F415122

General Info

Members Datasets Scaffolds Average Seq Length
342 215 684 178

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100165465|Ga0068865_1001654652
Length 218
Sequence VPATPARAVPRRAMDRAKVPVVRPPRLVVGSVLTAALALVALPGFAGSRAPSPVEPIPAVAFQQLTIPAGESRSTTSIGPLDDAFASDGALGAETAIVEPAAIGAGILAARPKVDQPGGGAGSERKEPPGALSASLPGKAKYTLSGGATFYDHGTTAMRLPRGTVVKICGKGGCIVRVVNDYGPQRKSRVVDLYRPDFFRVCGCPSWSGTTQVTVYVY

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.19
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 18.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100165465 3300006881 Unclassified 1691
2 Ga0070683_100061291 3300005329 Bacteria 3498
3 Ga0070690_100022498 3300005330 Bacteria 3856
4 Ga0070670_100277790 3300005331 Bacteria 1462
5 Ga0070677_10093771 3300005333 Bacteria 1311
6 Ga0068869_100289655 3300005334 Bacteria 1319
7 Ga0070666_10443940 3300005335 Bacteria 936
8 Ga0070680_100000216 3300005336 Bacteria 38019
9 Ga0070680_100225021 3300005336 Bacteria 1584
10 Ga0070682_100379194 3300005337 Bacteria 1063
11 Ga0068868_100009379 3300005338 Bacteria 7037
12 Ga0068868_100169950 3300005338 Bacteria 1804
13 Ga0070689_100027014 3300005340 Bacteria 4325
14 Ga0070689_100105503 3300005340 Bacteria 2235
15 Ga0070687_100001090 3300005343 Bacteria 9328
16 Ga0070692_10014783 3300005345 Bacteria 3676
17 Ga0070668_100096222 3300005347 Bacteria 2340
18 Ga0070669_100039561 3300005353 Bacteria 3427
19 Ga0070675_100008213 3300005354 Bacteria 8097
20 Ga0070671_100211747 3300005355 Bacteria 1644
21 Ga0070674_100010467 3300005356 Bacteria 5609
22 Ga0070673_100102315 3300005364 Bacteria 2361
23 Ga0070688_100024048 3300005365 Bacteria 3589
24 Ga0070659_100026592 3300005366 Bacteria 4453
25 Ga0070701_10001543 3300005438 Bacteria 8547
26 Ga0070705_100060414 3300005440 Unclassified 2248
27 Ga0070700_100166236 3300005441 Bacteria 1524
28 Ga0070700_100180816 3300005441 Unclassified 1468
29 Ga0070708_100011844 3300005445 Bacteria 7098
30 Ga0070708_100288231 3300005445 Bacteria 1546
31 Ga0070708_100551956 3300005445 Bacteria 1087
32 Ga0070708_101120197 3300005445 Bacteria 737
33 Ga0070663_100040969 3300005455 Bacteria 3246
34 Ga0070663_100337664 3300005455 Unclassified 1216
35 Ga0070678_100074626 3300005456 Bacteria 2550
36 Ga0070662_100097449 3300005457 Unclassified 2220
37 Ga0070662_100821226 3300005457 Unclassified 791
38 Ga0068867_100033493 3300005459 Bacteria 3721
39 Ga0070685_10005078 3300005466 Bacteria 6677
40 Ga0070706_100187582 3300005467 Bacteria 1932
41 Ga0070707_100015245 3300005468 Bacteria 7212
42 Ga0070698_100005422 3300005471 Bacteria 13935
43 Ga0070699_100026651 3300005518 Bacteria 4984
44 Ga0070699_100550697 3300005518 Unclassified 1050
45 Ga0070684_100027930 3300005535 Bacteria 4768
46 Ga0070697_100007914 3300005536 Bacteria 8282
47 Ga0070697_100106055 3300005536 Bacteria 2338
48 Ga0070697_100112101 3300005536 Bacteria 2274
49 Ga0068853_100628720 3300005539 Bacteria 1021
50 Ga0070672_100127513 3300005543 Bacteria 2089
51 Ga0070686_100067411 3300005544 Bacteria 2331
52 Ga0070686_100293258 3300005544 Bacteria 1204
53 Ga0070695_100068422 3300005545 Bacteria 2318
