F415169

General Info

Members Datasets Scaffolds Average Seq Length
342 207 684 113

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_12663253|Ga0157380_126632531
Length 120
Sequence MSIPVRKFDAIVVGAHYGMRDWLAQRITAAIMALYTVIVAVIVLINTPMRYAGWKALFEQGWMRVATLLFAVCLAWHAWVGVRDILMDYIKHDGLRLTLQVFTLLLLGAYLGWTVQILWR

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
130 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.12
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_12663253 3300014326 Bacteria 566
2 Ga0065707_10382539 3300005295 Bacteria 875
3 Ga0070676_10088354 3300005328 Bacteria 1893
4 Ga0070690_100016284 3300005330 Bacteria 4449
5 Ga0070670_100262415 3300005331 Bacteria 1506
6 Ga0070677_10201813 3300005333 Bacteria 960
7 Ga0068869_100707483 3300005334 Bacteria 860
8 Ga0070666_11204619 3300005335 Bacteria 564
9 Ga0070680_100053099 3300005336 Bacteria 3307
10 Ga0070689_100057103 3300005340 Bacteria 3029
11 Ga0070687_100324767 3300005343 Bacteria 984
12 Ga0070692_10009987 3300005345 Bacteria 4303
13 Ga0070692_10656051 3300005345 Bacteria 701
14 Ga0070668_100027602 3300005347 Bacteria 4310
15 Ga0070669_100073725 3300005353 Bacteria 2529
16 Ga0070669_100672296 3300005353 Bacteria 872
17 Ga0070675_100127069 3300005354 Bacteria 2170
18 Ga0070671_100471028 3300005355 Bacteria 1079
19 Ga0070688_100571268 3300005365 Bacteria 862
20 Ga0070709_10396800 3300005434 Bacteria 1029
21 Ga0070701_10289868 3300005438 Bacteria 1002
22 Ga0070701_10607794 3300005438 Bacteria 725
23 Ga0070705_100079523 3300005440 Bacteria 2008
24 Ga0070705_100398864 3300005440 Bacteria 1018
25 Ga0070705_100704366 3300005440 Bacteria 793
26 Ga0070700_100056682 3300005441 Bacteria 2457
27 Ga0070694_100005157 3300005444 Bacteria 7878
28 Ga0070694_100016847 3300005444 Bacteria 4608
29 Ga0070694_100130682 3300005444 Bacteria 1813
30 Ga0070694_100177201 3300005444 Bacteria 1574
31 Ga0070694_100724393 3300005444 Bacteria 810
32 Ga0070678_100508660 3300005456 Bacteria 1064
33 Ga0068867_100015380 3300005459 Bacteria 5426
34 Ga0070685_10273116 3300005466 Bacteria 1129
35 Ga0070685_10384390 3300005466 Bacteria 968
36 Ga0070707_100228469 3300005468 Bacteria 1812
37 Ga0070698_100155729 3300005471 Bacteria 2230
38 Ga0070699_101223988 3300005518 Bacteria 689
39 Ga0070684_100317989 3300005535 Bacteria 1430
40 Ga0070697_101061285 3300005536 Bacteria 721
41 Ga0070697_101716594 3300005536 Bacteria 562
42 Ga0070686_100071724 3300005544 Bacteria 2269
43 Ga0070695_100031452 3300005545 Bacteria 3311
44 Ga0070695_100137059 3300005545 Bacteria 1693
45 Ga0070695_101411974 3300005545 Bacteria 577
46 Ga0070696_100016449 3300005546 Bacteria 4981
47 Ga0070696_100361538 3300005546 Bacteria 1127
48 Ga0070696_100574967 3300005546 Bacteria 906
49 Ga0070696_100617454 3300005546 Bacteria 876
50 Ga0070696_100645355 3300005546 Bacteria 858
51 Ga0070696_100924413 3300005546 Bacteria 725
52 Ga0070696_101876358 3300005546 Bacteria 519
53 Ga0070693_100136587 3300005547 Bacteria 1539
54 Ga0070693_100273321 3300005547 Bacteria 1129
55 Ga0070693_100476270 3300005547 Bacteria 881
56 Ga0070693_100982620 3300005547 Bacteria 637
57 Ga0070704_100023764 3300005549 Bacteria 4010
58 Ga0070704_100024892 3300005549 Bacteria 3932
59 Ga0070704_100131769 3300005549 Bacteria 1939
