F415087

General Info

Members Datasets Scaffolds Average Seq Length
342 207 338 105

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101779192|Ga0070664_1017791922
Length 114
Sequence MTGADKWTRVAATREVEEGEVIGRGVGGRDLAICRVLGTVYATDNICTHARARLSDGAFIDGYELECPLHGGKFDVRTGKGLCEPINQDLRTYPVRIVGDEVQVFLGGEVGGSN

Samples

Sample ID Description Type Environment
1 2643221609 Acidovorax sp. Root217 Isolate Unclassified
2 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
3 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
4 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
138 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
181 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
182 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
183 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.39
Nodule 0
Rhizoplane 2.05
Rhizosphere 59.94
Stem 0
Stem Tuber 0
Unclassified 14.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10019512 3300003316 Bacteria 4497
2 rootL2_10161818 3300003322 Bacteria 1726
3 Ga0070658_10002804 3300005327 Bacteria 14479
4 Ga0070676_10016341 3300005328 Bacteria 4102
5 Ga0070683_101460056 3300005329 Unclassified 657
6 Ga0068869_100118296 3300005334 Bacteria 2023
7 Ga0068869_100322628 3300005334 Bacteria 1253
8 Ga0070666_10906978 3300005335 Bacteria 652
9 Ga0070675_100224640 3300005354 Bacteria 1636
10 Ga0070675_102141363 3300005354 Unclassified 515
11 Ga0070671_100034118 3300005355 Bacteria 4212
12 Ga0070671_100127377 3300005355 Bacteria 2144
13 Ga0070673_100086947 3300005364 Bacteria 2547
14 Ga0070688_101546747 3300005365 Bacteria 541
15 Ga0070667_100064974 3300005367 Bacteria 3097
16 Ga0070667_102231629 3300005367 Bacteria 516
17 Ga0070708_101231187 3300005445 Bacteria 700
18 Ga0070678_100283583 3300005456 Bacteria 1402
19 Ga0070678_101409203 3300005456 Bacteria 651
20 Ga0070685_10120501 3300005466 Bacteria 1629
21 Ga0070672_100010739 3300005543 Bacteria 6363
22 Ga0070665_100278353 3300005548 Bacteria 1675
23 Ga0070665_100668795 3300005548 Bacteria 1051
24 Ga0068855_100136672 3300005563 Bacteria 2796
25 Ga0070664_101779192 3300005564 Unclassified 584
26 Ga0068857_100162697 3300005577 Bacteria 2025
27 Ga0068854_100356131 3300005578 Bacteria 1199
28 Ga0068852_100913899 3300005616 Bacteria 895
29 Ga0068859_100306399 3300005617 Bacteria 1682
30 Ga0068864_100014664 3300005618 Bacteria 6508
31 Ga0068870_10115031 3300005840 Bacteria 1541
32 Ga0068860_100372691 3300005843 Bacteria 1408
33 Ga0068860_101446200 3300005843 Bacteria 709
34 Ga0081455_10052821 3300005937 Bacteria 3476
35 Ga0075365_10025577 3300006038 Bacteria 3738
36 Ga0075368_10099559 3300006042 Bacteria 1193
37 Ga0075368_10209250 3300006042 Bacteria 827
38 Ga0075363_100024058 3300006048 Bacteria 3093
39 Ga0075363_100098285 3300006048 Bacteria 1618
40 Ga0075364_10032521 3300006051 Bacteria 3354
41 Ga0075362_10012721 3300006177 Bacteria 3349
42 Ga0075362_10027795 3300006177 Bacteria 2424
43 Ga0075362_10061757 3300006177 Bacteria 1696
44 Ga0075362_10075832 3300006177 Bacteria 1543
