F415223

General Info

Members Datasets Scaffolds Average Seq Length
342 205 684 176

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10109220|Ga0307407_101092202
Length 203
Sequence MRPKGDGQPGFCAHHPHSTAPPLAGVQAYNLDMETWDTIRARRNVRQYTDQPIARADLERILDAGRRAASASNWQPWNFVVVTDRPQLVELAKVWQGARHVARSAATIAFVVRQPEDTRHQDLLMYDLGQATANIMLAATDLGIGSGHAAVSDQEQARRVLGFPDGYFCAYLIGLGYPADRRLRPLVLPDRRPFDEVVHWDLW

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 11.11
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 32.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10109220 3300031903 Unclassified 1733
2 rootL2_10156567 3300003322 Unclassified 1342
3 Ga0070690_100006230 3300005330 Bacteria 6768
4 Ga0070680_100179330 3300005336 Unclassified 1784
5 Ga0070682_101353502 3300005337 Archaea 607
6 Ga0068868_100347399 3300005338 Bacteria 1270
7 Ga0070660_100209329 3300005339 Unclassified 1583
8 Ga0070660_100993226 3300005339 Bacteria 709
9 Ga0070661_100063922 3300005344 Bacteria 2704
10 Ga0070692_10036309 3300005345 Unclassified 2500
11 Ga0070692_10037094 3300005345 Bacteria 2477
12 Ga0070692_10053577 3300005345 Bacteria 2104
13 Ga0070669_100416687 3300005353 Bacteria 1102
14 Ga0070671_100328961 3300005355 Unclassified 1302
15 Ga0070674_100001621 3300005356 Bacteria 12090
16 Ga0070674_100246667 3300005356 Bacteria 1401
17 Ga0070688_100166328 3300005365 Unclassified 1518
18 Ga0070659_100150646 3300005366 Bacteria 1897
19 Ga0070703_10002857 3300005406 Bacteria 4944
20 Ga0070701_10599444 3300005438 Bacteria 729
21 Ga0070705_100002274 3300005440 Bacteria 9709
22 Ga0070705_100056588 3300005440 Unclassified 2310
23 Ga0070705_100808734 3300005440 Unclassified 746
24 Ga0070700_100095941 3300005441 Bacteria 1945
25 Ga0070700_100249809 3300005441 Unclassified 1271
26 Ga0070694_100011857 3300005444 Bacteria 5406
27 Ga0070694_100130160 3300005444 Bacteria 1817
28 Ga0070694_100343963 3300005444 Unclassified 1154
29 Ga0070694_100425621 3300005444 Unclassified 1044
30 Ga0070708_100006445 3300005445 Bacteria 9346
31 Ga0070708_100007911 3300005445 Bacteria 8510
32 Ga0070663_100568847 3300005455 Unclassified 949
33 Ga0070678_100669988 3300005456 Unclassified 932
34 Ga0070678_100707506 3300005456 Bacteria 908
35 Ga0070678_101304178 3300005456 Unclassified 676
36 Ga0070662_100072346 3300005457 Unclassified 2545
37 Ga0070662_100705120 3300005457 Bacteria 854
38 Ga0068867_100005976 3300005459 Bacteria 8631
39 Ga0068867_100745194 3300005459 Unclassified 869
40 Ga0070685_10011761 3300005466 Bacteria 4588
41 Ga0070706_100014412 3300005467 Bacteria 7306
42 Ga0070706_100026160 3300005467 Bacteria 5370
43 Ga0070706_100030281 3300005467 Bacteria 4986
44 Ga0070706_100039782 3300005467 Bacteria 4339
45 Ga0070707_100000163 3300005468 Bacteria 63764
46 Ga0070707_100012398 3300005468 Bacteria 7960
47 Ga0070707_100013412 3300005468 Bacteria 7666
48 Ga0070698_100278635 3300005471 Bacteria 1604
49 Ga0070699_100001296 3300005518 Bacteria 23080
50 Ga0070679_100221745 3300005530 Unclassified 1852
51 Ga0070684_100009868 3300005535 Bacteria 7544
52 Ga0070697_100393682 3300005536 Bacteria 1201
53 Ga0070697_100631798 3300005536 Archaea 942
54 Ga0070686_100024055 3300005544 Unclassified 3648
55 Ga0070695_100016528 3300005545 Bacteria 4467
56 Ga0070695_100030856 3300005545 Bacteria 3338
57 Ga0070695_100089150 3300005545 Bacteria 2055