60 Ga0070704_100442725 3300005549 Bacteria 1117
61 Ga0070704_100453916 3300005549 Bacteria 1104
62 Ga0070704_100764149 3300005549 Bacteria 861
63 Ga0070704_102287672 3300005549 Bacteria 503
64 Ga0068856_100240684 3300005614 Bacteria 1825
65 Ga0070702_100193091 3300005615 Bacteria 1341
66 Ga0070702_100237786 3300005615 Bacteria 1227
67 Ga0068859_100124973 3300005617 Bacteria 2641
68 Ga0068866_10149533 3300005718 Bacteria 1351
69 Ga0068861_100017148 3300005719 Bacteria 5135
70 Ga0068861_100291400 3300005719 Bacteria 1410
71 Ga0068851_10340726 3300005834 Bacteria 870
72 Ga0068870_10088236 3300005840 Bacteria 1728
73 Ga0068863_102380180 3300005841 Bacteria 539
74 Ga0068862_100012365 3300005844 Bacteria 7057
75 Ga0068862_100235205 3300005844 Bacteria 1663
76 Ga0068862_100318641 3300005844 Bacteria 1434
77 Ga0068862_102050193 3300005844 Bacteria 583
78 Ga0081538_10027524 3300005981 Bacteria 3939
79 Ga0070715_10644945 3300006163 Bacteria 626
80 Ga0075366_10710930 3300006195 Bacteria 624
81 Ga0097621_100048136 3300006237 Bacteria 3457
82 Ga0097621_100998970 3300006237 Bacteria 783
83 Ga0097621_101750324 3300006237 Bacteria 592
84 Ga0068871_100000966 3300006358 Bacteria 19210
85 Ga0068871_102289416 3300006358 Bacteria 515
86 Ga0075428_100306066 3300006844 Bacteria 1708
87 Ga0075428_101513245 3300006844 Bacteria 703
88 Ga0075430_100000120 3300006846 Bacteria 48405
89 Ga0075431_100028405 3300006847 Bacteria 5748
90 Ga0075431_100299788 3300006847 Bacteria 1624
91 Ga0075431_100665504 3300006847 Bacteria 1021
92 Ga0075433_10372747 3300006852 Bacteria 1260
93 Ga0075433_10457488 3300006852 Bacteria 1125
94 Ga0075434_100014225 3300006871 Bacteria 7602
95 Ga0075429_100156726 3300006880 Bacteria 1994
96 Ga0075429_100427878 3300006880 Bacteria 1159
97 Ga0068865_100087286 3300006881 Bacteria 2254
98 Ga0068865_101342174 3300006881 Bacteria 637
99 Ga0097620_100124970 3300006931 Bacteria 2641
100 Ga0099794_10019964 3300007265 Bacteria 3028
101 Ga0111539_10325547 3300009094 Bacteria 1789
102 Ga0111539_10416960 3300009094 Bacteria 1564
103 Ga0111539_10463148 3300009094 Bacteria 1476
104 Ga0111539_11201414 3300009094 Bacteria 881
105 Ga0111539_11868567 3300009094 Bacteria 696
106 Ga0105245_10037633 3300009098 Bacteria 4302
107 Ga0105245_11350614 3300009098 Bacteria 762
108 Ga0114129_10711080 3300009147 Bacteria 1290
109 Ga0105243_10261221 3300009148 Bacteria 1550
110 Ga0105243_10333706 3300009148 Bacteria 1386
111 Ga0105242_10037938 3300009176 Bacteria 3872
112 Ga0105242_10639870 3300009176 Bacteria 1033
113 Ga0105242_11362998 3300009176 Bacteria 735
114 Ga0105248_10312052 3300009177 Bacteria 1771
115 Ga0105248_13095129 3300009177 Bacteria 529
116 Ga0105238_11721062 3300009551 Bacteria 658
117 Ga0105249_10041097 3300009553 Bacteria 4203
118 Ga0157378_10856271 3300013297 Bacteria 938
119 Ga0157378_11039327 3300013297 Bacteria 855
120 Ga0157375_10193850 3300013308 Bacteria 2187
121 Ga0157380_10072770 3300014326 Bacteria 2785
122 Ga0157380_10185777 3300014326 Bacteria 1830
123 Ga0157380_10187618 3300014326 Bacteria 1822
124 Ga0157377_10047299 3300014745 Bacteria 2410
125 Ga0157377_10623155 3300014745 Bacteria 773
126 Ga0157377_11398632 3300014745 Bacteria 552
127 Ga0157379_11186721 3300014968 Bacteria 734