54 Ga0070695_100689411 3300005545 Bacteria 810
55 Ga0070696_100031148 3300005546 Bacteria 3654
56 Ga0070696_100062457 3300005546 Bacteria 2607
57 Ga0070696_100068801 3300005546 Bacteria 2486
58 Ga0070696_100113099 3300005546 Bacteria 1957
59 Ga0070696_100301384 3300005546 Bacteria 1228
60 Ga0070704_100125021 3300005549 Bacteria 1983
61 Ga0070704_100471642 3300005549 Bacteria 1084
62 Ga0068857_100043827 3300005577 Bacteria 3968
63 Ga0068857_100620562 3300005577 Bacteria 1023
64 Ga0068854_100038930 3300005578 Bacteria 3347
65 Ga0068854_100332109 3300005578 Bacteria 1239
66 Ga0070702_100017372 3300005615 Bacteria 3710
67 Ga0068852_100165004 3300005616 Bacteria 2072
68 Ga0068859_100195420 3300005617 Bacteria 2107
69 Ga0068864_100019522 3300005618 Bacteria 5668
70 Ga0068864_100250668 3300005618 Bacteria 1644
71 Ga0068864_101161744 3300005618 Bacteria 770
72 Ga0068866_10093755 3300005718 Bacteria 1641
73 Ga0068861_100048352 3300005719 Bacteria 3215
74 Ga0068861_100170204 3300005719 Bacteria 1805
75 Ga0068861_100867668 3300005719 Bacteria 852
76 Ga0068870_10006149 3300005840 Bacteria 5279
77 Ga0068863_100206002 3300005841 Bacteria 1893
78 Ga0068863_100339750 3300005841 Bacteria 1461
79 Ga0068858_100281503 3300005842 Bacteria 1584
80 Ga0068860_100012848 3300005843 Bacteria 8229
81 Ga0068860_100090809 3300005843 Bacteria 2910
82 Ga0097621_100470150 3300006237 Bacteria 1135
83 Ga0075433_10173591 3300006852 Bacteria 1918
84 Ga0075433_10605625 3300006852 Bacteria 962
85 Ga0075434_100111869 3300006871 Bacteria 2742
86 Ga0068865_100011003 3300006881 Bacteria 5647
87 Ga0075436_100628478 3300006914 Unclassified 792
88 Ga0097620_100195405 3300006931 Bacteria 2107
89 Ga0075435_100294683 3300007076 Bacteria 1387
90 Ga0111539_10052521 3300009094 Bacteria 4851
91 Ga0105245_10053422 3300009098 Bacteria 3626
92 Ga0105245_10090683 3300009098 Bacteria 2812
93 Ga0105245_10751335 3300009098 Bacteria 1011
94 Ga0105247_10197060 3300009101 Bacteria 1351
95 Ga0114129_10045255 3300009147 Bacteria 6187
96 Ga0114129_10215335 3300009147 Bacteria 2594
97 Ga0114129_10273116 3300009147 Bacteria 2261
98 Ga0105243_10043650 3300009148 Bacteria 3514
99 Ga0105243_10407629 3300009148 Unclassified 1264
100 Ga0105241_10123264 3300009174 Bacteria 2090
101 Ga0105242_10133145 3300009176 Bacteria 2148
102 Ga0105248_10053919 3300009177 Bacteria 4510
103 Ga0105248_10571339 3300009177 Bacteria 1276
104 Ga0105237_11624657 3300009545 Unclassified 653
105 Ga0105238_10561156 3300009551 Bacteria 1147
106 Ga0105249_10059518 3300009553 Bacteria 3503
107 Ga0105249_10201961 3300009553 Bacteria 1946
108 Ga0105249_10300041 3300009553 Bacteria 1611
109 Ga0105239_10035228 3300010375 Bacteria 5498
110 Ga0105239_10052050 3300010375 Bacteria 4490
111 Ga0105239_10081744 3300010375 Bacteria 3556
112 Ga0105239_10270260 3300010375 Bacteria 1912
113 Ga0105246_10041559 3300011119 Bacteria 3108
114 Ga0157374_10202645 3300013296 Bacteria 1943
115 Ga0157378_10653140 3300013297 Bacteria 1067
116 Ga0157375_10051973 3300013308 Bacteria 4027
117 Ga0157375_10536787 3300013308 Bacteria 1332
118 Ga0163163_10004233 3300014325 Bacteria 12232