58 Ga0070696_100011943 3300005546 Bacteria 5820
59 Ga0070696_100050420 3300005546 Bacteria 2893
60 Ga0070696_100157730 3300005546 Unclassified 1670
61 Ga0070665_100408686 3300005548 Unclassified 1366
62 Ga0070704_100035330 3300005549 Bacteria 3396
63 Ga0070704_100093957 3300005549 Bacteria 2243
64 Ga0070704_100104330 3300005549 Unclassified 2144
65 Ga0070704_100285263 3300005549 Bacteria 1370
66 Ga0070704_101004169 3300005549 Unclassified 755
67 Ga0068855_100179565 3300005563 Bacteria 2394
68 Ga0070664_100307152 3300005564 Bacteria 1435
69 Ga0068857_101118371 3300005577 Bacteria 761
70 Ga0068854_100991715 3300005578 Unclassified 743
71 Ga0070702_100259965 3300005615 Unclassified 1181
72 Ga0068852_100268507 3300005616 Unclassified 1641
73 Ga0068859_101267446 3300005617 Bacteria 812
74 Ga0068866_10139638 3300005718 Unclassified 1389
75 Ga0068866_10329003 3300005718 Unclassified 964
76 Ga0068861_100057817 3300005719 Bacteria 2963
77 Ga0068861_100252269 3300005719 Archaea 1506
78 Ga0068861_100327137 3300005719 Bacteria 1337
79 Ga0068870_10091331 3300005840 Unclassified 1703
80 Ga0068860_100412392 3300005843 Unclassified 1338
81 Ga0068862_100340665 3300005844 Bacteria 1389
82 Ga0068862_101367511 3300005844 Unclassified 711
83 Ga0081455_10031355 3300005937 Bacteria 4811
84 Ga0081455_10419072 3300005937 Bacteria 924
85 Ga0081539_10000111 3300005985 Bacteria 190245
86 Ga0081539_10048330 3300005985 Bacteria 2421
87 Ga0075365_10191949 3300006038 Bacteria 1430
88 Ga0075432_10005972 3300006058 Bacteria 4144
89 Ga0075428_100021719 3300006844 Bacteria 7106
90 Ga0075428_100294034 3300006844 Bacteria 1747
91 Ga0075428_100982010 3300006844 Bacteria 894
92 Ga0075428_101758170 3300006844 Bacteria 646
93 Ga0075431_100028255 3300006847 Bacteria 5760
94 Ga0075433_10007154 3300006852 Bacteria 8837
95 Ga0075433_10306143 3300006852 Unclassified 1407
96 Ga0075433_10934336 3300006852 Bacteria 756
97 Ga0075434_100011689 3300006871 Bacteria 8292
98 Ga0075434_100281080 3300006871 Unclassified 1684
99 Ga0075434_101080677 3300006871 Unclassified 816
100 Ga0075429_100144968 3300006880 Bacteria 2079
101 Ga0068865_100144979 3300006881 Unclassified 1795
102 Ga0097620_101267164 3300006931 Bacteria 812
103 Ga0075435_100010522 3300007076 Bacteria 6766
104 Ga0111539_10014496 3300009094 Bacteria 9840
105 Ga0111539_10061046 3300009094 Bacteria 4466
106 Ga0111539_10166738 3300009094 Bacteria 2575
107 Ga0111539_11097971 3300009094 Bacteria 924
108 Ga0105245_10079681 3300009098 Bacteria 2991
109 Ga0105245_10226306 3300009098 Bacteria 1807
110 Ga0105245_10970891 3300009098 Bacteria 893
111 Ga0105245_11392496 3300009098 Bacteria 751
112 Ga0114129_10140045 3300009147 Bacteria 3317
113 Ga0114129_10309505 3300009147 Bacteria 2103
114 Ga0105243_10317605 3300009148 Unclassified 1418
115 Ga0105243_11246809 3300009148 Bacteria 759
116 Ga0105242_10029224 3300009176 Bacteria 4394
117 Ga0105248_10300568 3300009177 Unclassified 1807
118 Ga0105249_10198951 3300009553 Bacteria 1960
119 Ga0105249_10228434 3300009553 Bacteria 1835
120 Ga0105249_10475391 3300009553 Unclassified 1292
121 Ga0105239_10164434 3300010375 Bacteria 2481
122 Ga0105246_10523209 3300011119 Unclassified 1011
123 Ga0157371_10719102 3300013102 Unclassified 748
124 Ga0157374_10202856 3300013296 Bacteria 1942
125 Ga0157378_10014506 3300013297 Bacteria 6898