128 Ga0157376_10015647 3300014969 Bacteria 5737
129 Ga0207682_10308211 3300025893 Bacteria 743
130 Ga0207642_10035463 3300025899 Bacteria 2131
131 Ga0207680_10647653 3300025903 Bacteria 756
132 Ga0207680_11226536 3300025903 Bacteria 534
133 Ga0207685_10455930 3300025905 Bacteria 666
134 Ga0207699_11272180 3300025906 Bacteria 544
135 Ga0207643_10075401 3300025908 Bacteria 1946
136 Ga0207643_10801193 3300025908 Bacteria 610
137 Ga0207660_10130514 3300025917 Bacteria 1912
138 Ga0207662_10043804 3300025918 Bacteria 2641
139 Ga0207662_10323546 3300025918 Bacteria 1030
140 Ga0207646_10654244 3300025922 Bacteria 941
141 Ga0207681_10271391 3300025923 Bacteria 1331
142 Ga0207694_10845662 3300025924 Bacteria 773
143 Ga0207659_10275622 3300025926 Bacteria 1373
144 Ga0207687_10185912 3300025927 Bacteria 1613
145 Ga0207690_11622870 3300025932 Bacteria 540
146 Ga0207686_10289065 3300025934 Bacteria 1213
147 Ga0207709_10012999 3300025935 Bacteria 4589
148 Ga0207709_10354405 3300025935 Bacteria 1109
149 Ga0207670_10018478 3300025936 Bacteria 4238
150 Ga0207670_11893444 3300025936 Bacteria 507
151 Ga0207691_10449678 3300025940 Bacteria 1096
152 Ga0207691_10473665 3300025940 Bacteria 1064
153 Ga0207661_10032143 3300025944 Bacteria 4063
154 Ga0207651_11180164 3300025960 Bacteria 687
155 Ga0207712_10001602 3300025961 Bacteria 15219
156 Ga0207668_10012280 3300025972 Bacteria 5237
157 Ga0207708_10014579 3300026075 Bacteria 5879
158 Ga0207708_11166374 3300026075 Bacteria 673
159 Ga0207708_11610012 3300026075 Bacteria 571
160 Ga0207708_11890932 3300026075 Bacteria 523
161 Ga0207702_10480657 3300026078 Bacteria 1209
162 Ga0207648_10007670 3300026089 Bacteria 10561
163 Ga0207676_11559297 3300026095 Bacteria 658
164 Ga0207675_100003428 3300026118 Bacteria 15491
165 Ga0207675_102553038 3300026118 Bacteria 521
166 Ga0207683_10510211 3300026121 Bacteria 1111
167 Ga0209999_1018321 3300027543 Bacteria 1281
168 Ga0209966_1009914 3300027695 Bacteria 1708
169 Ga0207428_10027888 3300027907 Bacteria 4697
170 Ga0207428_10139166 3300027907 Bacteria 1854
171 Ga0207428_10252014 3300027907 Bacteria 1316
172 Ga0207428_10772775 3300027907 Bacteria 684
173 Ga0268265_10000718 3300028380 Bacteria 32453
174 Ga0268265_10137070 3300028380 Bacteria 2043
175 Ga0268265_10442956 3300028380 Bacteria 1211
176 Ga0268265_11045100 3300028380 Bacteria 809
177 Ga0268265_11181437 3300028380 Bacteria 762
178 Ga0307408_100529621 3300031548 Bacteria 1036
179 Ga0307408_101461740 3300031548 Bacteria 645
180 Ga0307405_10443811 3300031731 Bacteria 1027
181 Ga0307405_10992280 3300031731 Bacteria 716
182 Ga0307412_10166979 3300031911 Bacteria 1642
183 Ga0307416_100104947 3300032002 Bacteria 2472
184 Ga0307416_100140079 3300032002 Bacteria 2197
185 Ga0307411_10119876 3300032005 Bacteria 1901
186 Ga0373930_0156218 3300034816 Bacteria 575
187 Ga0373950_0040459 3300034818 Bacteria 891
188 Ga0373958_0040872 3300034819 Bacteria 947
189 Ga0373934_0068573 3300035086 Bacteria 1417
190 Ga0373934_0132553 3300035086 Bacteria 1017
191 Ga0373945_0039262 3300035116 Bacteria 1706
192 Ga0373954_0000041 3300035118 Bacteria 47425
193 Ga0373954_0302013 3300035118 Bacteria 790
194 Ga0373956_0148739 3300035119 Bacteria 1102
195 Ga0373956_0209152 3300035119 Bacteria 925