119 Ga0163163_10145876 3300014325 Bacteria 2410
120 Ga0163163_10939406 3300014325 Unclassified 928
121 Ga0163163_10981187 3300014325 Unclassified 908
122 Ga0157380_10003787 3300014326 Bacteria 10400
123 Ga0157380_10586658 3300014326 Bacteria 1100
124 Ga0157377_10009559 3300014745 Bacteria 4765
125 Ga0157379_10066285 3300014968 Bacteria 3227
126 Ga0157379_10142396 3300014968 Bacteria 2162
127 Ga0157379_10962298 3300014968 Bacteria 812
128 Ga0157376_10703226 3300014969 Unclassified 1016
129 Ga0163161_10129054 3300017792 Bacteria 1905
130 Ga0207688_10020848 3300025901 Bacteria 3578
131 Ga0207680_10201076 3300025903 Bacteria 1358
132 Ga0207645_10072086 3300025907 Bacteria 2211
133 Ga0207643_10004540 3300025908 Bacteria 7460
134 Ga0207684_10686013 3300025910 Unclassified 871
135 Ga0207660_10000004 3300025917 Bacteria 371608
136 Ga0207660_10392427 3300025917 Bacteria 1117
137 Ga0207660_10887440 3300025917 Bacteria 728
138 Ga0207662_10000700 3300025918 Bacteria 15303
139 Ga0207657_10109533 3300025919 Bacteria 2282
140 Ga0207646_10077795 3300025922 Bacteria 2964
141 Ga0207646_10781410 3300025922 Unclassified 851
142 Ga0207681_10059763 3300025923 Bacteria 2614
143 Ga0207694_10147551 3300025924 Unclassified 1894
144 Ga0207650_10059663 3300025925 Bacteria 2844
145 Ga0207659_10013679 3300025926 Bacteria 5208
146 Ga0207687_10064606 3300025927 Bacteria 2596
147 Ga0207687_10293762 3300025927 Bacteria 1307
148 Ga0207687_10653169 3300025927 Bacteria 890
149 Ga0207644_11157944 3300025931 Bacteria 650
150 Ga0207690_10061149 3300025932 Bacteria 2559
151 Ga0207706_10008562 3300025933 Bacteria 9428
152 Ga0207706_10101115 3300025933 Bacteria 2536
153 Ga0207706_10219413 3300025933 Bacteria 1665
154 Ga0207709_10406111 3300025935 Unclassified 1043
155 Ga0207670_10035313 3300025936 Bacteria 3240
156 Ga0207704_10127819 3300025938 Unclassified 1753
157 Ga0207711_10164133 3300025941 Unclassified 2012
158 Ga0207711_10441086 3300025941 Bacteria 1212
159 Ga0207689_10023105 3300025942 Bacteria 5222
160 Ga0207689_10641043 3300025942 Unclassified 895
161 Ga0207661_10192103 3300025944 Bacteria 1790
162 Ga0207712_10180400 3300025961 Unclassified 1658
163 Ga0207712_10463633 3300025961 Unclassified 1077
164 Ga0207668_10173486 3300025972 Bacteria 1693
165 Ga0207677_10459065 3300026023 Bacteria 1093
166 Ga0207703_10164504 3300026035 Unclassified 1945
167 Ga0207703_10299781 3300026035 Bacteria 1465
168 Ga0207678_10003503 3300026067 Bacteria 14111
169 Ga0207708_10002254 3300026075 Bacteria 14199
170 Ga0207708_10387687 3300026075 Unclassified 1153
171 Ga0207641_10122171 3300026088 Bacteria 2326
172 Ga0207641_10695616 3300026088 Bacteria 1001
173 Ga0207641_10822179 3300026088 Unclassified 920
174 Ga0207648_10011526 3300026089 Bacteria 8324
175 Ga0207676_10025916 3300026095 Bacteria 4354
176 Ga0207676_10300762 3300026095 Unclassified 1465
177 Ga0207674_10025041 3300026116 Bacteria 6368
178 Ga0207675_100057832 3300026118 Bacteria 3618
179 Ga0207675_100216852 3300026118 Bacteria 1842
180 Ga0207675_100219376 3300026118 Bacteria 1832
181 Ga0207675_101230697 3300026118 Bacteria 769
182 Ga0207683_10011993 3300026121 Bacteria 7399