45 Ga0075362_10078719 3300006177 Bacteria 1517
46 Ga0075367_10003489 3300006178 Bacteria 7504
47 Ga0075367_10061035 3300006178 Bacteria 2249
48 Ga0075369_10337016 3300006186 Bacteria 707
49 Ga0075369_10401783 3300006186 Bacteria 646
50 Ga0075366_10004367 3300006195 Bacteria 7582
51 Ga0075366_10005063 3300006195 Bacteria 7126
52 Ga0075366_10062816 3300006195 Bacteria 2207
53 Ga0075366_10103288 3300006195 Bacteria 1711
54 Ga0075366_10108492 3300006195 Bacteria 1669
55 Ga0075366_10151140 3300006195 Bacteria 1406
56 Ga0075366_10184553 3300006195 Bacteria 1267
57 Ga0075366_10310856 3300006195 Bacteria 965
58 Ga0075366_10327738 3300006195 Bacteria 938
59 Ga0075366_10425962 3300006195 Bacteria 818
60 Ga0075366_10705571 3300006195 Bacteria 626
61 Ga0097621_100321941 3300006237 Bacteria 1370
62 Ga0097621_100455426 3300006237 Bacteria 1153
63 Ga0075370_10011977 3300006353 Bacteria 4570
64 Ga0075370_10025251 3300006353 Bacteria 3285
65 Ga0075370_10067824 3300006353 Bacteria 2037
66 Ga0075370_10079534 3300006353 Bacteria 1883
67 Ga0075370_10178901 3300006353 Bacteria 1248
68 Ga0075370_10221285 3300006353 Bacteria 1119
69 Ga0075370_10415758 3300006353 Bacteria 808
70 Ga0075434_100139155 3300006871 Bacteria 2447
71 Ga0068865_100211493 3300006881 Bacteria 1512
72 Ga0097620_100306401 3300006931 Bacteria 1682
73 Ga0105240_10873097 3300009093 Bacteria 969
74 Ga0105245_10011498 3300009098 Bacteria 7709
75 Ga0105245_10147538 3300009098 Bacteria 2220
76 Ga0105241_11626778 3300009174 Bacteria 625
77 Ga0105248_11070018 3300009177 Bacteria 911
78 Ga0105237_10123442 3300009545 Bacteria 2584
79 Ga0105237_10210367 3300009545 Bacteria 1945
80 Ga0105237_10211438 3300009545 Bacteria 1940
81 Ga0105238_10648551 3300009551 Bacteria 1066
82 Ga0105246_10116212 3300011119 Bacteria 1974
83 Ga0105246_11085690 3300011119 Bacteria 730
84 Ga0157370_10018176 3300013104 Bacteria 7076
85 Ga0157374_10237908 3300013296 Bacteria 1790
86 Ga0157378_10382884 3300013297 Bacteria 1382
87 Ga0157372_11839303 3300013307 Bacteria 696
88 Ga0157375_10277498 3300013308 Bacteria 1839
89 Ga0157375_10448228 3300013308 Bacteria 1456
90 Ga0163163_10574875 3300014325 Bacteria 1190
91 Ga0157379_10344909 3300014968 Bacteria 1363
92 Ga0157379_10679915 3300014968 Bacteria 965
93 Ga0157379_11623683 3300014968 Bacteria 632
94 Ga0157376_11158350 3300014969 Bacteria 800
95 Ga0209646_1000023 3300025246 Bacteria 441100
96 Ga0209026_1013794 3300025250 Bacteria 1365
97 Ga0207688_11011810 3300025901 Bacteria 525
98 Ga0207680_11026067 3300025903 Bacteria 590
99 Ga0207645_10004614 3300025907 Bacteria 10153
100 Ga0207645_10013156 3300025907 Bacteria 5586
101 Ga0207643_10009830 3300025908 Bacteria 5138
102 Ga0207705_10002003 3300025909 Bacteria 15840
103 Ga0207654_10646166 3300025911 Bacteria 757
104 Ga0207695_11035450 3300025913 Bacteria 700
105 Ga0207671_10100261 3300025914 Bacteria 2192
106 Ga0207649_10527986 3300025920 Bacteria 901
107 Ga0207694_10757298 3300025924 Bacteria 820
108 Ga0207659_11033483 3300025926 Bacteria 707
109 Ga0207687_10056676 3300025927 Bacteria 2749