196 Ga0373957_0070197 3300035120 Bacteria 1369
197 Ga0373960_0037332 3300035121 Bacteria 1388
198 Ga0373960_0125855 3300035121 Bacteria 855
199 Ga0373946_0572670 3300035171 Bacteria 584
200 Ga0373955_0270244 3300035172 Bacteria 1022
201 Ga0373942_0004264 3300035207 Bacteria 3329
202 Ga0373942_0039745 3300035207 Bacteria 1281
203 Ga0373962_0142801 3300035242 Bacteria 779
204 Ga0316574_0003483 3300035398 Bacteria 8121
205 Ga0373931_0178131 3300035691 Bacteria 1257
206 Ga0373931_0466762 3300035691 Bacteria 810
207 Ga0373931_1115654 3300035691 Bacteria 537
208 Ga0373927_0700488 3300035695 Bacteria 669
209 Ga0373937_0001252 3300036401 Bacteria 21351
210 Ga0373937_0030042 3300036401 Bacteria 4922
211 Ga0373937_0094823 3300036401 Bacteria 2767
212 Ga0373937_0322208 3300036401 Bacteria 1462
213 Ga0373925_0154141 3300037068 Bacteria 1806
214 Ga0242420_056640 3300038996 Bacteria 775
215 Ga0451807_1040894 3300041486 Bacteria 896
216 Ga0439441_020016 3300042001 Bacteria 1223
217 Ga0439441_020098 3300042001 Bacteria 1221
218 Ga0450923_072518 3300042125 Bacteria 765
219 Ga0439446_0132408 3300042156 Bacteria 809
220 Ga0451577_0344969 3300042876 Bacteria 1351
221 Ga0466963_0312220 3300044694 Bacteria 1106
222 Ga0451576_0246300 3300045051 Bacteria 1868
223 Ga0451576_1196629 3300045051 Bacteria 794
224 Ga0466967_0054640 3300045976 Bacteria 3516
225 Ga0495592_0005415 3300046454 Bacteria 9422
226 Ga0495641_0057102 3300046461 Bacteria 1768
227 Ga0495639_0464597 3300046475 Bacteria 644
228 Ga0495662_0005900 3300046476 Bacteria 6126
229 Ga0495662_0010126 3300046476 Bacteria 4624
230 Ga0495584_0239788 3300046491 Bacteria 922
231 Ga0495608_0002187 3300046511 Bacteria 14109
232 Ga0495608_0124164 3300046511 Bacteria 1654
233 Ga0495618_0061751 3300046514 Bacteria 2377
234 Ga0495628_0010767 3300046516 Bacteria 7743
235 Ga0495630_0013171 3300046517 Bacteria 6012
236 Ga0495630_0151960 3300046517 Bacteria 1762
237 Ga0495644_0151304 3300046523 Bacteria 888
238 Ga0495666_0096278 3300046526 Bacteria 1395
239 Ga0495652_0102743 3300046529 Bacteria 2315
240 Ga0495640_0001212 3300046533 Bacteria 20170
241 Ga0495640_0091167 3300046533 Bacteria 2011
242 Ga0495586_0000572 3300046535 Bacteria 21366
243 Ga0495587_0019186 3300046536 Bacteria 4236
244 Ga0495598_0035555 3300046537 Bacteria 1427
245 Ga0495598_0373870 3300046537 Bacteria 553
246 Ga0495667_0087181 3300046559 Bacteria 2024
247 Ga0495656_0008231 3300046615 Bacteria 3717
248 Ga0495634_0009538 3300046642 Bacteria 7160
249 Ga0495634_0739696 3300046642 Bacteria 563
250 Ga0495635_0170546 3300046663 Bacteria 1480
251 Ga0495659_0136877 3300046664 Bacteria 975
252 Ga0495647_0193907 3300046681 Bacteria 889
253 Ga0495658_0016508 3300046683 Bacteria 3800
254 Ga0495658_0069238 3300046683 Bacteria 2045
255 Ga0495613_0003939 3300046689 Bacteria 11119
256 Ga0495600_0015027 3300046809 Bacteria 4889
257 Ga0495581_0162393 3300047315 Bacteria 1306
258 Ga0495604_0031957 3300047317 Bacteria 4173
259 Ga0495636_0165671 3300047318 Bacteria 997
260 Ga0495674_0104472 3300047319 Bacteria 2408
261 Ga0495674_0235308 3300047319 Bacteria 1511
262 Ga0495680_0001126 3300047322 Bacteria 29477
263 Ga0495593_0123800 3300047673 Bacteria 1315
264 Ga0495615_0318708 3300048090 Bacteria 507
265 Ga0501298_103614 3300049521 Bacteria 652
