F415111

General Info

Members Datasets Scaffolds Average Seq Length
342 197 342 255

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100020002|Ga0075428_1000200025
Length 281
Sequence VVASPGLAPERAIGGPAASAGSVGSSPMLQAHELTKRYGGLLALDRVSFELRPGEIVGYLGPNGSGKSTTVNLVVGLFEPSAGDLSLCGIRASEDPIAYKRRIGYVPEEPSLYAHLTASDYLMLVGRLRRMPSRTLRTRVRELLRLFQLHDSGYRSMTTFSKGMRQRVLVASALLHNPDLLVLDEPFSGLDVNAGLLLRTLLGILASQGRMIFFSTHRFDMVEKLCSRVIVLSSGRVVLERRVADFDREGPDSLEETFVRATQQPDFAPLARQIVDTIAGA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.43
Nodule 0
Rhizoplane 1.75
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10088041 3300005289 Bacteria 2972
2 Ga0065712_10011340 3300005290 Bacteria 3538
3 Ga0065712_10022788 3300005290 Bacteria 2728
4 Ga0065712_10108433 3300005290 Bacteria 1875
5 Ga0065715_10101930 3300005293 Bacteria 3148
6 Ga0065715_10139715 3300005293 Bacteria 1872
7 Ga0065715_10275409 3300005293 Unclassified 1100
8 Ga0065707_10086257 3300005295 Bacteria 5568
9 Ga0070670_100005692 3300005331 Bacteria 10526
10 Ga0070670_100088698 3300005331 Bacteria 2659
11 Ga0070670_100157492 3300005331 Bacteria 1968
12 Ga0070677_10047154 3300005333 Bacteria 1726
13 Ga0068869_100276397 3300005334 Bacteria 1349
14 Ga0070666_10065821 3300005335 Bacteria 2459
15 Ga0068868_100275536 3300005338 Bacteria 1422
16 Ga0070661_100250819 3300005344 Bacteria 1366
17 Ga0070661_100375309 3300005344 Bacteria 1120
18 Ga0070669_100042170 3300005353 Bacteria 3320
19 Ga0070669_100452633 3300005353 Bacteria 1058
20 Ga0070675_100078618 3300005354 Bacteria 2748
21 Ga0070675_100490623 3300005354 Bacteria 1106
22 Ga0070671_100037668 3300005355 Bacteria 4011
23 Ga0070673_100013861 3300005364 Bacteria 5595
24 Ga0070659_100213786 3300005366 Bacteria 1589
25 Ga0070667_100405697 3300005367 Bacteria 1241
26 Ga0070667_100634492 3300005367 Bacteria 986
27 Ga0070701_10018978 3300005438 Bacteria 3241
28 Ga0070705_100699625 3300005440 Bacteria 796
29 Ga0070700_100034116 3300005441 Bacteria 3071
30 Ga0070694_100013734 3300005444 Bacteria 5062
31 Ga0070708_100301538 3300005445 Bacteria 1509
32 Ga0070663_100132905 3300005455 Bacteria 1892
33 Ga0070678_100493938 3300005456 Bacteria 1079
34 Ga0068867_100009253 3300005459 Bacteria 6951
35 Ga0068867_100185092 3300005459 Bacteria 1658
36 Ga0070698_100430572 3300005471 Bacteria 1254
37 Ga0070686_100223209 3300005544 Bacteria 1363
38 Ga0070695_100058234 3300005545 Bacteria 2498
39 Ga0070696_100007119 3300005546 Bacteria 7470
40 Ga0070696_100269665 3300005546 Bacteria 1294
41 Ga0070693_100063509 3300005547 Bacteria 2152
42 Ga0070665_100006326 3300005548 Bacteria 12084
43 Ga0070665_100019336 3300005548 Bacteria 6835
44 Ga0070665_100377870 3300005548 Bacteria 1424
45 Ga0070704_100006169 3300005549 Bacteria 7043
46 Ga0070664_100083931 3300005564 Bacteria 2749
47 Ga0070664_100144134 3300005564 Unclassified 2099
48 Ga0068857_100230384 3300005577 Bacteria 1694
49 Ga0068854_100056466 3300005578 Bacteria 2830
50 Ga0068852_100836301 3300005616 Bacteria 936
51 Ga0068859_100461963 3300005617 Bacteria 1365
52 Ga0068859_100845678 3300005617 Bacteria 1001
53 Ga0068864_100016546 3300005618 Bacteria 6138
54 Ga0068864_100460024 3300005618 Bacteria 1218
55 Ga0068861_100013773 3300005719 Bacteria 5664
56 Ga0068861_100034864 3300005719 Bacteria 3724
57 Ga0068861_100079171 3300005719 Bacteria 2568
58 Ga0068863_100306884 3300005841 Bacteria 1540
59 Ga0068858_100035152 3300005842 Bacteria 4647
60 Ga0068858_100055336 3300005842 Bacteria 3667
61 Ga0068858_100138121 3300005842 Bacteria 2288
62 Ga0068860_100112296 3300005843 Bacteria 2606
63 Ga0068860_100150097 3300005843 Bacteria 2244
64 Ga0068860_100235434 3300005843 Bacteria 1780
65 Ga0068860_100292977 3300005843 Bacteria 1593
66 Ga0068862_100372420 3300005844 Bacteria 1330
67 Ga0068862_100385472 3300005844 Unclassified 1308
68 Ga0068862_100400361 3300005844 Bacteria 1284
69 Ga0070717_10131173 3300006028 Bacteria 2155
70 Ga0075368_10007248 3300006042 Bacteria 3909
71 Ga0075364_10102472 3300006051 Bacteria 1906
72 Ga0075364_10189266 3300006051 Bacteria 1393
73 Ga0075432_10030974 3300006058 Bacteria 1851
74 Ga0075367_10019188 3300006178 Bacteria 3788
75 Ga0075367_10066033 3300006178 Bacteria 2167
76 Ga0075367_10114560 3300006178 Bacteria 1657
77 Ga0075367_10188297 3300006178 Bacteria 1287
78 Ga0075366_10102832 3300006195 Bacteria 1715
79 Ga0075366_10119308 3300006195 Bacteria 1589
80 Ga0075366_10189259 3300006195 Bacteria 1251
81 Ga0097621_100002665 3300006237 Bacteria 12215
82 Ga0097621_100101690 3300006237 Bacteria 2419
83 Ga0097621_100213298 3300006237 Bacteria 1680
84 Ga0075370_10060071 3300006353 Bacteria 2165
85 Ga0068871_100000394 3300006358 Bacteria 30490
86 Ga0068871_100004992 3300006358 Bacteria 9273
87 Ga0068871_100135799 3300006358 Bacteria 2089
88 Ga0068871_100212609 3300006358 Bacteria 1673
89 Ga0075428_100020002 3300006844 Bacteria 7414
90 Ga0075428_100023487 3300006844 Bacteria 6825
91 Ga0075428_100087581 3300006844 Bacteria 3397