183 Ga0207683_10188416 3300026121 Unclassified 1872
184 Ga0207698_10174952 3300026142 Bacteria 1894
185 Ga0209998_10020698 3300027717 Unclassified 1408
186 Ga0209974_10047064 3300027876 Unclassified 1444
187 Ga0268264_10117096 3300028381 Unclassified 2343
188 Ga0268264_10214632 3300028381 Bacteria 1768
189 Ga0268264_10710415 3300028381 Bacteria 999
190 Ga0265329_10055973 3300031242 Bacteria 1251
191 Ga0307416_100651905 3300032002 Unclassified 1138
192 Ga0316583_10046348 3300032133 Bacteria 1534
193 Ga0373959_0008216 3300034820 Bacteria 1771
194 Ga0373928_0024245 3300035084 Bacteria 1300
195 Ga0373932_0120890 3300035112 Unclassified 873
196 Ga0373939_0170936 3300035114 Unclassified 804
197 Ga0373960_0041966 3300035121 Bacteria 1327
198 Ga0373961_0081772 3300035241 Bacteria 1017
199 Ga0316574_0376091 3300035398 Bacteria 897
200 Ga0373947_0615389 3300035725 Bacteria 740
201 Ga0373937_0343568 3300036401 Bacteria 1413
202 Ga0373937_0388332 3300036401 Bacteria 1324
203 Ga0316582_0827560 3300036647 Unclassified 634
204 Ga0395898_1469540 3300037466 Bacteria 608
205 Ga0439461_0050971 3300041410 Bacteria 918
206 Ga0439465_0025081 3300041413 Bacteria 1881
207 Ga0451847_0102542 3300041503 Bacteria 1198
208 Ga0451853_1128345 3300041512 Bacteria 917
209 Ga0439441_041740 3300042001 Unclassified 921
210 Ga0439456_062056 3300042013 Unclassified 822
211 Ga0439446_0299022 3300042156 Bacteria 565
212 Ga0451577_0011510 3300042876 Bacteria 8361
213 Ga0451577_0057740 3300042876 Bacteria 3459
214 Ga0453683_0120516 3300044673 Bacteria 1651
215 Ga0466964_0549901 3300044706 Bacteria 627
216 Ga0453684_0833528 3300044712 Unclassified 992
217 Ga0451576_0041318 3300045051 Bacteria 4876
218 Ga0451576_0549720 3300045051 Bacteria 1213
219 Ga0451576_0889001 3300045051 Bacteria 935
220 Ga0451576_0935177 3300045051 Bacteria 909
221 Ga0495651_0125494 3300046462 Bacteria 1880
222 Ga0495653_0511393 3300046463 Unclassified 747
223 Ga0495664_0247905 3300046477 Bacteria 1077
224 Ga0495608_0183815 3300046511 Unclassified 1322
225 Ga0495608_0465153 3300046511 Unclassified 768
226 Ga0495630_0304119 3300046517 Bacteria 1219
227 Ga0495652_0187207 3300046529 Bacteria 1583
228 Ga0495640_0096605 3300046533 Bacteria 1944
229 Ga0495645_0390464 3300046543 Bacteria 889
230 Ga0495667_0155117 3300046559 Bacteria 1474
231 Ga0495634_0308242 3300046642 Bacteria 956
232 Ga0495635_0231422 3300046663 Bacteria 1248
233 Ga0495657_0248918 3300046675 Bacteria 1070
234 Ga0495599_0190349 3300046678 Bacteria 1262
235 Ga0495599_0245934 3300046678 Bacteria 1090
236 Ga0495623_0221458 3300046679 Bacteria 1078
237 Ga0495623_0424767 3300046679 Bacteria 712
238 Ga0495658_0298358 3300046683 Unclassified 1019
239 Ga0495613_0403803 3300046689 Bacteria 932
240 Ga0495624_0304472 3300046690 Unclassified 961
241 Ga0495600_0059463 3300046809 Bacteria 2497
242 Ga0495581_0409700 3300047315 Bacteria 790
243 Ga0495604_0423775 3300047317 Unclassified 873
244 Ga0495674_0038886 3300047319 Bacteria 4267
245 Ga0495674_0745788 3300047319 Bacteria 765
246 Ga0495680_0232465 3300047322 Unclassified 1312
247 Ga0495680_0283776 3300047322 Bacteria 1166