266 Ga0501299_118656 3300049522 Bacteria 635
267 Ga0501031_0675552 3300049568 Bacteria 663
268 Ga0501036_0123210 3300049572 Bacteria 2189
269 Ga0501037_0408314 3300049573 Bacteria 931
270 Ga0501037_0692979 3300049573 Bacteria 678
271 Ga0501038_1233608 3300049574 Bacteria 542
272 Ga0501039_0018353 3300049575 Bacteria 5369
273 Ga0501039_0189976 3300049575 Bacteria 1615
274 Ga0501040_0167037 3300049576 Bacteria 1557
275 Ga0501040_0275428 3300049576 Bacteria 1202
276 Ga0501040_0881904 3300049576 Bacteria 648
277 Ga0501040_1009070 3300049576 Unclassified 603
278 Ga0501041_0003516 3300049577 Bacteria 9016
279 Ga0501042_0419247 3300049578 Bacteria 970
280 Ga0501042_0531770 3300049578 Bacteria 854
281 Ga0501042_0537055 3300049578 Bacteria 850
282 Ga0501042_0573919 3300049578 Bacteria 820
283 Ga0501046_0404260 3300049580 Bacteria 986
284 Ga0501046_0452751 3300049580 Bacteria 923
285 Ga0501046_0939197 3300049580 Bacteria 602
286 Ga0501048_0140908 3300049582 Bacteria 1705
287 Ga0501048_0335447 3300049582 Bacteria 1078
288 Ga0501048_0571312 3300049582 Bacteria 811
289 Ga0501048_0918001 3300049582 Bacteria 630
290 Ga0501068_0036658 3300049584 Bacteria 2934
291 Ga0501071_0005914 3300049587 Bacteria 7914
292 Ga0501071_0565951 3300049587 Bacteria 873
293 Ga0501072_0006749 3300049588 Bacteria 8719
294 Ga0501072_0019197 3300049588 Bacteria 5281
295 Ga0501072_0065066 3300049588 Bacteria 2875
296 Ga0501072_0166638 3300049588 Bacteria 1758
297 Ga0501072_1086055 3300049588 Bacteria 623
298 Ga0501073_0081006 3300049589 Bacteria 2258
299 Ga0501075_0010801 3300049591 Bacteria 6433
300 Ga0501075_0044510 3300049591 Bacteria 3330
301 Ga0501076_0043588 3300049592 Bacteria 3536
302 Ga0501076_0274805 3300049592 Bacteria 1380
303 Ga0501076_0401470 3300049592 Bacteria 1127
304 Ga0501076_1106006 3300049592 Bacteria 652
305 Ga0501077_0056431 3300049593 Bacteria 2493
306 Ga0501217_105588 3300049661 Bacteria 805
307 Ga0501225_0059171 3300049705 Bacteria 1076
308 Ga0501079_0080628 3300049741 Bacteria 2516
309 Ga0501079_0081260 3300049741 Bacteria 2506
310 Ga0501080_0000836 3300049742 Bacteria 25138
311 Ga0501080_1713014 3300049742 Bacteria 530
312 Ga0501081_0005654 3300049743 Bacteria 8087
313 Ga0501081_0038961 3300049743 Bacteria 3250
314 Ga0501035_0696633 3300049822 Bacteria 820
315 Ga0501044_1073821 3300049823 Bacteria 675
316 Ga0501045_0013774 3300049824 Bacteria 5717
317 Ga0501045_0706411 3300049824 Bacteria 744
318 nmdc:mga0k408_697692_c1 3300050493 Bacteria 595
319 nmdc:mga05p37_1888985_c1 3300050507 Bacteria 571
320 nmdc:mga05p37_1949166_c1 3300050507 Bacteria 558
321 nmdc:mga09592_320557_c1 3300050508 Bacteria 1343
322 nmdc:mga09592_340172_c1 3300050508 Bacteria 1299
323 nmdc:mga0qj67_1344651_c1 3300050509 Bacteria 553
324 nmdc:mga0qj67_2078_c1 3300050509 Bacteria 14287
325 nmdc:mga0qj67_22518_c1 3300050509 Bacteria 4839
326 nmdc:mga06r32_466338_c1 3300050510 Bacteria 1242
327 nmdc:mga06r32_603471_c1 3300050510 Bacteria 1068
328 nmdc:mga06r32_72126_c1 3300050510 Bacteria 3343
329 nmdc:mga06r32_8872_c1 3300050510 Bacteria 9061
330 nmdc:mga08y16_52289_c1 3300050511 Bacteria 4274
331 nmdc:mga08y16_58269_c1 3300050511 Bacteria 4036
332 nmdc:mga08y16_75444_c1 3300050511 Bacteria 3515