110 Ga0207687_10078852 3300025927 Bacteria 2372
111 Ga0207687_10211834 3300025927 Bacteria 1521
112 Ga0207687_10392238 3300025927 Bacteria 1140
113 Ga0207644_10065196 3300025931 Bacteria 2648
114 Ga0207644_10070563 3300025931 Bacteria 2554
115 Ga0207644_10382331 3300025931 Bacteria 1148
116 Ga0207686_10769056 3300025934 Bacteria 770
117 Ga0207704_10382054 3300025938 Bacteria 1106
118 Ga0207691_10153924 3300025940 Bacteria 2020
119 Ga0207691_11425814 3300025940 Bacteria 568
120 Ga0207689_10120756 3300025942 Bacteria 2156
121 Ga0207689_10180386 3300025942 Bacteria 1741
122 Ga0207689_10269083 3300025942 Bacteria 1411
123 Ga0207689_10923446 3300025942 Bacteria 736
124 Ga0207667_10004476 3300025949 Bacteria 17111
125 Ga0207651_10128082 3300025960 Bacteria 1938
126 Ga0207651_11743862 3300025960 Bacteria 561
127 Ga0207640_10286300 3300025981 Bacteria 1297
128 Ga0207640_10427674 3300025981 Bacteria 1085
129 Ga0207640_11697448 3300025981 Bacteria 570
130 Ga0207658_10017295 3300025986 Bacteria 4967
131 Ga0207658_10772969 3300025986 Bacteria 871
132 Ga0207658_12164338 3300025986 Bacteria 505
133 Ga0207677_10117791 3300026023 Bacteria 1991
134 Ga0207677_10426178 3300026023 Bacteria 1131
135 Ga0207677_12093283 3300026023 Bacteria 526
136 Ga0207703_11550812 3300026035 Bacteria 637
137 Ga0207678_10742731 3300026067 Bacteria 865
138 Ga0207648_10017873 3300026089 Bacteria 6435
139 Ga0207648_10019036 3300026089 Bacteria 6200
140 Ga0207676_10194516 3300026095 Bacteria 1787
141 Ga0207674_10219577 3300026116 Bacteria 1849
142 Ga0207674_10604400 3300026116 Bacteria 1059
143 Ga0207683_10237209 3300026121 Bacteria 1663
144 Ga0209996_1001867 3300027395 Bacteria 2584
145 Ga0209968_1000702 3300027526 Bacteria 5159
146 Ga0209966_1000040 3300027695 Bacteria 54404
147 Ga0209813_10116668 3300027866 Bacteria 925
148 Ga0209974_10006173 3300027876 Bacteria 4198
149 Ga0268266_10010170 3300028379 Bacteria 8244
150 Ga0268266_10455050 3300028379 Bacteria 1217
151 Ga0268265_10087552 3300028380 Bacteria 2478
152 Ga0268264_10180300 3300028381 Bacteria 1917
153 Ga0268264_10275052 3300028381 Bacteria 1575
154 Ga0268264_11259302 3300028381 Bacteria 750
155 Ga0307517_10000160 3300028786 Bacteria 108370
156 Ga0307517_10000395 3300028786 Bacteria 74663
157 Ga0307517_10589362 3300028786 Bacteria 549
158 Ga0307515_10000006 3300028794 Bacteria 725810
159 Ga0307515_10000332 3300028794 Bacteria 116126
160 Ga0307515_10060601 3300028794 Bacteria 5392
161 Ga0307515_10206740 3300028794 Bacteria 1820
162 Ga0307511_10013142 3300030521 Bacteria 8095
163 Ga0307512_10041345 3300030522 Bacteria 3833
164 Ga0307512_10130900 3300030522 Bacteria 1574
165 Ga0307512_10139063 3300030522 Bacteria 1492
166 Ga0307513_10020560 3300031456 Bacteria 7826
167 Ga0307513_10801884 3300031456 Bacteria 647
168 Ga0307509_10000212 3300031507 Bacteria 92922
169 Ga0307509_10001515 3300031507 Bacteria 39177
170 Ga0307509_10161551 3300031507 Bacteria 2136
171 Ga0307509_10250752 3300031507 Bacteria 1554
172 Ga0307509_10330913 3300031507 Bacteria 1255