248 Ga0495675_0198860 3300047444 Unclassified 1221
249 Ga0495684_0367054 3300047471 Bacteria 1018
250 Ga0496100_0155089 3300048903 Bacteria 1637
251 Ga0496102_0172818 3300048905 Bacteria 2034
252 Ga0496102_0309359 3300048905 Bacteria 1489
253 Ga0496102_0594955 3300048905 Bacteria 1029
254 Ga0496103_0293167 3300048906 Bacteria 1046
255 Ga0496103_0514208 3300048906 Unclassified 766
256 Ga0496104_0571902 3300048907 Bacteria 1040
257 Ga0496105_0193190 3300048908 Bacteria 1663
258 Ga0496105_1123337 3300048908 Unclassified 582
259 Ga0496106_0037938 3300048909 Bacteria 3605
260 Ga0496106_0183299 3300048909 Bacteria 1663
261 Ga0496107_0310035 3300048910 Unclassified 1175
262 Ga0496107_0370271 3300048910 Bacteria 1066
263 Ga0496108_0045090 3300048911 Bacteria 3681
264 Ga0496109_0013928 3300048912 Bacteria 6992
265 Ga0496109_0357225 3300048912 Unclassified 1380
266 Ga0496109_0655773 3300048912 Unclassified 986
267 Ga0496109_0863807 3300048912 Unclassified 843
268 Ga0496110_0006830 3300048913 Bacteria 9073
269 Ga0496112_0000012 3300048915 Bacteria 243643
270 Ga0496112_0067535 3300048915 Bacteria 3529
271 Ga0496112_0139936 3300048915 Bacteria 2390
272 Ga0496112_0359479 3300048915 Unclassified 1398
273 Ga0496113_0011356 3300048916 Bacteria 5936
274 Ga0496113_0309553 3300048916 Bacteria 1265
275 Ga0496113_0842793 3300048916 Unclassified 727
276 Ga0496114_0231773 3300048917 Bacteria 1622
277 Ga0496114_0342472 3300048917 Bacteria 1322
278 Ga0501036_0055892 3300049572 Bacteria 3344
279 Ga0501036_0516724 3300049572 Bacteria 993
280 Ga0501038_0089428 3300049574 Bacteria 2583
281 Ga0501038_0852538 3300049574 Bacteria 675
282 Ga0501039_0274880 3300049575 Unclassified 1324
283 Ga0501039_0455247 3300049575 Bacteria 1005
284 Ga0501040_0129886 3300049576 Bacteria 1771
285 Ga0501043_0333703 3300049579 Bacteria 1154
286 Ga0501046_0185251 3300049580 Bacteria 1555
287 Ga0501048_0070371 3300049582 Bacteria 2471
288 Ga0501048_1146444 3300049582 Unclassified 559
289 Ga0501067_0035446 3300049583 Bacteria 2770
290 Ga0501069_0036637 3300049585 Bacteria 2706
291 Ga0501071_0102871 3300049587 Bacteria 2107
292 Ga0501071_0292723 3300049587 Bacteria 1233
293 Ga0501071_0579694 3300049587 Bacteria 862
294 Ga0501071_0623566 3300049587 Bacteria 829
295 Ga0501071_0740941 3300049587 Bacteria 757
296 Ga0501072_0018519 3300049588 Bacteria 5365
297 Ga0501072_0104049 3300049588 Bacteria 2257
298 Ga0501072_0181235 3300049588 Bacteria 1680
299 Ga0501072_0636276 3300049588 Archaea 840
300 Ga0501075_0011801 3300049591 Bacteria 6195
301 Ga0501075_0135930 3300049591 Unclassified 1873
302 Ga0501075_0565527 3300049591 Unclassified 867
303 Ga0501075_0799062 3300049591 Unclassified 718
304 Ga0501076_0001767 3300049592 Bacteria 14627
305 Ga0501076_0076700 3300049592 Bacteria 2681
306 Ga0501076_0913535 3300049592 Archaea 724
307 Ga0501077_0040871 3300049593 Bacteria 2953
308 Ga0501077_0216863 3300049593 Bacteria 1216
309 Ga0501079_0024933 3300049741 Bacteria 4588
310 Ga0501079_0606689 3300049741 Bacteria 861
311 Ga0501079_0648252 3300049741 Bacteria 831
312 Ga0501079_0985032 3300049741 Unclassified 664
313 Ga0501081_0166943 3300049743 Unclassified 1588