92 Ga0075428_100106611 3300006844 Bacteria 3055
93 Ga0075428_100513859 3300006844 Bacteria 1281
94 Ga0075430_100008462 3300006846 Bacteria 8692
95 Ga0075430_100012410 3300006846 Bacteria 7249
96 Ga0075431_100007646 3300006847 Bacteria 10760
97 Ga0075431_100012159 3300006847 Bacteria 8684
98 Ga0075431_100069779 3300006847 Bacteria 3626
99 Ga0075431_100233116 3300006847 Bacteria 1875
100 Ga0075434_100005500 3300006871 Bacteria 11540
101 Ga0075434_100164032 3300006871 Bacteria 2242
102 Ga0075434_100348629 3300006871 Bacteria 1502
103 Ga0075434_100673861 3300006871 Bacteria 1052
104 Ga0075429_100005611 3300006880 Bacteria 10810
105 Ga0075429_100236547 3300006880 Bacteria 1600
106 Ga0075429_100240164 3300006880 Unclassified 1587
107 Ga0068865_100003679 3300006881 Bacteria 9213
108 Ga0097620_100461961 3300006931 Bacteria 1365
109 Ga0097620_100845845 3300006931 Bacteria 1001
110 Ga0075435_100076218 3300007076 Bacteria 2748
111 Ga0099795_10155662 3300007788 Bacteria 939
112 Ga0105240_10029976 3300009093 Bacteria 7077
113 Ga0111539_10004285 3300009094 Bacteria 18666
114 Ga0111539_10021887 3300009094 Bacteria 7860
115 Ga0111539_10057006 3300009094 Bacteria 4641
116 Ga0111539_10116576 3300009094 Bacteria 3132
117 Ga0105245_10197405 3300009098 Bacteria 1931
118 Ga0105247_10016107 3300009101 Bacteria 4478
119 Ga0114129_10001448 3300009147 Bacteria 32015
120 Ga0114129_10004629 3300009147 Bacteria 19420
121 Ga0114129_10015757 3300009147 Bacteria 10746
122 Ga0114129_10016296 3300009147 Bacteria 10579
123 Ga0114129_10032615 3300009147 Bacteria 7360
124 Ga0114129_10041789 3300009147 Bacteria 6456
125 Ga0114129_10075799 3300009147 Bacteria 4683
126 Ga0105243_10093938 3300009148 Bacteria 2476
127 Ga0105243_10285236 3300009148 Bacteria 1489
128 Ga0105242_10003206 3300009176 Bacteria 12737
129 Ga0105242_10038446 3300009176 Bacteria 3848
130 Ga0105248_10004152 3300009177 Bacteria 16021
131 Ga0105248_10042484 3300009177 Bacteria 5098
132 Ga0105238_10131379 3300009551 Unclassified 2482
133 Ga0105249_10025169 3300009553 Bacteria 5355
134 Ga0105249_10176092 3300009553 Bacteria 2078
135 Ga0105249_10410797 3300009553 Unclassified 1386
136 Ga0105249_10908946 3300009553 Bacteria 947
137 Ga0105246_10017940 3300011119 Bacteria 4505
138 Ga0157374_10012089 3300013296 Bacteria 7497
139 Ga0157374_10836249 3300013296 Bacteria 937
140 Ga0157378_10115369 3300013297 Bacteria 2468
141 Ga0157378_10431280 3300013297 Bacteria 1304
142 Ga0163162_10230781 3300013306 Bacteria 1981
143 Ga0157375_10118481 3300013308 Bacteria 2754
144 Ga0163163_10004061 3300014325 Bacteria 12479
145 Ga0163163_10054230 3300014325 Bacteria 3961
146 Ga0163163_10101298 3300014325 Bacteria 2902
147 Ga0163163_10747862 3300014325 Bacteria 1041
148 Ga0157380_10354405 3300014326 Bacteria 1374
149 Ga0157380_10836122 3300014326 Bacteria 941
150 Ga0157379_10011909 3300014968 Bacteria 7601
151 Ga0157379_10025361 3300014968 Bacteria 5265
152 Ga0157379_10026853 3300014968 Bacteria 5125
153 Ga0157379_10595267 3300014968 Bacteria 1032
154 Ga0157376_10124113 3300014969 Bacteria 2293
155 Ga0163161_10387085 3300017792 Bacteria 1119
156 Ga0213876_10143865 3300021384 Bacteria 1268
157 Ga0207642_10098383 3300025899 Bacteria 1463
158 Ga0207710_10010283 3300025900 Bacteria 3939
159 Ga0207688_10305364 3300025901 Unclassified 974
160 Ga0207680_10354199 3300025903 Unclassified 1031
161 Ga0207645_10009802 3300025907 Bacteria 6606
162 Ga0207695_10456194 3300025913 Bacteria 1161
163 Ga0207681_10198139 3300025923 Bacteria 1540
164 Ga0207694_10093251 3300025924 Unclassified 2378
165 Ga0207694_10113972 3300025924 Bacteria 2153
166 Ga0207650_10126510 3300025925 Bacteria 1995
167 Ga0207659_10304359 3300025926 Bacteria 1310
168 Ga0207687_10200183 3300025927 Bacteria 1560
169 Ga0207700_10127226 3300025928 Bacteria 2074
170 Ga0207644_10164052 3300025931 Bacteria 1729
171 Ga0207686_10005220 3300025934 Bacteria 6974
172 Ga0207686_10015060 3300025934 Bacteria 4317
173 Ga0207709_10250941 3300025935 Bacteria 1292
174 Ga0207709_10279685 3300025935 Bacteria 1232
175 Ga0207669_10377435 3300025937 Bacteria 1104
176 Ga0207704_10065100 3300025938 Bacteria 2281
177 Ga0207711_10002803 3300025941 Bacteria 15320
178 Ga0207711_10043772 3300025941 Bacteria 3820
179 Ga0207711_10045767 3300025941 Bacteria 3739
180 Ga0207689_10060288 3300025942 Bacteria 3120
181 Ga0207689_10226860 3300025942 Bacteria 1544
182 Ga0207689_10327896 3300025942 Unclassified 1271
183 Ga0207661_10442469 3300025944 Bacteria 1183
184 Ga0207679_10012501 3300025945 Bacteria 5536
185 Ga0207651_10015102 3300025960 Bacteria 4478
186 Ga0207712_10217827 3300025961 Bacteria 1524
187 Ga0207640_10043930 3300025981 Bacteria 2860
188 Ga0207703_10014237 3300026035 Bacteria 6205
189 Ga0207703_10103716 3300026035 Bacteria 2415
190 Ga0207703_10120570 3300026035 Bacteria 2251
191 Ga0207703_10151615 3300026035 Bacteria 2022
192 Ga0207703_10362841 3300026035 Bacteria 1336
193 Ga0207703_10436269 3300026035 Bacteria 1221
