
674 Ga0501084_0793124
675 Ga0501084_1618962
676 Ga0501082_0551585
677 Ga0530510_0080604
678 Ga0530510_0134947
679 Ga0530510_1092701
680 2774394883
681 2809194264
682 2812349016
683 2891973228
684 2917741195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

11

89

0.89

PF01575

MaoC_dehydratas

MaoC like domain

11

126

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9278 5 132
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9124 5 132
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9102 5 132
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.8965 5 132
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8881 5 132
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9239 5 132 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8846 5 132 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8756 5 133 3.10.129.10
af_A4HT66_2_132_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8716 5 116 3.10.129.10
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8672 5 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1I3HZC3-F1-model_v4 Acyl dehydratase 0.965 8 133 GO:0004312
GO:0005835
GO:0006633
AF-A0A1I3HZC3-F1-model_v4 Acyl dehydratase 0.9575 8 133 GO:0004312
GO:0005835
GO:0006633
AF-A0A6J4MLI4-F1-model_v4 (3R)-hydroxyacyl-ACP dehydratase subunit HadB 0.9568 6 133
AF-A0A4Q4Z6E4-F1-model_v4 Acyl dehydratase 0.9559 8 133 GO:0004312
GO:0005835
GO:0006633
AF-W4U9Q3-F1-model_v4 deleted 0.9506 49 133

Map