314 Ga0501083_0389882 3300049744 Unclassified 906
315 Ga0501035_0232455 3300049822 Bacteria 1571
316 Ga0501045_0201966 3300049824 Bacteria 1481
317 Ga0501045_0322875 3300049824 Bacteria 1149
318 nmdc:mga05p37_223325_c1 3300050507 Bacteria 2272
319 nmdc:mga05p37_237506_c1 3300050507 Bacteria 2193
320 nmdc:mga05p37_80554_c1 3300050507 Bacteria 4011
321 nmdc:mga06r32_630437_c1 3300050510 Bacteria 1041
322 nmdc:mga08y16_68806_c1 3300050511 Bacteria 3691
323 nmdc:mga0n895_162685_c1 3300050512 Bacteria 2263
324 nmdc:mga0n895_384093_c1 3300050512 Unclassified 1421
325 nmdc:mga0rr50_137551_c1 3300050513 Bacteria 1962
326 nmdc:mga0rr50_685291_c1 3300050513 Unclassified 875
327 nmdc:mga0a205_182339_c1 3300050515 Bacteria 1993
328 nmdc:mga0a205_474210_c1 3300050515 Bacteria 1110
329 nmdc:mga0a205_555414_c1 3300050515 Bacteria 1003
330 nmdc:mga0a205_575538_c1 3300050515 Unclassified 980
331 Ga0495601_0072820 3300053077 Bacteria 2195
332 Ga0495601_0542245 3300053077 Bacteria 749
333 Ga0495595_0030479 3300053084 Bacteria 2420
334 Ga0495619_0090063 3300053085 Bacteria 2076
335 Ga0501084_0101448 3300054114 Bacteria 2417
336 Ga0501084_0130360 3300054114 Bacteria 2117
337 Ga0501084_0328311 3300054114 Bacteria 1292
338 Ga0501082_0054221 3300060353 Bacteria 3456
339 Ga0501082_1081089 3300060353 Bacteria 701
340 Ga0530510_0001464 3300061734 Bacteria 15840
341 Ga0530510_0084645 3300061734 Bacteria 2310
342 Ga0530510_0420040 3300061734 Bacteria 1009
343 Ga0068865_100165465
344 Ga0070683_100061291
345 Ga0070690_100022498
346 Ga0070670_100277790
347 Ga0070677_10093771
348 Ga0068869_100289655
349 Ga0070666_10443940
350 Ga0070680_100000216
351 Ga0070680_100225021
352 Ga0070682_100379194
353 Ga0068868_100009379
354 Ga0068868_100169950
355 Ga0070689_100027014
356 Ga0070689_100105503
357 Ga0070687_100001090
358 Ga0070692_10014783
359 Ga0070668_100096222
360 Ga0070669_100039561
361 Ga0070675_100008213
362 Ga0070671_100211747
363 Ga0070674_100010467
364 Ga0070673_100102315
365 Ga0070688_100024048
366 Ga0070659_100026592
367 Ga0070701_10001543
368 Ga0070705_100060414
369 Ga0070700_100166236
370 Ga0070700_100180816
371 Ga0070708_100011844
372 Ga0070708_100288231
373 Ga0070708_100551956
374 Ga0070708_101120197
375 Ga0070663_100040969
376 Ga0070663_100337664
377 Ga0070678_100074626
378 Ga0070662_100097449
379 Ga0070662_100821226
380 Ga0068867_100033493
381 Ga0070685_10005078
382 Ga0070706_100187582
383 Ga0070707_100015245
384 Ga0070698_100005422
385 Ga0070699_100026651
386 Ga0070699_100550697
387 Ga0070684_100027930
388 Ga0070697_100007914
389 Ga0070697_100106055
390 Ga0070697_100112101
391 Ga0068853_100628720
392 Ga0070672_100127513
393 Ga0070686_100067411
394 Ga0070686_100293258
395 Ga0070695_100068422
396 Ga0070695_100689411
397 Ga0070696_100031148
398 Ga0070696_100062457
399 Ga0070696_100068801
400 Ga0070696_100113099
401 Ga0070696_100301384
402 Ga0070704_100125021
403 Ga0070704_100471642
404 Ga0068857_100043827
405 Ga0068857_100620562
406 Ga0068854_100038930
407 Ga0068854_100332109
408 Ga0070702_100017372
409 Ga0068852_100165004
410 Ga0068859_100195420
411 Ga0068864_100019522
412 Ga0068864_100250668