194 Ga0207678_10067032 3300026067 Bacteria 3081
195 Ga0207708_10002226 3300026075 Bacteria 14306
196 Ga0207641_10142986 3300026088 Bacteria 2161
197 Ga0207648_10004014 3300026089 Bacteria 15276
198 Ga0207648_10054167 3300026089 Bacteria 3504
199 Ga0207648_10130872 3300026089 Bacteria 2209
200 Ga0207648_10206514 3300026089 Bacteria 1743
201 Ga0207648_10422652 3300026089 Bacteria 1210
202 Ga0207676_10007321 3300026095 Bacteria 7827
203 Ga0207676_10119358 3300026095 Bacteria 2221
204 Ga0207676_10415945 3300026095 Bacteria 1260
205 Ga0207676_10446534 3300026095 Bacteria 1218
206 Ga0207674_10098946 3300026116 Unclassified 2899
207 Ga0207675_100000281 3300026118 Bacteria 48891
208 Ga0207675_100074587 3300026118 Bacteria 3174
209 Ga0207683_10040820 3300026121 Bacteria 4051
210 Ga0207683_10094996 3300026121 Bacteria 2657
211 Ga0207683_10392688 3300026121 Bacteria 1276
212 Ga0207698_10812883 3300026142 Bacteria 938
213 Ga0209813_10016143 3300027866 Bacteria 2034
214 Ga0207428_10011071 3300027907 Bacteria 8013
215 Ga0268266_10034866 3300028379 Bacteria 4280
216 Ga0268266_10196944 3300028379 Bacteria 1842
217 Ga0268265_10322292 3300028380 Bacteria 1400
218 Ga0268265_10441566 3300028380 Bacteria 1213
219 Ga0268264_10137979 3300028381 Bacteria 2171
220 Ga0268264_10211920 3300028381 Bacteria 1779
221 Ga0268264_10239355 3300028381 Bacteria 1680
222 Ga0268264_10505498 3300028381 Bacteria 1179
223 Ga0268264_10725830 3300028381 Bacteria 988
224 Ga0307413_10136183 3300031824 Bacteria 1689
225 Ga0307407_10115248 3300031903 Bacteria 1694
226 Ga0307407_10488136 3300031903 Bacteria 901
227 Ga0307409_100520415 3300031995 Bacteria 1162
228 Ga0307416_100072026 3300032002 Bacteria 2874
229 Ga0307416_100182868 3300032002 Bacteria 1967
230 Ga0307411_10203251 3300032005 Bacteria 1523
231 Ga0373939_0015588 3300035114 Bacteria 1991
232 Ga0373945_0173077 3300035116 Bacteria 885
233 Ga0373953_0121719 3300035117 Bacteria 1109
234 Ga0373924_0006430 3300035410 Bacteria 4211
235 Ga0373933_0319405 3300035724 Bacteria 1007
236 Ga0373937_0145092 3300036401 Bacteria 2222
237 Ga0373925_0010774 3300037068 Bacteria 6628
238 Ga0373925_0344488 3300037068 Bacteria 1209
239 Ga0436365_0032159 3300039437 Bacteria 1275
240 Ga0451807_1067953 3300041486 Bacteria 2023
241 Ga0451807_2622590 3300041486 Bacteria 976
242 Ga0451853_2954714 3300041512 Bacteria 1992
243 Ga0495592_0039176 3300046454 Bacteria 3562
244 Ga0495603_0269619 3300046455 Bacteria 979
245 Ga0495629_0293416 3300046459 Bacteria 1114
246 Ga0495582_0125894 3300046473 Bacteria 1446
247 Ga0495639_0180470 3300046475 Bacteria 1028
248 Ga0495608_0009255 3300046511 Bacteria 6890
249 Ga0495628_0021807 3300046516 Bacteria 5263
250 Ga0495652_0099044 3300046529 Bacteria 2368
251 Ga0495587_0019461 3300046536 Bacteria 4201
252 Ga0495645_0002883 3300046543 Bacteria 11674
253 Ga0495667_0114138 3300046559 Bacteria 1746
254 Ga0495647_0006948 3300046681 Bacteria 3771
255 Ga0495647_0009049 3300046681 Bacteria 3362
256 Ga0495658_0036007 3300046683 Bacteria 2728
257 Ga0495658_0066039 3300046683 Bacteria 2089
258 Ga0495669_0014178 3300046684 Bacteria 3407
259 Ga0495669_0052750 3300046684 Bacteria 1828
260 Ga0495613_0326436 3300046689 Bacteria 1058
261 Ga0495600_0213727 3300046809 Bacteria 1235
262 Ga0495581_0072144 3300047315 Archaea 1998
263 Ga0495604_0036695 3300047317 Bacteria 3864
264 Ga0495674_0085507 3300047319 Bacteria 2702
265 Ga0495674_0137832 3300047319 Bacteria 2052
266 Ga0495684_0000214 3300047471 Bacteria 45082
267 Ga0495684_0027662 3300047471 Bacteria 4355
268 Ga0495602_0312685 3300048088 Bacteria 1146
269 Ga0496104_0116061 3300048907 Bacteria 2569
270 Ga0496112_0033234 3300048915 Bacteria 5012
271 Ga0496113_0017182 3300048916 Bacteria 5017
272 Ga0496114_0074973 3300048917 Bacteria 2849
273 Ga0501036_0352310 3300049572 Bacteria 1229
274 Ga0501039_0086376 3300049575 Bacteria 2443
275 Ga0501040_0041886 3300049576 Bacteria 3119
276 Ga0501041_0207453 3300049577 Bacteria 1229
277 Ga0501041_0252003 3300049577 Bacteria 1110
278 Ga0501046_0226890 3300049580 Bacteria 1381
279 Ga0501048_0008977 3300049582 Bacteria 7525
280 Ga0501070_0171817 3300049586 Bacteria 1785
281 Ga0501071_0060968 3300049587 Bacteria 2732
282 Ga0501071_0387782 3300049587 Bacteria 1066
283 Ga0501072_0092405 3300049588 Bacteria 2403
284 Ga0501074_0026332 3300049590 Bacteria 4217
285 Ga0501075_0024935 3300049591 Bacteria 4391
286 Ga0501075_0075917 3300049591 Bacteria 2541
287 Ga0501075_0285111 3300049591 Bacteria 1258
288 Ga0501076_0057878 3300049592 Bacteria 3079
289 Ga0501076_0157935 3300049592 Bacteria 1846
290 Ga0501076_0241453 3300049592 Bacteria 1478
291 Ga0501076_0564095 3300049592 Bacteria 939
292 Ga0501077_0040921 3300049593 Bacteria 2951
293 Ga0501077_0259285 3300049593 Bacteria 1106
294 Ga0501079_0116465 3300049741 Bacteria 2077
295 Ga0501079_0152365 3300049741 Bacteria 1802
296 Ga0501045_0020563 3300049824 Bacteria 4717
297 nmdc:mga00v17_337971_c1 3300050491 Bacteria 979