333 nmdc:mga0n895_47913_c1 3300050512 Bacteria 4181
334 nmdc:mga0n895_946403_c1 3300050512 Bacteria 845
335 nmdc:mga0rr50_781311_c1 3300050513 Bacteria 815
336 nmdc:mga0a205_442521_c1 3300050515 Bacteria 1160
337 nmdc:mga0a205_78288_c1 3300050515 Bacteria 3194
338 Ga0495619_0189274 3300053085 Bacteria 1424
339 Ga0501084_0084163 3300054114 Bacteria 2670
340 Ga0501082_0008753 3300060353 Bacteria 8725
341 Ga0530510_0000825 3300061734 Bacteria 20335
342 Ga0530510_0410892 3300061734 Bacteria 1021
343 Ga0157380_12663253
344 Ga0065707_10382539
345 Ga0070676_10088354
346 Ga0070690_100016284
347 Ga0070670_100262415
348 Ga0070677_10201813
349 Ga0068869_100707483
350 Ga0070666_11204619
351 Ga0070680_100053099
352 Ga0070689_100057103
353 Ga0070687_100324767
354 Ga0070692_10009987
355 Ga0070692_10656051
356 Ga0070668_100027602
357 Ga0070669_100073725
358 Ga0070669_100672296
359 Ga0070675_100127069
360 Ga0070671_100471028
361 Ga0070688_100571268
362 Ga0070709_10396800
363 Ga0070701_10289868
364 Ga0070701_10607794
365 Ga0070705_100079523
366 Ga0070705_100398864
367 Ga0070705_100704366
368 Ga0070700_100056682
369 Ga0070694_100005157
370 Ga0070694_100016847
371 Ga0070694_100130682
372 Ga0070694_100177201
373 Ga0070694_100724393
374 Ga0070678_100508660
375 Ga0068867_100015380
376 Ga0070685_10273116
377 Ga0070685_10384390
378 Ga0070707_100228469
379 Ga0070698_100155729
380 Ga0070699_101223988
381 Ga0070684_100317989
382 Ga0070697_101061285
383 Ga0070697_101716594
384 Ga0070686_100071724
385 Ga0070695_100031452
386 Ga0070695_100137059
387 Ga0070695_101411974
388 Ga0070696_100016449
389 Ga0070696_100361538
390 Ga0070696_100574967
391 Ga0070696_100617454
392 Ga0070696_100645355
393 Ga0070696_100924413
394 Ga0070696_101876358
395 Ga0070693_100136587
396 Ga0070693_100273321
397 Ga0070693_100476270
398 Ga0070693_100982620
399 Ga0070704_100023764
400 Ga0070704_100024892
401 Ga0070704_100131769
402 Ga0070704_100442725
403 Ga0070704_100453916
404 Ga0070704_100764149
405 Ga0070704_102287672
406 Ga0068856_100240684
407 Ga0070702_100193091
408 Ga0070702_100237786
409 Ga0068859_100124973
410 Ga0068866_10149533
411 Ga0068861_100017148
412 Ga0068861_100291400
413 Ga0068851_10340726
414 Ga0068870_10088236
415 Ga0068863_102380180
416 Ga0068862_100012365
417 Ga0068862_100235205
418 Ga0068862_100318641
419 Ga0068862_102050193
420 Ga0081538_10027524
421 Ga0070715_10644945
422 Ga0075366_10710930
423 Ga0097621_100048136
424 Ga0097621_100998970
425 Ga0097621_101750324
426 Ga0068871_100000966
427 Ga0068871_102289416
428 Ga0075428_100306066
429 Ga0075428_101513245
430 Ga0075430_100000120
431 Ga0075431_100028405
432 Ga0075431_100299788
433 Ga0075431_100665504
434 Ga0075433_10372747
435 Ga0075433_10457488
436 Ga0075434_100014225
437 Ga0075429_100156726
438 Ga0075429_100427878
439 Ga0068865_100087286
440 Ga0068865_101342174
441 Ga0097620_100124970
442 Ga0099794_10019964
443 Ga0111539_10325547
444 Ga0111539_10416960
445 Ga0111539_10463148
446 Ga0111539_11201414
447 Ga0111539_11868567
448 Ga0105245_10037633
449 Ga0105245_11350614
450 Ga0114129_10711080
451 Ga0105243_10261221
452 Ga0105243_10333706
453 Ga0105242_10037938
454 Ga0105242_10639870
455 Ga0105242_11362998
456 Ga0105248_10312052
457 Ga0105248_13095129
458 Ga0105238_11721062
459 Ga0105249_10041097