173 Ga0307509_10548735 3300031507 Bacteria 834
174 Ga0307509_10552386 3300031507 Bacteria 829
175 Ga0307408_100000196 3300031548 Bacteria 65663
176 Ga0307408_101484153 3300031548 Bacteria 641
177 Ga0307508_10000332 3300031616 Bacteria 57039
178 Ga0307508_10001697 3300031616 Bacteria 24440
179 Ga0307508_10006375 3300031616 Bacteria 11096
180 Ga0307508_10041135 3300031616 Bacteria 4149
181 Ga0307514_10066783 3300031649 Bacteria 2718
182 Ga0307514_10176693 3300031649 Bacteria 1384
183 Ga0307516_10063251 3300031730 Bacteria 3583
184 Ga0307516_10236422 3300031730 Bacteria 1528
185 Ga0307516_10257903 3300031730 Bacteria 1435
186 Ga0307516_10291613 3300031730 Bacteria 1310
187 Ga0307516_10362311 3300031730 Bacteria 1114
188 Ga0307405_10583186 3300031731 Bacteria 910
189 Ga0307405_10859803 3300031731 Bacteria 764
190 Ga0307405_11761347 3300031731 Bacteria 550
191 Ga0307410_11094406 3300031852 Bacteria 691
192 Ga0307406_10067497 3300031901 Bacteria 2332
193 Ga0307406_11343612 3300031901 Bacteria 625
194 Ga0307407_11518503 3300031903 Bacteria 530
195 Ga0307412_10647465 3300031911 Bacteria 901
196 Ga0307416_102171744 3300032002 Bacteria 657
197 Ga0307507_10003609 3300033179 Bacteria 29424
198 Ga0307507_10084452 3300033179 Bacteria 2767
199 Ga0307510_10286704 3300033180 Bacteria 1114
200 Ga0373930_0047804 3300034816 Bacteria 927
201 Ga0373932_0020198 3300035112 Bacteria 1744
202 Ga0373946_0292386 3300035171 Bacteria 804
203 Ga0373924_0001472 3300035410 Bacteria 7658
204 Ga0373931_0010336 3300035691 Bacteria 4485
205 Ga0373931_0410910 3300035691 Bacteria 859
206 Ga0373927_0949771 3300035695 Bacteria 567
207 Ga0373925_0057822 3300037068 Bacteria 2906
208 Ga0395900_0058554 3300037418 Bacteria 3966
209 Ga0395898_0031332 3300037466 Bacteria 5315
210 Ga0395905_0003396 3300037471 Bacteria 17047
211 Ga0395905_0115052 3300037471 Bacteria 2527
212 Ga0395905_0154779 3300037471 Bacteria 2156
213 Ga0395901_0000012 3300038443 Bacteria 381361
214 Ga0436360_0650797 3300039438 Bacteria 1648
215 Ga0436360_1132277 3300039438 Bacteria 2286
216 Ga0436361_0207225 3300039447 Bacteria 861
217 Ga0436363_0750708 3300039450 Bacteria 662
218 Ga0439453_0117999 3300041408 Bacteria 606
219 Ga0451789_1314594 3300041443 Bacteria 546
220 Ga0451841_0288774 3300041498 Bacteria 598
221 Ga0451849_1178856 3300041505 Bacteria 614
222 Ga0451855_1378282 3300041511 Bacteria 565
223 Ga0439433_0013375 3300041999 Bacteria 1802
224 Ga0439455_0003947 3300042012 Bacteria 2893
225 Ga0450894_025442 3300042131 Bacteria 810
226 Ga0450905_054341 3300042142 Bacteria 659
227 Ga0451577_0012109 3300042876 Bacteria 8113
228 Ga0451577_0680706 3300042876 Bacteria 932
229 Ga0466977_0008340 3300044666 Bacteria 5741
230 Ga0466963_0105424 3300044694 Bacteria 1932
231 Ga0495592_0000175 3300046454 Bacteria 56416
232 Ga0495592_0003711 3300046454 Bacteria 11010
233 Ga0495590_0000001 3300046457 Bacteria 762984
234 Ga0495590_0290648 3300046457 Bacteria 613
235 Ga0495638_0105756 3300046460 Bacteria 1677
236 Ga0495638_0365313 3300046460 Bacteria 758