298 nmdc:mga00v17_35657_c1 3300050491 Bacteria 2962
299 nmdc:mga0k408_116619_c1 3300050493 Bacteria 1580
300 nmdc:mga0k408_387368_c1 3300050493 Bacteria 832
301 nmdc:mga0k408_81936_c1 3300050493 Bacteria 1890
302 nmdc:mga06z11_133985_c1 3300050494 Bacteria 1394
303 nmdc:mga06z11_14078_c1 3300050494 Bacteria 3532
304 nmdc:mga06z11_36034_c1 3300050494 Bacteria 2439
305 nmdc:mga04h51_23468_c1 3300050495 Bacteria 1878
306 nmdc:mga05p37_10042_c1 3300050507 Bacteria 11233
307 nmdc:mga05p37_117110_c1 3300050507 Bacteria 2505
308 nmdc:mga05p37_119616_c1 3300050507 Bacteria 3236
309 nmdc:mga05p37_1840_c1 3300050507 Bacteria 24732
310 nmdc:mga05p37_40648_c1 3300050507 Bacteria 5711
311 nmdc:mga05p37_614_c1 3300050507 Bacteria 39350
312 nmdc:mga09592_160156_c1 3300050508 Bacteria 1944
313 nmdc:mga09592_230559_c1 3300050508 Unclassified 1604
314 nmdc:mga09592_23878_c1 3300050508 Bacteria 5053
315 nmdc:mga0qj67_8725_c1 3300050509 Bacteria 7529
316 nmdc:mga06r32_20300_c1 3300050510 Bacteria 6115
317 nmdc:mga06r32_6471_c1 3300050510 Bacteria 10524
318 nmdc:mga08y16_22116_c1 3300050511 Bacteria 6713
319 nmdc:mga08y16_25401_c1 3300050511 Bacteria 6247
320 nmdc:mga08y16_260333_c1 3300050511 Bacteria 1791
321 nmdc:mga08y16_288050_c1 3300050511 Bacteria 1693
322 nmdc:mga08y16_32464_c1 3300050511 Bacteria 5488
323 nmdc:mga08y16_755956_c1 3300050511 Bacteria 968
324 nmdc:mga0n895_206608_c1 3300050512 Bacteria 1994
325 nmdc:mga0n895_48958_c1 3300050512 Bacteria 4139
326 nmdc:mga0n895_787965_c1 3300050512 Bacteria 942
327 nmdc:mga08x19_264182_c1 3300050514 Bacteria 1190
328 nmdc:mga0a205_217521_c1 3300050515 Bacteria 1797
329 nmdc:mga0a205_46225_c1 3300050515 Bacteria 4198
330 nmdc:mga0a205_48717_c1 3300050515 Unclassified 4090
331 Ga0495601_0002005 3300053077 Bacteria 11426
332 Ga0495601_0064159 3300053077 Bacteria 2335
333 Ga0495595_0138912 3300053084 Bacteria 1191
334 Ga0495595_0212472 3300053084 Bacteria 964
335 Ga0495619_0000427 3300053085 Bacteria 28604
336 Ga0500658_0043249 3300053134 Bacteria 1814
337 Ga0501084_0012166 3300054114 Bacteria 7123
338 Ga0590071_000954 3300059421 Bacteria 7983
339 Ga0590074_002557 3300059423 Bacteria 2988
340 Ga0590075_000166 3300059424 Bacteria 18089
341 Ga0590077_001199 3300059426 Bacteria 6277
342 Ga0501082_0101723 3300060353 Bacteria 2486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10354405 Ga0157380_103544052 231
2 3300026095 Ga0207676_10415945 Ga0207676_104159452 244
3 3300021384 Ga0213876_10143865 Ga0213876_101438652 249
4 3300039437 Ga0436365_0032159 Ga0436365_0032159_157_909 249
5 3300009147 Ga0114129_10016296 Ga0114129_100162962 252
6 3300047315 Ga0495581_0072144 Ga0495581_0072144_879_1637 252
7 3300005289 Ga0065704_10088041 Ga0065704_100880412 253
8 3300005290 Ga0065712_10011340 Ga0065712_100113402 253
9 3300005290 Ga0065712_10022788 Ga0065712_100227883 253
10 3300005290 Ga0065712_10108433 Ga0065712_101084332 253
11 3300005293 Ga0065715_10101930 Ga0065715_101019302 253
12 3300005293 Ga0065715_10139715 Ga0065715_101397153 253
13 3300005293 Ga0065715_10275409 Ga0065715_102754091 253
14 3300005295 Ga0065707_10086257 Ga0065707_100862573 253
15 3300005331 Ga0070670_100005692 Ga0070670_1000056923 253
16 3300005331 Ga0070670_100088698 Ga0070670_1000886981 253
17 3300005331 Ga0070670_100157492 Ga0070670_1001574924 253
18 3300005333 Ga0070677_10047154 Ga0070677_100471542 253
19 3300005334 Ga0068869_100276397 Ga0068869_1002763972 253
20 3300005335 Ga0070666_10065821 Ga0070666_100658213 253
21 3300005338 Ga0068868_100275536 Ga0068868_1002755362 253
22 3300005344 Ga0070661_100250819 Ga0070661_1002508192 253
23 3300005344 Ga0070661_100375309 Ga0070661_1003753092 253
24 3300005353 Ga0070669_100042170 Ga0070669_1000421703 253
25 3300005353 Ga0070669_100452633 Ga0070669_1004526332 253
26 3300005354 Ga0070675_100078618 Ga0070675_1000786184 253
27 3300005354 Ga0070675_100490623 Ga0070675_1004906232 253
28 3300005355 Ga0070671_100037668 Ga0070671_1000376682 253
29 3300005364 Ga0070673_100013861 Ga0070673_1000138614 253
30 3300005366 Ga0070659_100213786 Ga0070659_1002137861 253
31 3300005367 Ga0070667_100405697 Ga0070667_1004056971 253
32 3300005367 Ga0070667_100634492 Ga0070667_1006344921 253
33 3300005438 Ga0070701_10018978 Ga0070701_100189783 253
34 3300005440 Ga0070705_100699625 Ga0070705_1006996251 253
35 3300005441 Ga0070700_100034116 Ga0070700_1000341164 253
36 3300005444 Ga0070694_100013734 Ga0070694_1000137342 253
37 3300005445 Ga0070708_100301538 Ga0070708_1003015382 253
38 3300005455 Ga0070663_100132905 Ga0070663_1001329053 253
39 3300005456 Ga0070678_100493938 Ga0070678_1004939382 253
40 3300005459 Ga0068867_100009253 Ga0068867_1000092537 253
41 3300005459 Ga0068867_100185092 Ga0068867_1001850922 253
42 3300005471 Ga0070698_100430572 Ga0070698_1004305721 253
43 3300005544 Ga0070686_100223209 Ga0070686_1002232092 253
44 3300005545 Ga0070695_100058234 Ga0070695_1000582343 253
45 3300005546 Ga0070696_100007119 Ga0070696_1000071197 253