460 Ga0157378_10856271
461 Ga0157378_11039327
462 Ga0157375_10193850
463 Ga0157380_10072770
464 Ga0157380_10185777
465 Ga0157380_10187618
466 Ga0157377_10047299
467 Ga0157377_10623155
468 Ga0157377_11398632
469 Ga0157379_11186721
470 Ga0157376_10015647
471 Ga0207682_10308211
472 Ga0207642_10035463
473 Ga0207680_10647653
474 Ga0207680_11226536
475 Ga0207685_10455930
476 Ga0207699_11272180
477 Ga0207643_10075401
478 Ga0207643_10801193
479 Ga0207660_10130514
480 Ga0207662_10043804
481 Ga0207662_10323546
482 Ga0207646_10654244
483 Ga0207681_10271391
484 Ga0207694_10845662
485 Ga0207659_10275622
486 Ga0207687_10185912
487 Ga0207690_11622870
488 Ga0207686_10289065
489 Ga0207709_10012999
490 Ga0207709_10354405
491 Ga0207670_10018478
492 Ga0207670_11893444
493 Ga0207691_10449678
494 Ga0207691_10473665
495 Ga0207661_10032143
496 Ga0207651_11180164
497 Ga0207712_10001602
498 Ga0207668_10012280
499 Ga0207708_10014579
500 Ga0207708_11166374
501 Ga0207708_11610012
502 Ga0207708_11890932
503 Ga0207702_10480657
504 Ga0207648_10007670
505 Ga0207676_11559297
506 Ga0207675_100003428
507 Ga0207675_102553038
508 Ga0207683_10510211
509 Ga0209999_1018321
510 Ga0209966_1009914
511 Ga0207428_10027888
512 Ga0207428_10139166
513 Ga0207428_10252014
514 Ga0207428_10772775
515 Ga0268265_10000718
516 Ga0268265_10137070
517 Ga0268265_10442956
518 Ga0268265_11045100
519 Ga0268265_11181437
520 Ga0307408_100529621
521 Ga0307408_101461740
522 Ga0307405_10443811
523 Ga0307405_10992280
524 Ga0307412_10166979
525 Ga0307416_100104947
526 Ga0307416_100140079
527 Ga0307411_10119876
528 Ga0373930_0156218
529 Ga0373950_0040459
530 Ga0373958_0040872
531 Ga0373934_0068573
532 Ga0373934_0132553
533 Ga0373945_0039262
534 Ga0373954_0000041
535 Ga0373954_0302013
536 Ga0373956_0148739
537 Ga0373956_0209152
538 Ga0373957_0070197
539 Ga0373960_0037332
540 Ga0373960_0125855
541 Ga0373946_0572670
542 Ga0373955_0270244
543 Ga0373942_0004264
544 Ga0373942_0039745
545 Ga0373962_0142801
546 Ga0316574_0003483
547 Ga0373931_0178131
548 Ga0373931_0466762
549 Ga0373931_1115654
550 Ga0373927_0700488
551 Ga0373937_0001252
552 Ga0373937_0030042
553 Ga0373937_0094823
554 Ga0373937_0322208
555 Ga0373925_0154141
556 Ga0242420_056640
557 Ga0451807_1040894
558 Ga0439441_020016
559 Ga0439441_020098
560 Ga0450923_072518
561 Ga0439446_0132408
562 Ga0451577_0344969
563 Ga0466963_0312220
564 Ga0451576_0246300
565 Ga0451576_1196629
566 Ga0466967_0054640
567 Ga0495592_0005415
568 Ga0495641_0057102
569 Ga0495639_0464597
570 Ga0495662_0005900
571 Ga0495662_0010126
572 Ga0495584_0239788
573 Ga0495608_0002187
574 Ga0495608_0124164
575 Ga0495618_0061751
576 Ga0495628_0010767
577 Ga0495630_0013171
578 Ga0495630_0151960
579 Ga0495644_0151304
580 Ga0495666_0096278
581 Ga0495652_0102743
582 Ga0495640_0001212
583 Ga0495640_0091167
584 Ga0495586_0000572
585 Ga0495587_0019186
586 Ga0495598_0035555
587 Ga0495598_0373870
588 Ga0495667_0087181
589 Ga0495656_0008231
590 Ga0495634_0009538
591 Ga0495634_0739696
592 Ga0495635_0170546
593 Ga0495659_0136877
594 Ga0495647_0193907
595 Ga0495658_0016508
596 Ga0495658_0069238
597 Ga0495613_0003939
598 Ga0495600_0015027
599 Ga0495581_0162393
600 Ga0495604_0031957
601 Ga0495636_0165671
602 Ga0495674_0104472
603 Ga0495674_0235308