237 Ga0495638_0381748 3300046460 Bacteria 736
238 Ga0495650_0113324 3300046471 Bacteria 1005
239 Ga0495585_0626440 3300046492 Bacteria 505
240 Ga0495606_0530436 3300046507 Bacteria 589
241 Ga0495610_0276498 3300046512 Bacteria 656
242 Ga0495610_0293728 3300046512 Bacteria 629
243 Ga0495618_0554303 3300046514 Unclassified 688
244 Ga0495630_0194883 3300046517 Bacteria 1546
245 Ga0495630_0288158 3300046517 Bacteria 1255
246 Ga0495632_0008164 3300046519 Bacteria 6468
247 Ga0495643_0000044 3300046522 Bacteria 226211
248 Ga0495648_0000001 3300046524 Bacteria 696872
249 Ga0495648_0023383 3300046524 Bacteria 4233
250 Ga0495648_0115262 3300046524 Bacteria 1454
251 Ga0495648_0193289 3300046524 Bacteria 1025
252 Ga0495648_0194533 3300046524 Bacteria 1020
253 Ga0495648_0402425 3300046524 Bacteria 611
254 Ga0495642_0000401 3300046528 Bacteria 23277
255 Ga0495642_0099496 3300046528 Bacteria 1237
256 Ga0495597_0000115 3300046542 Bacteria 72325
257 Ga0495597_0084653 3300046542 Bacteria 1352
258 Ga0495668_0000045 3300046616 Bacteria 225145
259 Ga0495668_0051691 3300046616 Bacteria 2275
260 Ga0495625_0000065 3300046660 Bacteria 173230
261 Ga0495625_0147503 3300046660 Bacteria 1583
262 Ga0495646_0005993 3300046680 Bacteria 7705
263 Ga0495669_0193509 3300046684 Bacteria 971
264 Ga0495624_0215218 3300046690 Bacteria 1165
265 Ga0495649_0007850 3300046694 Bacteria 6459
266 Ga0495660_0202517 3300046810 Bacteria 947
267 Ga0495676_0144215 3300047321 Bacteria 1703
268 Ga0495687_001099 3300047443 Bacteria 26415
269 Ga0495687_001273 3300047443 Bacteria 23729
270 Ga0495687_013163 3300047443 Bacteria 4330
271 Ga0495687_031321 3300047443 Bacteria 2440
272 Ga0495686_0001324 3300047472 Bacteria 27731
273 Ga0495686_0668610 3300047472 Bacteria 532
274 Ga0495614_0367677 3300048089 Bacteria 672
275 Ga0495626_0146678 3300048091 Bacteria 997
276 Ga0496101_0561846 3300048904 Bacteria 902
277 Ga0496102_0335806 3300048905 Bacteria 1423
278 Ga0496105_0335281 3300048908 Bacteria 1210
279 Ga0496106_0933359 3300048909 Bacteria 684
280 Ga0496113_0133633 3300048916 Bacteria 1949
281 Ga0496114_0314115 3300048917 Bacteria 1384
282 Ga0496116_0001220 3300048919 Bacteria 29937
283 Ga0496121_0089403 3300048924 Bacteria 2411
284 Ga0496125_0622828 3300048928 Bacteria 585
285 Ga0495678_033503 3300049459 Bacteria 2119
286 Ga0495682_0068522 3300049460 Bacteria 1278
287 Ga0501043_0365601 3300049579 Bacteria 1094
288 Ga0501206_015062 3300049653 Bacteria 1068
289 Ga0501229_049893 3300049706 Bacteria 616
290 Ga0501272_071595 3300049769 Bacteria 508
291 Ga0501279_001704 3300049775 Bacteria 2891
292 nmdc:mga03683_100415_c1 3300050489 Bacteria 1271
293 nmdc:mga03683_28002_c1 3300050489 Bacteria 2237
294 nmdc:mga03683_304346_c1 3300050489 Bacteria 748
295 nmdc:mga03683_9830_c1 3300050489 Bacteria 3415
296 nmdc:mga03n38_132691_c1 3300050490 Bacteria 1236
297 nmdc:mga03n38_165911_c1 3300050490 Bacteria 1121
298 nmdc:mga03n38_44662_c1 3300050490 Bacteria 1948
299 nmdc:mga00v17_22087_c1 3300050491 Bacteria 3667