413 Ga0068864_101161744
414 Ga0068866_10093755
415 Ga0068861_100048352
416 Ga0068861_100170204
417 Ga0068861_100867668
418 Ga0068870_10006149
419 Ga0068863_100206002
420 Ga0068863_100339750
421 Ga0068858_100281503
422 Ga0068860_100012848
423 Ga0068860_100090809
424 Ga0097621_100470150
425 Ga0075433_10173591
426 Ga0075433_10605625
427 Ga0075434_100111869
428 Ga0068865_100011003
429 Ga0075436_100628478
430 Ga0097620_100195405
431 Ga0075435_100294683
432 Ga0111539_10052521
433 Ga0105245_10053422
434 Ga0105245_10090683
435 Ga0105245_10751335
436 Ga0105247_10197060
437 Ga0114129_10045255
438 Ga0114129_10215335
439 Ga0114129_10273116
440 Ga0105243_10043650
441 Ga0105243_10407629
442 Ga0105241_10123264
443 Ga0105242_10133145
444 Ga0105248_10053919
445 Ga0105248_10571339
446 Ga0105237_11624657
447 Ga0105238_10561156
448 Ga0105249_10059518
449 Ga0105249_10201961
450 Ga0105249_10300041
451 Ga0105239_10035228
452 Ga0105239_10052050
453 Ga0105239_10081744
454 Ga0105239_10270260
455 Ga0105246_10041559
456 Ga0157374_10202645
457 Ga0157378_10653140
458 Ga0157375_10051973
459 Ga0157375_10536787
460 Ga0163163_10004233
461 Ga0163163_10145876
462 Ga0163163_10939406
463 Ga0163163_10981187
464 Ga0157380_10003787
465 Ga0157380_10586658
466 Ga0157377_10009559
467 Ga0157379_10066285
468 Ga0157379_10142396
469 Ga0157379_10962298
470 Ga0157376_10703226
471 Ga0163161_10129054
472 Ga0207688_10020848
473 Ga0207680_10201076
474 Ga0207645_10072086
475 Ga0207643_10004540
476 Ga0207684_10686013
477 Ga0207660_10000004
478 Ga0207660_10392427
479 Ga0207660_10887440
480 Ga0207662_10000700
481 Ga0207657_10109533
482 Ga0207646_10077795
483 Ga0207646_10781410
484 Ga0207681_10059763
485 Ga0207694_10147551
486 Ga0207650_10059663
487 Ga0207659_10013679
488 Ga0207687_10064606
489 Ga0207687_10293762
490 Ga0207687_10653169
491 Ga0207644_11157944
492 Ga0207690_10061149
493 Ga0207706_10008562
494 Ga0207706_10101115
495 Ga0207706_10219413
496 Ga0207709_10406111
497 Ga0207670_10035313
498 Ga0207704_10127819
499 Ga0207711_10164133
500 Ga0207711_10441086
501 Ga0207689_10023105
502 Ga0207689_10641043
503 Ga0207661_10192103
504 Ga0207712_10180400
505 Ga0207712_10463633
506 Ga0207668_10173486
507 Ga0207677_10459065
508 Ga0207703_10164504
509 Ga0207703_10299781
510 Ga0207678_10003503
511 Ga0207708_10002254
512 Ga0207708_10387687
513 Ga0207641_10122171
514 Ga0207641_10695616
515 Ga0207641_10822179
516 Ga0207648_10011526
517 Ga0207676_10025916
518 Ga0207676_10300762
519 Ga0207674_10025041
520 Ga0207675_100057832
521 Ga0207675_100216852
522 Ga0207675_100219376
523 Ga0207675_101230697
524 Ga0207683_10011993
525 Ga0207683_10188416
526 Ga0207698_10174952
527 Ga0209998_10020698
528 Ga0209974_10047064
529 Ga0268264_10117096
530 Ga0268264_10214632
531 Ga0268264_10710415
532 Ga0265329_10055973
533 Ga0307416_100651905
534 Ga0316583_10046348
535 Ga0373959_0008216
536 Ga0373928_0024245
537 Ga0373932_0120890
538 Ga0373939_0170936
539 Ga0373960_0041966
540 Ga0373961_0081772
541 Ga0316574_0376091
542 Ga0373947_0615389
543 Ga0373937_0343568
544 Ga0373937_0388332
545 Ga0316582_0827560
546 Ga0395898_1469540
547 Ga0439461_0050971
548 Ga0439465_0025081