126 Ga0157378_10541232 3300013297 Bacteria 1168
127 Ga0157378_11883148 3300013297 Unclassified 647
128 Ga0163162_10324703 3300013306 Bacteria 1671
129 Ga0157375_10028168 3300013308 Bacteria 5261
130 Ga0157375_10074269 3300013308 Bacteria 3421
131 Ga0163163_10101102 3300014325 Bacteria 2905
132 Ga0163163_12126902 3300014325 Unclassified 621
133 Ga0157380_10272387 3300014326 Unclassified 1544
134 Ga0157380_10316313 3300014326 Bacteria 1445
135 Ga0157377_10018352 3300014745 Unclassified 3634
136 Ga0157379_10409804 3300014968 Unclassified 1247
137 Ga0157379_10606037 3300014968 Bacteria 1023
138 Ga0157376_10187541 3300014969 Unclassified 1894
139 Ga0163161_10251397 3300017792 Unclassified 1378
140 Ga0163161_10316429 3300017792 Bacteria 1233
141 Ga0207642_10214178 3300025899 Bacteria 1072
142 Ga0207642_10264743 3300025899 Archaea 982
143 Ga0207688_10006798 3300025901 Bacteria 6224
144 Ga0207688_10295845 3300025901 Unclassified 989
145 Ga0207647_10427602 3300025904 Bacteria 744
146 Ga0207684_10006716 3300025910 Bacteria 10446
147 Ga0207684_10029005 3300025910 Bacteria 4713
148 Ga0207684_10150631 3300025910 Bacteria 2001
149 Ga0207684_10541541 3300025910 Bacteria 996
150 Ga0207663_10215735 3300025916 Unclassified 1394
151 Ga0207660_10211287 3300025917 Bacteria 1519
152 Ga0207657_10018470 3300025919 Bacteria 6654
153 Ga0207657_10257027 3300025919 Bacteria 1391
154 Ga0207652_10641286 3300025921 Unclassified 950
155 Ga0207646_10079532 3300025922 Bacteria 2931
156 Ga0207646_10572955 3300025922 Unclassified 1014
157 Ga0207681_10282637 3300025923 Bacteria 1307
158 Ga0207694_10576925 3300025924 Unclassified 945
159 Ga0207650_10279895 3300025925 Unclassified 1358
160 Ga0207659_10271869 3300025926 Bacteria 1382
161 Ga0207687_11146499 3300025927 Bacteria 668
162 Ga0207644_10099735 3300025931 Bacteria 2180
163 Ga0207690_10125570 3300025932 Bacteria 1870
164 Ga0207690_10816049 3300025932 Bacteria 771
165 Ga0207690_10885320 3300025932 Unclassified 740
166 Ga0207706_10019411 3300025933 Bacteria 6116
167 Ga0207706_10380575 3300025933 Bacteria 1225
168 Ga0207686_10368598 3300025934 Bacteria 1086
169 Ga0207709_11309898 3300025935 Unclassified 599
170 Ga0207670_10057587 3300025936 Bacteria 2636
171 Ga0207669_10026613 3300025937 Bacteria 3150
172 Ga0207669_10174997 3300025937 Bacteria 1532
173 Ga0207704_10192008 3300025938 Unclassified 1486
174 Ga0207691_10138752 3300025940 Bacteria 2143
175 Ga0207689_10497151 3300025942 Unclassified 1022
176 Ga0207661_10430001 3300025944 Unclassified 1200
177 Ga0207679_10305795 3300025945 Unclassified 1372
178 Ga0207667_11504541 3300025949 Unclassified 644
179 Ga0207712_10568962 3300025961 Bacteria 977
180 Ga0207712_11458061 3300025961 Unclassified 613
181 Ga0207640_10050146 3300025981 Unclassified 2706
182 Ga0207640_10349982 3300025981 Unclassified 1187
183 Ga0207677_10293604 3300026023 Bacteria 1340
184 Ga0207708_10001183 3300026075 Bacteria 19643
185 Ga0207648_10002606 3300026089 Bacteria 19323
186 Ga0207648_10662147 3300026089 Unclassified 965
187 Ga0207676_10318421 3300026095 Unclassified 1427
188 Ga0207674_10004010 3300026116 Bacteria 17879
189 Ga0207675_100069557 3300026118 Bacteria 3290
190 Ga0207675_100205748 3300026118 Unclassified 1891
191 Ga0207675_100558244 3300026118 Bacteria 1145
192 Ga0207675_101209694 3300026118 Bacteria 776