300 nmdc:mga0yw44_32210_c1 3300050492 Bacteria 3053
301 nmdc:mga0k408_12545_c1 3300050493 Bacteria 4635
302 nmdc:mga0k408_133_c1 3300050493 Bacteria 36991
303 nmdc:mga0k408_136604_c1 3300050493 Bacteria 1457
304 nmdc:mga0k408_143867_c1 3300050493 Bacteria 1419
305 nmdc:mga0k408_244486_c1 3300050493 Bacteria 1072
306 nmdc:mga0k408_359923_c1 3300050493 Bacteria 867
307 nmdc:mga0k408_41756_c1 3300050493 Bacteria 2641
308 nmdc:mga0k408_509237_c1 3300050493 Bacteria 713
309 nmdc:mga0k408_749567_c1 3300050493 Bacteria 570
310 nmdc:mga0k408_79993_c1 3300050493 Bacteria 1913
311 nmdc:mga0k408_83142_c1 3300050493 Bacteria 1877
312 nmdc:mga06z11_3475_c1 3300050494 Bacteria 6102
313 nmdc:mga06z11_365783_c1 3300050494 Bacteria 865
314 nmdc:mga04h51_180803_c1 3300050495 Bacteria 821
315 nmdc:mga07m45_10967_c1 3300050496 Bacteria 4749
316 nmdc:mga07m45_117139_c1 3300050496 Bacteria 1537
317 nmdc:mga07m45_127_c1 3300050496 Bacteria 30414
318 nmdc:mga07m45_247529_c1 3300050496 Bacteria 1037
319 nmdc:mga07m45_257119_c1 3300050496 Bacteria 1016
320 nmdc:mga07m45_43309_c1 3300050496 Bacteria 2524
321 nmdc:mga07m45_88815_c1 3300050496 Bacteria 1769
322 nmdc:mga0n895_296272_c1 3300050512 Bacteria 1640
323 nmdc:mga0sz30_58547_c1 3300050516 Bacteria 1643
324 Ga0500578_0168990 3300053086 Bacteria 1353
325 Ga0500643_222807 3300053087 Bacteria 507
326 Ga0500644_0014654 3300053088 Bacteria 2218
327 Ga0500646_0027077 3300053090 Bacteria 1558
328 Ga0500583_0125474 3300053092 Bacteria 1271
329 Ga0500583_0366783 3300053092 Bacteria 695
330 Ga0500651_0211259 3300053093 Bacteria 1141
331 Ga0500594_0003320 3300053118 Bacteria 3523
332 Ga0500607_135680 3300053121 Bacteria 1166
333 Ga0500652_029224 3300053131 Bacteria 2148
334 Ga0500658_0042452 3300053134 Bacteria 1827
335 Ga0500559_0001694 3300053136 Bacteria 12147
336 Ga0500619_017417 3300053154 Bacteria 1998
337 Ga0500622_0008524 3300053156 Bacteria 5727
338 Ga0500587_009667 3300053739 Bacteria 1229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10206740 Ga0307515_102067402 97
2 3300031852 Ga0307410_11094406 Ga0307410_110944061 97
3 3300041999 Ga0439433_0013375 Ga0439433_0013375_424_741 97
4 3300042876 Ga0451577_0012109 Ga0451577_0012109_1168_1524 97
5 3300027876 Ga0209974_10006173 Ga0209974_100061734 98
6 3300050489 nmdc:mga03683_304346_c1 nmdc:mga03683_304346_c1_307_696 100
7 iso_pu_bacteria 2834641062 2834645135 100
8 iso_pu_bacteria 2643221644 2644244934 101
9 iso_pu_bacteria 2643221654 2644302576 101
10 3300005327 Ga0070658_10002804 Ga0070658_1000280415 103
11 3300005354 Ga0070675_102141363 Ga0070675_1021413631 103
12 3300005563 Ga0068855_100136672 Ga0068855_1001366724 103
13 3300005578 Ga0068854_100356131 Ga0068854_1003561313 103
14 3300009093 Ga0105240_10873097 Ga0105240_108730971 103
15 3300009545 Ga0105237_10123442 Ga0105237_101234423 103
16 3300009551 Ga0105238_10648551 Ga0105238_106485512 103
17 3300013104 Ga0157370_10018176 Ga0157370_100181767 103
18 3300013307 Ga0157372_11839303 Ga0157372_118393032 103
19 3300025909 Ga0207705_10002003 Ga0207705_1000200313 103