46 3300005546 Ga0070696_100269665 Ga0070696_1002696652 253
47 3300005547 Ga0070693_100063509 Ga0070693_1000635093 253
48 3300005548 Ga0070665_100006326 Ga0070665_10000632610 253
49 3300005548 Ga0070665_100019336 Ga0070665_1000193365 253
50 3300005548 Ga0070665_100377870 Ga0070665_1003778702 253
51 3300005549 Ga0070704_100006169 Ga0070704_1000061697 253
52 3300005564 Ga0070664_100083931 Ga0070664_1000839314 253
53 3300005564 Ga0070664_100144134 Ga0070664_1001441342 253
54 3300005577 Ga0068857_100230384 Ga0068857_1002303842 253
55 3300005578 Ga0068854_100056466 Ga0068854_1000564664 253
56 3300005616 Ga0068852_100836301 Ga0068852_1008363012 253
57 3300005617 Ga0068859_100461963 Ga0068859_1004619632 253
58 3300005617 Ga0068859_100845678 Ga0068859_1008456781 253
59 3300005618 Ga0068864_100016546 Ga0068864_1000165462 253
60 3300005618 Ga0068864_100460024 Ga0068864_1004600242 253
61 3300005719 Ga0068861_100013773 Ga0068861_1000137736 253
62 3300005719 Ga0068861_100034864 Ga0068861_1000348642 253
63 3300005719 Ga0068861_100079171 Ga0068861_1000791715 253
64 3300005841 Ga0068863_100306884 Ga0068863_1003068842 253
65 3300005842 Ga0068858_100035152 Ga0068858_1000351521 253
66 3300005842 Ga0068858_100055336 Ga0068858_1000553362 253
67 3300005842 Ga0068858_100138121 Ga0068858_1001381212 253
68 3300005843 Ga0068860_100112296 Ga0068860_1001122962 253
69 3300005843 Ga0068860_100150097 Ga0068860_1001500974 253
70 3300005843 Ga0068860_100235434 Ga0068860_1002354342 253
71 3300005843 Ga0068860_100292977 Ga0068860_1002929772 253
72 3300005844 Ga0068862_100372420 Ga0068862_1003724202 253
73 3300005844 Ga0068862_100385472 Ga0068862_1003854722 253
74 3300005844 Ga0068862_100400361 Ga0068862_1004003612 253
75 3300006028 Ga0070717_10131173 Ga0070717_101311732 253
76 3300006042 Ga0075368_10007248 Ga0075368_100072484 253
77 3300006051 Ga0075364_10102472 Ga0075364_101024723 253
78 3300006051 Ga0075364_10189266 Ga0075364_101892662 253
79 3300006058 Ga0075432_10030974 Ga0075432_100309743 253
80 3300006178 Ga0075367_10019188 Ga0075367_100191884 253
81 3300006178 Ga0075367_10066033 Ga0075367_100660334 253
82 3300006178 Ga0075367_10114560 Ga0075367_101145602 253
83 3300006178 Ga0075367_10188297 Ga0075367_101882972 253
84 3300006195 Ga0075366_10102832 Ga0075366_101028322 253
85 3300006195 Ga0075366_10119308 Ga0075366_101193082 253
86 3300006195 Ga0075366_10189259 Ga0075366_101892592 253
87 3300006237 Ga0097621_100002665 Ga0097621_10000266510 253
88 3300006237 Ga0097621_100101690 Ga0097621_1001016903 253
89 3300006237 Ga0097621_100213298 Ga0097621_1002132982 253
90 3300006353 Ga0075370_10060071 Ga0075370_100600712 253
91 3300006358 Ga0068871_100000394 Ga0068871_10000039419 253
92 3300006358 Ga0068871_100004992 Ga0068871_1000049925 253
93 3300006358 Ga0068871_100135799 Ga0068871_1001357993 253
94 3300006358 Ga0068871_100212609 Ga0068871_1002126092 253
95 3300006844 Ga0075428_100020002 Ga0075428_1000200025 253
96 3300006844 Ga0075428_100023487 Ga0075428_1000234874 253
97 3300006844 Ga0075428_100087581 Ga0075428_1000875812 253
98 3300006844 Ga0075428_100106611 Ga0075428_1001066112 253
99 3300006844 Ga0075428_100513859 Ga0075428_1005138592 253
100 3300006846 Ga0075430_100008462 Ga0075430_1000084622 253
101 3300006846 Ga0075430_100012410 Ga0075430_1000124105 253
102 3300006847 Ga0075431_100007646 Ga0075431_1000076465 253
103 3300006847 Ga0075431_100012159 Ga0075431_1000121593 253
104 3300006847 Ga0075431_100069779 Ga0075431_1000697792 253
105 3300006847 Ga0075431_100233116 Ga0075431_1002331161 253
106 3300006871 Ga0075434_100005500 Ga0075434_1000055003 253
107 3300006871 Ga0075434_100164032 Ga0075434_1001640324 253
108 3300006871 Ga0075434_100348629 Ga0075434_1003486292 253
109 3300006871 Ga0075434_100673861 Ga0075434_1006738612 253
110 3300006880 Ga0075429_100005611 Ga0075429_1000056112 253
111 3300006880 Ga0075429_100236547 Ga0075429_1002365472 253
112 3300006880 Ga0075429_100240164 Ga0075429_1002401641 253
113 3300006881 Ga0068865_100003679 Ga0068865_1000036796 253
114 3300006931 Ga0097620_100461961 Ga0097620_1004619612 253
115 3300006931 Ga0097620_100845845 Ga0097620_1008458451 253
116 3300007076 Ga0075435_100076218 Ga0075435_1000762182 253
117 3300007788 Ga0099795_10155662 Ga0099795_101556622 253
118 3300009093 Ga0105240_10029976 Ga0105240_100299764 253
119 3300009094 Ga0111539_10004285 Ga0111539_100042857 253
120 3300009094 Ga0111539_10021887 Ga0111539_100218872 253
121 3300009094 Ga0111539_10057006 Ga0111539_100570062 253
122 3300009094 Ga0111539_10116576 Ga0111539_101165766 253
123 3300009098 Ga0105245_10197405 Ga0105245_101974053 253
124 3300009101 Ga0105247_10016107 Ga0105247_100161074 253
125 3300009147 Ga0114129_10001448 Ga0114129_100014487 253
126 3300009147 Ga0114129_10004629 Ga0114129_100046295 253
127 3300009147 Ga0114129_10015757 Ga0114129_100157575 253
128 3300009147 Ga0114129_10032615 Ga0114129_100326153 253
129 3300009147 Ga0114129_10041789 Ga0114129_100417892 253