604 Ga0495680_0001126
605 Ga0495593_0123800
606 Ga0495615_0318708
607 Ga0501298_103614
608 Ga0501299_118656
609 Ga0501031_0675552
610 Ga0501036_0123210
611 Ga0501037_0408314
612 Ga0501037_0692979
613 Ga0501038_1233608
614 Ga0501039_0018353
615 Ga0501039_0189976
616 Ga0501040_0167037
617 Ga0501040_0275428
618 Ga0501040_0881904
619 Ga0501040_1009070
620 Ga0501041_0003516
621 Ga0501042_0419247
622 Ga0501042_0531770
623 Ga0501042_0537055
624 Ga0501042_0573919
625 Ga0501046_0404260
626 Ga0501046_0452751
627 Ga0501046_0939197
628 Ga0501048_0140908
629 Ga0501048_0335447
630 Ga0501048_0571312
631 Ga0501048_0918001
632 Ga0501068_0036658
633 Ga0501071_0005914
634 Ga0501071_0565951
635 Ga0501072_0006749
636 Ga0501072_0019197
637 Ga0501072_0065066
638 Ga0501072_0166638
639 Ga0501072_1086055
640 Ga0501073_0081006
641 Ga0501075_0010801
642 Ga0501075_0044510
643 Ga0501076_0043588
644 Ga0501076_0274805
645 Ga0501076_0401470
646 Ga0501076_1106006
647 Ga0501077_0056431
648 Ga0501217_105588
649 Ga0501225_0059171
650 Ga0501079_0080628
651 Ga0501079_0081260
652 Ga0501080_0000836
653 Ga0501080_1713014
654 Ga0501081_0005654
655 Ga0501081_0038961
656 Ga0501035_0696633
657 Ga0501044_1073821
658 Ga0501045_0013774
659 Ga0501045_0706411
660 nmdc:mga0k408_697692_c1
661 nmdc:mga05p37_1888985_c1
662 nmdc:mga05p37_1949166_c1
663 nmdc:mga09592_320557_c1
664 nmdc:mga09592_340172_c1
665 nmdc:mga0qj67_1344651_c1
666 nmdc:mga0qj67_2078_c1
667 nmdc:mga0qj67_22518_c1
668 nmdc:mga06r32_466338_c1
669 nmdc:mga06r32_603471_c1
670 nmdc:mga06r32_72126_c1
671 nmdc:mga06r32_8872_c1
672 nmdc:mga08y16_52289_c1
673 nmdc:mga08y16_58269_c1
674 nmdc:mga08y16_75444_c1
675 nmdc:mga0n895_47913_c1
676 nmdc:mga0n895_946403_c1
677 nmdc:mga0rr50_781311_c1
678 nmdc:mga0a205_442521_c1
679 nmdc:mga0a205_78288_c1
680 Ga0495619_0189274
681 Ga0501084_0084163
682 Ga0501082_0008753
683 Ga0530510_0000825
684 Ga0530510_0410892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

6

112

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.9338 11 111
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.9312 11 111
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.93 14 111
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.9299 11 111
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.9276 11 111
ID Description Score Start End Superfamily
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9337 11 111 1.20.1300.10
2wdrL00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9308 11 111 1.20.1300.10
2wdqD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.93 11 111 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9277 11 111 1.20.1300.10
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8921 11 111 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A839I047-F1-model_v4 deleted 0.969 28 111
AF-A0A837Q7L2-F1-model_v4 deleted 0.9613 18 112
AF-A0A1Y0G7F2-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9543 12 112 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A3B0X461-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor protein 0.9526 17 110 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A1G0IQ42-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9525 11 112 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872

Map