193 Ga0207683_10376797 3300026121 Unclassified 1304
194 Ga0207428_10041424 3300027907 Bacteria 3729
195 Ga0207428_10118903 3300027907 Unclassified 2028
196 Ga0268266_10080810 3300028379 Unclassified 2833
197 Ga0268265_10871419 3300028380 Unclassified 882
198 Ga0268265_10936580 3300028380 Bacteria 852
199 Ga0268265_11111102 3300028380 Unclassified 785
200 Ga0268264_10142290 3300028381 Unclassified 2140
201 Ga0268264_10182380 3300028381 Unclassified 1907
202 Ga0307408_100037030 3300031548 Unclassified 3434
203 Ga0307408_100423953 3300031548 Unclassified 1148
204 Ga0307405_10262874 3300031731 Bacteria 1290
205 Ga0307405_10896763 3300031731 Bacteria 750
206 Ga0307413_10006601 3300031824 Bacteria 5317
207 Ga0307410_10006087 3300031852 Bacteria 6471
208 Ga0307410_10034067 3300031852 Bacteria 3294
209 Ga0307410_10073647 3300031852 Unclassified 2376
210 Ga0307410_10876136 3300031852 Unclassified 768
211 Ga0307406_10134292 3300031901 Bacteria 1742
212 Ga0307406_10149679 3300031901 Unclassified 1663
213 Ga0307412_10068278 3300031911 Bacteria 2417
214 Ga0307409_100001743 3300031995 Bacteria 10974
215 Ga0307409_100132276 3300031995 Unclassified 2134
216 Ga0307409_101247715 3300031995 Unclassified 767
217 Ga0307416_100084036 3300032002 Unclassified 2703
218 Ga0307416_100102594 3300032002 Bacteria 2495
219 Ga0307416_100254971 3300032002 Bacteria 1710
220 Ga0307416_100821067 3300032002 Bacteria 1026
221 Ga0307416_101976273 3300032002 Unclassified 686
222 Ga0307414_10022358 3300032004 Bacteria 3987
223 Ga0307414_10069310 3300032004 Unclassified 2535
224 Ga0307411_10021942 3300032005 Unclassified 3749
225 Ga0307415_100015580 3300032126 Bacteria 4507
226 Ga0307415_100171233 3300032126 Bacteria 1693
227 Ga0373951_0050677 3300035091 Unclassified 1021
228 Ga0373936_0488440 3300035113 Bacteria 572
229 Ga0373947_0043029 3300035725 Bacteria 2697
230 Ga0373925_0375287 3300037068 Bacteria 1157
231 Ga0395898_0014266 3300037466 Bacteria 8166
232 Ga0395901_0007545 3300038443 Bacteria 10987
233 Ga0436365_0087380 3300039437 Bacteria 5269
234 Ga0436365_0916590 3300039437 Bacteria 1580
235 Ga0436365_1206541 3300039437 Bacteria 1067
236 Ga0436362_1172430 3300039453 Bacteria 1097
237 Ga0439463_002772 3300042016 Bacteria 4444
238 Ga0439459_0078062 3300042438 Bacteria 777
239 Ga0439464_0085008 3300042439 Bacteria 948
240 Ga0451577_0121583 3300042876 Unclassified 2339
241 Ga0451577_0972825 3300042876 Bacteria 763
242 Ga0439440_0002923 3300042993 Bacteria 3255
243 Ga0466963_0116834 3300044694 Bacteria 1834
244 Ga0466967_0111215 3300045976 Bacteria 2517
245 Ga0495629_0588801 3300046459 Bacteria 745
246 Ga0495618_0216972 3300046514 Unclassified 1208
247 Ga0495628_0963038 3300046516 Bacteria 589
248 Ga0495652_0427539 3300046529 Bacteria 932
249 Ga0495656_0352780 3300046615 Bacteria 763
250 Ga0495674_0056738 3300047319 Unclassified 3429
251 Ga0495684_0284200 3300047471 Unclassified 1193
252 Ga0496102_0002135 3300048905 Bacteria 16984
253 Ga0496102_0120731 3300048905 Bacteria 2448
254 Ga0496102_0167075 3300048905 Bacteria 2071
255 Ga0496102_0453369 3300048905 Bacteria 1203
256 Ga0496102_0649901 3300048905 Bacteria 978
257 Ga0496103_0005159 3300048906 Bacteria 7862
258 Ga0496103_0046457 3300048906 Bacteria 2681
259 Ga0496104_0014000 3300048907 Bacteria 7236
260 Ga0496105_0014121 3300048908 Bacteria 6355
261 Ga0496105_0053353 3300048908 Bacteria 3339