130 3300009147 Ga0114129_10075799 Ga0114129_100757994 253
131 3300009148 Ga0105243_10093938 Ga0105243_100939382 253
132 3300009148 Ga0105243_10285236 Ga0105243_102852362 253
133 3300009176 Ga0105242_10003206 Ga0105242_100032066 253
134 3300009176 Ga0105242_10038446 Ga0105242_100384463 253
135 3300009177 Ga0105248_10004152 Ga0105248_1000415215 253
136 3300009177 Ga0105248_10042484 Ga0105248_100424842 253
137 3300009551 Ga0105238_10131379 Ga0105238_101313794 253
138 3300009553 Ga0105249_10025169 Ga0105249_100251694 253
139 3300009553 Ga0105249_10176092 Ga0105249_101760922 253
140 3300009553 Ga0105249_10410797 Ga0105249_104107972 253
141 3300009553 Ga0105249_10908946 Ga0105249_109089462 253
142 3300011119 Ga0105246_10017940 Ga0105246_100179401 253
143 3300013296 Ga0157374_10012089 Ga0157374_100120894 253
144 3300013296 Ga0157374_10836249 Ga0157374_108362491 253
145 3300013297 Ga0157378_10115369 Ga0157378_101153692 253
146 3300013297 Ga0157378_10431280 Ga0157378_104312801 253
147 3300013306 Ga0163162_10230781 Ga0163162_102307812 253
148 3300013308 Ga0157375_10118481 Ga0157375_101184811 253
149 3300014325 Ga0163163_10004061 Ga0163163_100040615 253
150 3300014325 Ga0163163_10054230 Ga0163163_100542302 253
151 3300014325 Ga0163163_10101298 Ga0163163_101012982 253
152 3300014325 Ga0163163_10747862 Ga0163163_107478622 253
153 3300014326 Ga0157380_10836122 Ga0157380_108361222 253
154 3300014968 Ga0157379_10011909 Ga0157379_100119093 253
155 3300014968 Ga0157379_10025361 Ga0157379_100253617 253
156 3300014968 Ga0157379_10026853 Ga0157379_100268533 253
157 3300014968 Ga0157379_10595267 Ga0157379_105952672 253
158 3300014969 Ga0157376_10124113 Ga0157376_101241132 253
159 3300017792 Ga0163161_10387085 Ga0163161_103870852 253
160 3300025899 Ga0207642_10098383 Ga0207642_100983832 253
161 3300025900 Ga0207710_10010283 Ga0207710_100102832 253
162 3300025901 Ga0207688_10305364 Ga0207688_103053642 253
163 3300025903 Ga0207680_10354199 Ga0207680_103541992 253
164 3300025907 Ga0207645_10009802 Ga0207645_100098023 253
165 3300025913 Ga0207695_10456194 Ga0207695_104561941 253
166 3300025923 Ga0207681_10198139 Ga0207681_101981392 253
167 3300025924 Ga0207694_10093251 Ga0207694_100932514 253
168 3300025924 Ga0207694_10113972 Ga0207694_101139722 253
169 3300025925 Ga0207650_10126510 Ga0207650_101265102 253
170 3300025926 Ga0207659_10304359 Ga0207659_103043592 253
171 3300025927 Ga0207687_10200183 Ga0207687_102001832 253
172 3300025928 Ga0207700_10127226 Ga0207700_101272262 253
173 3300025931 Ga0207644_10164052 Ga0207644_101640522 253
174 3300025934 Ga0207686_10005220 Ga0207686_100052204 253
175 3300025934 Ga0207686_10015060 Ga0207686_100150604 253
176 3300025935 Ga0207709_10250941 Ga0207709_102509411 253
177 3300025935 Ga0207709_10279685 Ga0207709_102796851 253
178 3300025937 Ga0207669_10377435 Ga0207669_103774351 253
179 3300025938 Ga0207704_10065100 Ga0207704_100651002 253
180 3300025941 Ga0207711_10002803 Ga0207711_100028033 253
181 3300025941 Ga0207711_10043772 Ga0207711_100437723 253
182 3300025941 Ga0207711_10045767 Ga0207711_100457672 253
183 3300025942 Ga0207689_10060288 Ga0207689_100602885 253
184 3300025942 Ga0207689_10226860 Ga0207689_102268602 253
185 3300025942 Ga0207689_10327896 Ga0207689_103278962 253
186 3300025944 Ga0207661_10442469 Ga0207661_104424692 253
187 3300025945 Ga0207679_10012501 Ga0207679_100125014 253
188 3300025960 Ga0207651_10015102 Ga0207651_100151022 253
189 3300025961 Ga0207712_10217827 Ga0207712_102178272 253
190 3300025981 Ga0207640_10043930 Ga0207640_100439305 253
191 3300026035 Ga0207703_10014237 Ga0207703_100142372 253
192 3300026035 Ga0207703_10103716 Ga0207703_101037164 253
193 3300026035 Ga0207703_10120570 Ga0207703_101205702 253
194 3300026035 Ga0207703_10151615 Ga0207703_101516152 253
195 3300026035 Ga0207703_10362841 Ga0207703_103628412 253
196 3300026035 Ga0207703_10436269 Ga0207703_104362692 253
197 3300026067 Ga0207678_10067032 Ga0207678_100670322 253
198 3300026075 Ga0207708_10002226 Ga0207708_100022269 253
199 3300026088 Ga0207641_10142986 Ga0207641_101429862 253
200 3300026089 Ga0207648_10004014 Ga0207648_100040146 253
201 3300026089 Ga0207648_10054167 Ga0207648_100541674 253
202 3300026089 Ga0207648_10130872 Ga0207648_101308721 253
203 3300026089 Ga0207648_10206514 Ga0207648_102065141 253
204 3300026089 Ga0207648_10422652 Ga0207648_104226521 253
205 3300026095 Ga0207676_10007321 Ga0207676_100073214 253
206 3300026095 Ga0207676_10119358 Ga0207676_101193582 253
207 3300026095 Ga0207676_10446534 Ga0207676_104465342 253
208 3300026116 Ga0207674_10098946 Ga0207674_100989462 253
209 3300026118 Ga0207675_100000281 Ga0207675_10000028110 253
210 3300026118 Ga0207675_100074587 Ga0207675_1000745871 253
211 3300026121 Ga0207683_10040820 Ga0207683_100408204 253
212 3300026121 Ga0207683_10094996 Ga0207683_100949962 253
213 3300026121 Ga0207683_10392688 Ga0207683_103926882 253
214 3300026142 Ga0207698_10812883 Ga0207698_108128832 253