549 Ga0451847_0102542
550 Ga0451853_1128345
551 Ga0439441_041740
552 Ga0439456_062056
553 Ga0439446_0299022
554 Ga0451577_0011510
555 Ga0451577_0057740
556 Ga0453683_0120516
557 Ga0466964_0549901
558 Ga0453684_0833528
559 Ga0451576_0041318
560 Ga0451576_0549720
561 Ga0451576_0889001
562 Ga0451576_0935177
563 Ga0495651_0125494
564 Ga0495653_0511393
565 Ga0495664_0247905
566 Ga0495608_0183815
567 Ga0495608_0465153
568 Ga0495630_0304119
569 Ga0495652_0187207
570 Ga0495640_0096605
571 Ga0495645_0390464
572 Ga0495667_0155117
573 Ga0495634_0308242
574 Ga0495635_0231422
575 Ga0495657_0248918
576 Ga0495599_0190349
577 Ga0495599_0245934
578 Ga0495623_0221458
579 Ga0495623_0424767
580 Ga0495658_0298358
581 Ga0495613_0403803
582 Ga0495624_0304472
583 Ga0495600_0059463
584 Ga0495581_0409700
585 Ga0495604_0423775
586 Ga0495674_0038886
587 Ga0495674_0745788
588 Ga0495680_0232465
589 Ga0495680_0283776
590 Ga0495675_0198860
591 Ga0495684_0367054
592 Ga0496100_0155089
593 Ga0496102_0172818
594 Ga0496102_0309359
595 Ga0496102_0594955
596 Ga0496103_0293167
597 Ga0496103_0514208
598 Ga0496104_0571902
599 Ga0496105_0193190
600 Ga0496105_1123337
601 Ga0496106_0037938
602 Ga0496106_0183299
603 Ga0496107_0310035
604 Ga0496107_0370271
605 Ga0496108_0045090
606 Ga0496109_0013928
607 Ga0496109_0357225
608 Ga0496109_0655773
609 Ga0496109_0863807
610 Ga0496110_0006830
611 Ga0496112_0000012
612 Ga0496112_0067535
613 Ga0496112_0139936
614 Ga0496112_0359479
615 Ga0496113_0011356
616 Ga0496113_0309553
617 Ga0496113_0842793
618 Ga0496114_0231773
619 Ga0496114_0342472
620 Ga0501036_0055892
621 Ga0501036_0516724
622 Ga0501038_0089428
623 Ga0501038_0852538
624 Ga0501039_0274880
625 Ga0501039_0455247
626 Ga0501040_0129886
627 Ga0501043_0333703
628 Ga0501046_0185251
629 Ga0501048_0070371
630 Ga0501048_1146444
631 Ga0501067_0035446
632 Ga0501069_0036637
633 Ga0501071_0102871
634 Ga0501071_0292723
635 Ga0501071_0579694
636 Ga0501071_0623566
637 Ga0501071_0740941
638 Ga0501072_0018519
639 Ga0501072_0104049
640 Ga0501072_0181235
641 Ga0501072_0636276
642 Ga0501075_0011801
643 Ga0501075_0135930
644 Ga0501075_0565527
645 Ga0501075_0799062
646 Ga0501076_0001767
647 Ga0501076_0076700
648 Ga0501076_0913535
649 Ga0501077_0040871
650 Ga0501077_0216863
651 Ga0501079_0024933
652 Ga0501079_0606689
653 Ga0501079_0648252
654 Ga0501079_0985032
655 Ga0501081_0166943
656 Ga0501083_0389882
657 Ga0501035_0232455
658 Ga0501045_0201966
659 Ga0501045_0322875
660 nmdc:mga05p37_223325_c1
661 nmdc:mga05p37_237506_c1
662 nmdc:mga05p37_80554_c1
663 nmdc:mga06r32_630437_c1
664 nmdc:mga08y16_68806_c1
665 nmdc:mga0n895_162685_c1
666 nmdc:mga0n895_384093_c1
667 nmdc:mga0rr50_137551_c1
668 nmdc:mga0rr50_685291_c1
669 nmdc:mga0a205_182339_c1
670 nmdc:mga0a205_474210_c1
671 nmdc:mga0a205_555414_c1
672 nmdc:mga0a205_575538_c1
673 Ga0495601_0072820
674 Ga0495601_0542245
675 Ga0495595_0030479
676 Ga0495619_0090063
677 Ga0501084_0101448
678 Ga0501084_0130360
679 Ga0501084_0328311
680 Ga0501082_0054221
681 Ga0501082_1081089
682 Ga0530510_0001464
683 Ga0530510_0084645
684 Ga0530510_0420040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map