262 Ga0496105_0140634 3300048908 Bacteria 1987
263 Ga0496106_0022526 3300048909 Bacteria 4682
264 Ga0496106_0025358 3300048909 Unclassified 4412
265 Ga0496106_0039250 3300048909 Bacteria 3546
266 Ga0496106_0055900 3300048909 Unclassified 2984
267 Ga0496107_0313431 3300048910 Unclassified 1168
268 Ga0496108_0007788 3300048911 Bacteria 8677
269 Ga0496108_0029747 3300048911 Unclassified 4526
270 Ga0496108_0140078 3300048911 Bacteria 2084
271 Ga0496108_1144345 3300048911 Unclassified 660
272 Ga0496109_0007709 3300048912 Bacteria 9123
273 Ga0496109_0080099 3300048912 Bacteria 3009
274 Ga0496109_0221728 3300048912 Unclassified 1778
275 Ga0496109_0240854 3300048912 Unclassified 1702
276 Ga0496109_0347321 3300048912 Unclassified 1401
277 Ga0496110_0003563 3300048913 Bacteria 11960
278 Ga0496110_0545470 3300048913 Bacteria 1054
279 Ga0496110_0922321 3300048913 Bacteria 780
280 Ga0496111_0032612 3300048914 Bacteria 3714
281 Ga0496112_0010185 3300048915 Bacteria 8519
282 Ga0496112_0077847 3300048915 Bacteria 3280
283 Ga0496112_1103380 3300048915 Bacteria 712
284 Ga0496113_0062922 3300048916 Bacteria 2803
285 Ga0496113_0347950 3300048916 Bacteria 1189
286 Ga0496114_0008813 3300048917 Bacteria 7995
287 Ga0496114_0088317 3300048917 Unclassified 2630
288 Ga0496114_0118027 3300048917 Bacteria 2279
289 Ga0496114_0897248 3300048917 Bacteria 767
290 Ga0501032_0196627 3300049569 Bacteria 1317
291 Ga0501033_0500239 3300049570 Unclassified 841
292 Ga0501039_0035735 3300049575 Bacteria 3836
293 Ga0501039_0991245 3300049575 Bacteria 653
294 Ga0501040_0135611 3300049576 Bacteria 1733
295 Ga0501041_0015916 3300049577 Bacteria 4469
296 Ga0501043_0062126 3300049579 Unclassified 2933
297 Ga0501046_0254130 3300049580 Bacteria 1293
298 Ga0501067_0443883 3300049583 Bacteria 724
299 Ga0501068_0672448 3300049584 Unclassified 676
300 Ga0501069_0105575 3300049585 Bacteria 1601
301 Ga0501071_0065282 3300049587 Unclassified 2643
302 Ga0501071_0080174 3300049587 Unclassified 2386
303 Ga0501071_0211301 3300049587 Viruses 1459
304 Ga0501072_0100211 3300049588 Bacteria 2302
305 Ga0501073_0037042 3300049589 Bacteria 3465
306 Ga0501074_0350805 3300049590 Bacteria 1047
307 Ga0501075_0121573 3300049591 Bacteria 1987
308 Ga0501076_0047650 3300049592 Bacteria 3389
309 Ga0501076_0181778 3300049592 Unclassified 1714
310 Ga0501077_0525124 3300049593 Bacteria 759
311 Ga0501077_0685575 3300049593 Unclassified 658
312 Ga0501079_0259861 3300049741 Unclassified 1357
313 Ga0501080_0042852 3300049742 Bacteria 4213
314 Ga0501080_0930045 3300049742 Bacteria 757
315 Ga0501081_0020540 3300049743 Bacteria 4401
316 Ga0501083_0080405 3300049744 Bacteria 2161
317 Ga0501035_0852095 3300049822 Bacteria 725
318 Ga0501045_0169224 3300049824 Unclassified 1628
319 nmdc:mga05p37_47657_c1 3300050507 Bacteria 5269
320 nmdc:mga05p37_87402_c1 3300050507 Bacteria 3842
321 nmdc:mga09592_32337_c1 3300050508 Bacteria 4361
322 nmdc:mga06r32_67802_c1 3300050510 Bacteria 3445
323 nmdc:mga08y16_1305095_c1 3300050511 Bacteria 692
324 nmdc:mga08y16_140829_c1 3300050511 Bacteria 2508
325 nmdc:mga08y16_41163_c1 3300050511 Bacteria 4840
326 nmdc:mga08y16_833938_c1 3300050511 Bacteria 912
327 nmdc:mga0n895_106818_c1 3300050512 Bacteria 2813
328 nmdc:mga0n895_739347_c1 3300050512 Bacteria 977
329 nmdc:mga0rr50_152440_c1 3300050513 Bacteria 1869