215 3300027866 Ga0209813_10016143 Ga0209813_100161432 253
216 3300027907 Ga0207428_10011071 Ga0207428_100110713 253
217 3300028379 Ga0268266_10034866 Ga0268266_100348663 253
218 3300028379 Ga0268266_10196944 Ga0268266_101969441 253
219 3300028380 Ga0268265_10322292 Ga0268265_103222922 253
220 3300028380 Ga0268265_10441566 Ga0268265_104415662 253
221 3300028381 Ga0268264_10137979 Ga0268264_101379792 253
222 3300028381 Ga0268264_10211920 Ga0268264_102119202 253
223 3300028381 Ga0268264_10239355 Ga0268264_102393552 253
224 3300028381 Ga0268264_10505498 Ga0268264_105054982 253
225 3300028381 Ga0268264_10725830 Ga0268264_107258301 253
226 3300031824 Ga0307413_10136183 Ga0307413_101361832 253
227 3300031903 Ga0307407_10115248 Ga0307407_101152482 253
228 3300031903 Ga0307407_10488136 Ga0307407_104881361 253
229 3300031995 Ga0307409_100520415 Ga0307409_1005204152 253
230 3300032002 Ga0307416_100072026 Ga0307416_1000720262 253
231 3300032002 Ga0307416_100182868 Ga0307416_1001828682 253
232 3300032005 Ga0307411_10203251 Ga0307411_102032512 253
233 3300035114 Ga0373939_0015588 Ga0373939_0015588_1153_1917 253
234 3300035116 Ga0373945_0173077 Ga0373945_0173077_85_849 253
235 3300035117 Ga0373953_0121719 Ga0373953_0121719_129_893 253
236 3300035410 Ga0373924_0006430 Ga0373924_0006430_2834_3598 253
237 3300035724 Ga0373933_0319405 Ga0373933_0319405_69_833 253
238 3300036401 Ga0373937_0145092 Ga0373937_0145092_1324_2088 253
239 3300037068 Ga0373925_0010774 Ga0373925_0010774_2818_3582 253
240 3300037068 Ga0373925_0344488 Ga0373925_0344488_123_887 253
241 3300041486 Ga0451807_1067953 Ga0451807_1067953_223_987 253
242 3300041486 Ga0451807_2622590 Ga0451807_2622590_90_854 253
243 3300041512 Ga0451853_2954714 Ga0451853_2954714_736_1500 253
244 3300046454 Ga0495592_0039176 Ga0495592_0039176_2114_2878 253
245 3300046455 Ga0495603_0269619 Ga0495603_0269619_138_902 253
246 3300046459 Ga0495629_0293416 Ga0495629_0293416_87_851 253
247 3300046473 Ga0495582_0125894 Ga0495582_0125894_626_1390 253
248 3300046475 Ga0495639_0180470 Ga0495639_0180470_104_868 253
249 3300046511 Ga0495608_0009255 Ga0495608_0009255_1550_2314 253
250 3300046516 Ga0495628_0021807 Ga0495628_0021807_2428_3192 253
251 3300046529 Ga0495652_0099044 Ga0495652_0099044_193_957 253
252 3300046536 Ga0495587_0019461 Ga0495587_0019461_428_1192 253
253 3300046543 Ga0495645_0002883 Ga0495645_0002883_4946_5710 253
254 3300046559 Ga0495667_0114138 Ga0495667_0114138_241_1005 253
255 3300046681 Ga0495647_0006948 Ga0495647_0006948_379_1143 253
256 3300046681 Ga0495647_0009049 Ga0495647_0009049_2439_3203 253
257 3300046683 Ga0495658_0036007 Ga0495658_0036007_686_1450 253
258 3300046683 Ga0495658_0066039 Ga0495658_0066039_977_1741 253
259 3300046684 Ga0495669_0014178 Ga0495669_0014178_620_1381 253
260 3300046684 Ga0495669_0052750 Ga0495669_0052750_529_1290 253
261 3300046689 Ga0495613_0326436 Ga0495613_0326436_158_922 253
262 3300046809 Ga0495600_0213727 Ga0495600_0213727_97_861 253
263 3300047317 Ga0495604_0036695 Ga0495604_0036695_1650_2414 253
264 3300047319 Ga0495674_0085507 Ga0495674_0085507_979_1743 253
265 3300047319 Ga0495674_0137832 Ga0495674_0137832_773_1537 253
266 3300047471 Ga0495684_0000214 Ga0495684_0000214_9537_10301 253
267 3300047471 Ga0495684_0027662 Ga0495684_0027662_2970_3734 253
268 3300048088 Ga0495602_0312685 Ga0495602_0312685_11_775 253
269 3300048907 Ga0496104_0116061 Ga0496104_0116061_1045_1848 253
270 3300048915 Ga0496112_0033234 Ga0496112_0033234_769_1572 253
271 3300048916 Ga0496113_0017182 Ga0496113_0017182_1094_1897 253
272 3300048917 Ga0496114_0074973 Ga0496114_0074973_914_1678 253
273 3300049572 Ga0501036_0352310 Ga0501036_0352310_171_935 253
274 3300049575 Ga0501039_0086376 Ga0501039_0086376_487_1251 253
275 3300049576 Ga0501040_0041886 Ga0501040_0041886_101_865 253
276 3300049577 Ga0501041_0207453 Ga0501041_0207453_268_1032 253
277 3300049577 Ga0501041_0252003 Ga0501041_0252003_79_840 253
278 3300049580 Ga0501046_0226890 Ga0501046_0226890_43_807 253
279 3300049582 Ga0501048_0008977 Ga0501048_0008977_2960_3724 253
280 3300049586 Ga0501070_0171817 Ga0501070_0171817_20_784 253
281 3300049587 Ga0501071_0060968 Ga0501071_0060968_1920_2696 253
282 3300049587 Ga0501071_0387782 Ga0501071_0387782_190_954 253
283 3300049588 Ga0501072_0092405 Ga0501072_0092405_779_1543 253
284 3300049590 Ga0501074_0026332 Ga0501074_0026332_1415_2179 253
285 3300049591 Ga0501075_0024935 Ga0501075_0024935_1991_2755 253
286 3300049591 Ga0501075_0075917 Ga0501075_0075917_102_866 253
287 3300049591 Ga0501075_0285111 Ga0501075_0285111_200_964 253
288 3300049592 Ga0501076_0057878 Ga0501076_0057878_879_1643 253
289 3300049592 Ga0501076_0157935 Ga0501076_0157935_122_886 253
290 3300049592 Ga0501076_0241453 Ga0501076_0241453_96_860 253
291 3300049592 Ga0501076_0564095 Ga0501076_0564095_35_799 253
292 3300049593 Ga0501077_0040921 Ga0501077_0040921_684_1448 253
293 3300049593 Ga0501077_0259285 Ga0501077_0259285_149_913 253
294 3300049741 Ga0501079_0116465 Ga0501079_0116465_292_1056 253
295 3300049741 Ga0501079_0152365 Ga0501079_0152365_95_859 253
296 3300049824 Ga0501045_0020563 Ga0501045_0020563_210_974 253
297 3300050491 nmdc:mga00v17_337971_c1 nmdc:mga00v17_337971_c1_14_778 253
298 3300050491 nmdc:mga00v17_35657_c1 nmdc:mga00v17_35657_c1_45_809 253
299 3300050493 nmdc:mga0k408_116619_c1 nmdc:mga0k408_116619_c1_501_1265 253
300 3300050493 nmdc:mga0k408_387368_c1 nmdc:mga0k408_387368_c1_38_799 253
301 3300050493 nmdc:mga0k408_81936_c1 nmdc:mga0k408_81936_c1_523_1287 253
302 3300050494 nmdc:mga06z11_133985_c1 nmdc:mga06z11_133985_c1_324_1088 253
303 3300050494 nmdc:mga06z11_14078_c1 nmdc:mga06z11_14078_c1_2101_2865 253
304 3300050494 nmdc:mga06z11_36034_c1 nmdc:mga06z11_36034_c1_1227_1991 253
305 3300050495 nmdc:mga04h51_23468_c1 nmdc:mga04h51_23468_c1_856_1620 253
306 3300050507 nmdc:mga05p37_10042_c1 nmdc:mga05p37_10042_c1_1187_1951 253
307 3300050507 nmdc:mga05p37_117110_c1 nmdc:mga05p37_117110_c1_1114_1878 253
308 3300050507 nmdc:mga05p37_119616_c1 nmdc:mga05p37_119616_c1_1533_2294 253
309 3300050507 nmdc:mga05p37_1840_c1 nmdc:mga05p37_1840_c1_16327_17091 253
310 3300050507 nmdc:mga05p37_40648_c1 nmdc:mga05p37_40648_c1_4756_5517 253
311 3300050507 nmdc:mga05p37_614_c1 nmdc:mga05p37_614_c1_7292_8056 253
312 3300050508 nmdc:mga09592_160156_c1 nmdc:mga09592_160156_c1_785_1549 253
313 3300050508 nmdc:mga09592_230559_c1 nmdc:mga09592_230559_c1_14_778 253
314 3300050508 nmdc:mga09592_23878_c1 nmdc:mga09592_23878_c1_642_1403 253
315 3300050509 nmdc:mga0qj67_8725_c1 nmdc:mga0qj67_8725_c1_4056_4820 253
316 3300050510 nmdc:mga06r32_20300_c1 nmdc:mga06r32_20300_c1_362_1126 253
317 3300050510 nmdc:mga06r32_6471_c1 nmdc:mga06r32_6471_c1_8084_8845 253
318 3300050511 nmdc:mga08y16_22116_c1 nmdc:mga08y16_22116_c1_3645_4409 253
319 3300050511 nmdc:mga08y16_25401_c1 nmdc:mga08y16_25401_c1_2547_3308 253
320 3300050511 nmdc:mga08y16_260333_c1 nmdc:mga08y16_260333_c1_1016_1777 253
321 3300050511 nmdc:mga08y16_288050_c1 nmdc:mga08y16_288050_c1_18_782 253
322 3300050511 nmdc:mga08y16_32464_c1 nmdc:mga08y16_32464_c1_1767_2531 253
323 3300050511 nmdc:mga08y16_755956_c1 nmdc:mga08y16_755956_c1_123_884 253
324 3300050512 nmdc:mga0n895_206608_c1 nmdc:mga0n895_206608_c1_1185_1949 253
325 3300050512 nmdc:mga0n895_48958_c1 nmdc:mga0n895_48958_c1_770_1531 253
326 3300050512 nmdc:mga0n895_787965_c1 nmdc:mga0n895_787965_c1_60_821 253
327 3300050514 nmdc:mga08x19_264182_c1 nmdc:mga08x19_264182_c1_354_1115 253
328 3300050515 nmdc:mga0a205_217521_c1 nmdc:mga0a205_217521_c1_829_1590 253
329 3300050515 nmdc:mga0a205_46225_c1 nmdc:mga0a205_46225_c1_1124_1885 253
330 3300050515 nmdc:mga0a205_48717_c1 nmdc:mga0a205_48717_c1_159_920 253
331 3300053077 Ga0495601_0002005 Ga0495601_0002005_7767_8531 253
332 3300053077 Ga0495601_0064159 Ga0495601_0064159_1385_2149 253
333 3300053084 Ga0495595_0138912 Ga0495595_0138912_415_1179 253
334 3300053084 Ga0495595_0212472 Ga0495595_0212472_102_866 253
335 3300053085 Ga0495619_0000427 Ga0495619_0000427_11733_12497 253
336 3300053134 Ga0500658_0043249 Ga0500658_0043249_26_790 253
337 3300054114 Ga0501084_0012166 Ga0501084_0012166_6341_7105 253
338 3300059421 Ga0590071_000954 Ga0590071_000954_3104_3868 253
339 3300059423 Ga0590074_002557 Ga0590074_002557_548_1312 253
340 3300059424 Ga0590075_000166 Ga0590075_000166_11014_11778 253
341 3300059426 Ga0590077_001199 Ga0590077_001199_2902_3666 253
342 3300060353 Ga0501082_0101723 Ga0501082_0101723_774_1538 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

188

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

87

218

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.8923 1 219
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.8806 2 215
5lj6-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p6522) 0.8804 2 215
5lil-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.8802 2 215
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8796 2 220
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9192 2 64 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8997 2 210 3.40.50.300
af_A0A096TX75_2_202_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8916 2 191 3.40.50.300
af_Q2FZN0_1_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8847 1 194 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8829 2 220 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382QEG3-F1-model_v4 ABC transporter domain-containing protein 0.9199 1 199 GO:0005524
GO:0016887
AF-A0A382QEG3-F1-model_v4 ABC transporter domain-containing protein 0.9028 1 199 GO:0005524
GO:0016887
AF-A0A521T9R7-F1-model_v4 ABC transporter ATP-binding protein 0.9019 1 217 GO:0005524
GO:0016887
AF-A0A7V3NJ16-F1-model_v4 ABC transporter ATP-binding protein 0.9018 2 223 GO:0005524
GO:0016887
AF-A0A7X9L6Q2-F1-model_v4 ABC transporter ATP-binding protein 0.8993 1 194 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
81.29 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map