330 nmdc:mga0a205_27314_c1 3300050515 Bacteria 5450
331 nmdc:mga0a205_53771_c1 3300050515 Bacteria 3887
332 nmdc:mga0a205_671624_c1 3300050515 Bacteria 887
333 Ga0495601_0020340 3300053077 Unclassified 4053
334 Ga0495612_0002179 3300053078 Bacteria 8062
335 Ga0495595_0089683 3300053084 Unclassified 1474
336 Ga0495619_0064510 3300053085 Bacteria 2442
337 Ga0501084_0016436 3300054114 Bacteria 6146
338 Ga0501084_0550113 3300054114 Unclassified 975
339 Ga0590075_002986 3300059424 Bacteria 4026
340 Ga0501082_0070734 3300060353 Bacteria 3004
341 Ga0530510_0090121 3300061734 Unclassified 2236
342 Ga0530510_0441997 3300061734 Unclassified 983
343 Ga0307407_10109220
344 rootL2_10156567
345 Ga0070690_100006230
346 Ga0070680_100179330
347 Ga0070682_101353502
348 Ga0068868_100347399
349 Ga0070660_100209329
350 Ga0070660_100993226
351 Ga0070661_100063922
352 Ga0070692_10036309
353 Ga0070692_10037094
354 Ga0070692_10053577
355 Ga0070669_100416687
356 Ga0070671_100328961
357 Ga0070674_100001621
358 Ga0070674_100246667
359 Ga0070688_100166328
360 Ga0070659_100150646
361 Ga0070703_10002857
362 Ga0070701_10599444
363 Ga0070705_100002274
364 Ga0070705_100056588
365 Ga0070705_100808734
366 Ga0070700_100095941
367 Ga0070700_100249809
368 Ga0070694_100011857
369 Ga0070694_100130160
370 Ga0070694_100343963
371 Ga0070694_100425621
372 Ga0070708_100006445
373 Ga0070708_100007911
374 Ga0070663_100568847
375 Ga0070678_100669988
376 Ga0070678_100707506
377 Ga0070678_101304178
378 Ga0070662_100072346
379 Ga0070662_100705120
380 Ga0068867_100005976
381 Ga0068867_100745194
382 Ga0070685_10011761
383 Ga0070706_100014412
384 Ga0070706_100026160
385 Ga0070706_100030281
386 Ga0070706_100039782
387 Ga0070707_100000163
388 Ga0070707_100012398
389 Ga0070707_100013412
390 Ga0070698_100278635
391 Ga0070699_100001296
392 Ga0070679_100221745
393 Ga0070684_100009868
394 Ga0070697_100393682
395 Ga0070697_100631798
396 Ga0070686_100024055
397 Ga0070695_100016528
398 Ga0070695_100030856
399 Ga0070695_100089150
400 Ga0070696_100011943
401 Ga0070696_100050420
402 Ga0070696_100157730
403 Ga0070665_100408686
404 Ga0070704_100035330
405 Ga0070704_100093957
406 Ga0070704_100104330
407 Ga0070704_100285263
408 Ga0070704_101004169
409 Ga0068855_100179565
410 Ga0070664_100307152
411 Ga0068857_101118371
412 Ga0068854_100991715
413 Ga0070702_100259965
414 Ga0068852_100268507
415 Ga0068859_101267446
416 Ga0068866_10139638
417 Ga0068866_10329003
418 Ga0068861_100057817
419 Ga0068861_100252269
420 Ga0068861_100327137
421 Ga0068870_10091331
422 Ga0068860_100412392
423 Ga0068862_100340665
424 Ga0068862_101367511
425 Ga0081455_10031355
426 Ga0081455_10419072
427 Ga0081539_10000111
428 Ga0081539_10048330
429 Ga0075365_10191949
430 Ga0075432_10005972
431 Ga0075428_100021719
432 Ga0075428_100294034
433 Ga0075428_100982010
434 Ga0075428_101758170
435 Ga0075431_100028255
436 Ga0075433_10007154
437 Ga0075433_10306143
438 Ga0075433_10934336
439 Ga0075434_100011689
440 Ga0075434_100281080
441 Ga0075434_101080677
442 Ga0075429_100144968
443 Ga0068865_100144979
444 Ga0097620_101267164
445 Ga0075435_100010522
446 Ga0111539_10014496
447 Ga0111539_10061046
448 Ga0111539_10166738
449 Ga0111539_11097971
450 Ga0105245_10079681
451 Ga0105245_10226306
452 Ga0105245_10970891
453 Ga0105245_11392496
454 Ga0114129_10140045
455 Ga0114129_10309505
456 Ga0105243_10317605
457 Ga0105243_11246809
458 Ga0105242_10029224
459 Ga0105248_10300568
460 Ga0105249_10198951
461 Ga0105249_10228434
462 Ga0105249_10475391
463 Ga0105239_10164434
464 Ga0105246_10523209
465 Ga0157371_10719102
466 Ga0157374_10202856
467 Ga0157378_10014506
468 Ga0157378_10541232
469 Ga0157378_11883148
470 Ga0163162_10324703
471 Ga0157375_10028168
472 Ga0157375_10074269
473 Ga0163163_10101102
474 Ga0163163_12126902
475 Ga0157380_10272387
476 Ga0157380_10316313
477 Ga0157377_10018352
478 Ga0157379_10409804
479 Ga0157379_10606037
480 Ga0157376_10187541
481 Ga0163161_10251397
482 Ga0163161_10316429
483 Ga0207642_10214178
484 Ga0207642_10264743
485 Ga0207688_10006798
486 Ga0207688_10295845
487 Ga0207647_10427602
488 Ga0207684_10006716
489 Ga0207684_10029005
490 Ga0207684_10150631
491 Ga0207684_10541541
492 Ga0207663_10215735
493 Ga0207660_10211287
494 Ga0207657_10018470
495 Ga0207657_10257027
496 Ga0207652_10641286
497 Ga0207646_10079532
498 Ga0207646_10572955
499 Ga0207681_10282637
500 Ga0207694_10576925
501 Ga0207650_10279895
502 Ga0207659_10271869
503 Ga0207687_11146499
504 Ga0207644_10099735
505 Ga0207690_10125570
506 Ga0207690_10816049
507 Ga0207690_10885320
508 Ga0207706_10019411
509 Ga0207706_10380575
510 Ga0207686_10368598
511 Ga0207709_11309898
512 Ga0207670_10057587
513 Ga0207669_10026613
514 Ga0207669_10174997
515 Ga0207704_10192008
516 Ga0207691_10138752
517 Ga0207689_10497151
518 Ga0207661_10430001
519 Ga0207679_10305795
520 Ga0207667_11504541
521 Ga0207712_10568962
522 Ga0207712_11458061
523 Ga0207640_10050146
524 Ga0207640_10349982
525 Ga0207677_10293604
526 Ga0207708_10001183
527 Ga0207648_10002606
528 Ga0207648_10662147
529 Ga0207676_10318421
530 Ga0207674_10004010
531 Ga0207675_100069557
532 Ga0207675_100205748
533 Ga0207675_100558244
534 Ga0207675_101209694
535 Ga0207683_10376797
536 Ga0207428_10041424
537 Ga0207428_10118903
538 Ga0268266_10080810
539 Ga0268265_10871419
540 Ga0268265_10936580
541 Ga0268265_11111102
542 Ga0268264_10142290
543 Ga0268264_10182380
544 Ga0307408_100037030
545 Ga0307408_100423953
546 Ga0307405_10262874
547 Ga0307405_10896763
548 Ga0307413_10006601
549 Ga0307410_10006087
550 Ga0307410_10034067
551 Ga0307410_10073647
552 Ga0307410_10876136
553 Ga0307406_10134292
554 Ga0307406_10149679
555 Ga0307412_10068278
556 Ga0307409_100001743
557 Ga0307409_100132276
558 Ga0307409_101247715
559 Ga0307416_100084036
560 Ga0307416_100102594
561 Ga0307416_100254971
562 Ga0307416_100821067
563 Ga0307416_101976273
564 Ga0307414_10022358
565 Ga0307414_10069310
566 Ga0307411_10021942
567 Ga0307415_100015580
568 Ga0307415_100171233
569 Ga0373951_0050677
570 Ga0373936_0488440
571 Ga0373947_0043029
572 Ga0373925_0375287
573 Ga0395898_0014266
574 Ga0395901_0007545
575 Ga0436365_0087380
576 Ga0436365_0916590
577 Ga0436365_1206541
578 Ga0436362_1172430
579 Ga0439463_002772
580 Ga0439459_0078062
581 Ga0439464_0085008
582 Ga0451577_0121583
583 Ga0451577_0972825
584 Ga0439440_0002923
585 Ga0466963_0116834
586 Ga0466967_0111215
587 Ga0495629_0588801
588 Ga0495618_0216972
589 Ga0495628_0963038
590 Ga0495652_0427539
591 Ga0495656_0352780
592 Ga0495674_0056738
593 Ga0495684_0284200
594 Ga0496102_0002135
595 Ga0496102_0120731
596 Ga0496102_0167075
597 Ga0496102_0453369
598 Ga0496102_0649901
599 Ga0496103_0005159
600 Ga0496103_0046457
601 Ga0496104_0014000
602 Ga0496105_0014121
603 Ga0496105_0053353
604 Ga0496105_0140634
605 Ga0496106_0022526
606 Ga0496106_0025358
607 Ga0496106_0039250
608 Ga0496106_0055900
609 Ga0496107_0313431
610 Ga0496108_0007788
611 Ga0496108_0029747
612 Ga0496108_0140078
613 Ga0496108_1144345
614 Ga0496109_0007709
615 Ga0496109_0080099
616 Ga0496109_0221728
617 Ga0496109_0240854
618 Ga0496109_0347321
619 Ga0496110_0003563
620 Ga0496110_0545470
621 Ga0496110_0922321
622 Ga0496111_0032612
623 Ga0496112_0010185
624 Ga0496112_0077847
625 Ga0496112_1103380
626 Ga0496113_0062922
627 Ga0496113_0347950
628 Ga0496114_0008813
629 Ga0496114_0088317
630 Ga0496114_0118027
631 Ga0496114_0897248
632 Ga0501032_0196627
633 Ga0501033_0500239
634 Ga0501039_0035735
635 Ga0501039_0991245
636 Ga0501040_0135611
637 Ga0501041_0015916
638 Ga0501043_0062126
639 Ga0501046_0254130
640 Ga0501067_0443883
641 Ga0501068_0672448
642 Ga0501069_0105575
643 Ga0501071_0065282
644 Ga0501071_0080174
645 Ga0501071_0211301
646 Ga0501072_0100211
647 Ga0501073_0037042
648 Ga0501074_0350805
649 Ga0501075_0121573
650 Ga0501076_0047650
651 Ga0501076_0181778
652 Ga0501077_0525124
653 Ga0501077_0685575
654 Ga0501079_0259861
655 Ga0501080_0042852
656 Ga0501080_0930045
657 Ga0501081_0020540
658 Ga0501083_0080405
659 Ga0501035_0852095
660 Ga0501045_0169224
661 nmdc:mga05p37_47657_c1
662 nmdc:mga05p37_87402_c1
663 nmdc:mga09592_32337_c1
664 nmdc:mga06r32_67802_c1
665 nmdc:mga08y16_1305095_c1
666 nmdc:mga08y16_140829_c1
667 nmdc:mga08y16_41163_c1
668 nmdc:mga08y16_833938_c1
669 nmdc:mga0n895_106818_c1
670 nmdc:mga0n895_739347_c1
671 nmdc:mga0rr50_152440_c1
672 nmdc:mga0a205_27314_c1
673 nmdc:mga0a205_53771_c1
674 nmdc:mga0a205_671624_c1
675 Ga0495601_0020340
676 Ga0495612_0002179
677 Ga0495595_0089683
678 Ga0495619_0064510
679 Ga0501084_0016436
680 Ga0501084_0550113
681 Ga0590075_002986
682 Ga0501082_0070734
683 Ga0530510_0090121
684 Ga0530510_0441997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

85

177

0.91

PF00881

Nitroreductase

Nitroreductase family

39

97

0.89

PF14512

TM1586_NiRdase

Putative TM nitroreductase

34

202

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8866 11 161
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.8814 14 183
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.8808 16 183
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.8708 16 183
4g8s-assembly1.cif.gz_A crystal structure of a putative nitroreductase from geobacter sulfurreducens pca (target psi-013445) 0.8688 10 162
ID Description Score Start End Superfamily
3m5kB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8731 14 183 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8605 16 183 3.40.109.10
5j6cB00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8588 16 183 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8585 13 156 3.40.109.10
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8582 14 158 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A522PCX4-F1-model_v4 Nitroreductase 0.9744 11 119 GO:0016491
AF-A0A536BUV2-F1-model_v4 Nitroreductase domain-containing protein 0.9703 11 116 GO:0016491
AF-A0A363UCB4-F1-model_v4 Nitroreductase domain-containing protein 0.9677 11 183 GO:0016491
AF-A0A535CCV7-F1-model_v4 Nitroreductase 0.9643 11 183 GO:0016491
AF-A0A350WUU3-F1-model_v4 Nitroreductase 0.9641 11 183 GO:0016491

Map