20 3300025913 Ga0207695_11035450 Ga0207695_110354502 103
21 3300025914 Ga0207671_10100261 Ga0207671_101002613 103
22 3300025924 Ga0207694_10757298 Ga0207694_107572982 103
23 3300025949 Ga0207667_10004476 Ga0207667_1000447613 103
24 3300025981 Ga0207640_10286300 Ga0207640_102863002 103
25 3300031731 Ga0307405_10859803 Ga0307405_108598031 103
26 3300031731 Ga0307405_11761347 Ga0307405_117613472 103
27 3300037418 Ga0395900_0058554 Ga0395900_0058554_858_1169 103
28 3300037466 Ga0395898_0031332 Ga0395898_0031332_2687_2998 103
29 3300038443 Ga0395901_0000012 Ga0395901_0000012_205764_206075 103
30 3300044694 Ga0466963_0105424 Ga0466963_0105424_499_810 103
31 3300006177 Ga0075362_10075832 Ga0075362_100758323 104
32 3300006871 Ga0075434_100139155 Ga0075434_1001391552 104
33 3300025246 Ga0209646_1000023 Ga0209646_1000023357 104
34 3300025250 Ga0209026_1013794 Ga0209026_10137942 104
35 3300031548 Ga0307408_100000196 Ga0307408_10000019619 104
36 3300035410 Ga0373924_0001472 Ga0373924_0001472_3959_4303 104
37 3300044666 Ga0466977_0008340 Ga0466977_0008340_3986_4300 104
38 3300046457 Ga0495590_0000001 Ga0495590_0000001_343067_343381 104
39 3300046514 Ga0495618_0554303 Ga0495618_0554303_196_540 104
40 3300046517 Ga0495630_0288158 Ga0495630_0288158_503_847 104
41 3300046522 Ga0495643_0000044 Ga0495643_0000044_49030_49344 104
42 3300046524 Ga0495648_0000001 Ga0495648_0000001_505846_506160 104
43 3300046528 Ga0495642_0000401 Ga0495642_0000401_11137_11451 104
44 3300046542 Ga0495597_0000115 Ga0495597_0000115_54724_55038 104
45 3300046616 Ga0495668_0000045 Ga0495668_0000045_36008_36322 104
46 3300046660 Ga0495625_0000065 Ga0495625_0000065_138176_138490 104
47 3300047443 Ga0495687_001099 Ga0495687_001099_7359_7673 104
48 3300047443 Ga0495687_001273 Ga0495687_001273_7354_7668 104
49 3300048905 Ga0496102_0335806 Ga0496102_0335806_129_461 104
50 3300048908 Ga0496105_0335281 Ga0496105_0335281_423_755 104
51 3300048909 Ga0496106_0933359 Ga0496106_0933359_223_555 104
52 3300048917 Ga0496114_0314115 Ga0496114_0314115_84_398 104
53 3300049459 Ga0495678_033503 Ga0495678_033503_943_1257 104
54 3300049579 Ga0501043_0365601 Ga0501043_0365601_23_337 104
55 3300049775 Ga0501279_001704 Ga0501279_001704_2195_2509 104
56 3300050489 nmdc:mga03683_100415_c1 nmdc:mga03683_100415_c1_107_421 104
57 3300050490 nmdc:mga03n38_165911_c1 nmdc:mga03n38_165911_c1_475_789 104
58 3300050493 nmdc:mga0k408_749567_c1 nmdc:mga0k408_749567_c1_26_340 104
59 3300050496 nmdc:mga07m45_10967_c1 nmdc:mga07m45_10967_c1_889_1203 104
60 3300050512 nmdc:mga0n895_296272_c1 nmdc:mga0n895_296272_c1_290_604 104
61 iso_pu_bacteria 2643221609 2644059194 104
62 3300005328 Ga0070676_10016341 Ga0070676_100163415 105
63 3300005329 Ga0070683_101460056 Ga0070683_1014600561 105
64 3300005334 Ga0068869_100118296 Ga0068869_1001182963 105
65 3300005334 Ga0068869_100322628 Ga0068869_1003226281 105
66 3300005335 Ga0070666_10906978 Ga0070666_109069782 105
67 3300005354 Ga0070675_100224640 Ga0070675_1002246403 105
68 3300005355 Ga0070671_100034118 Ga0070671_1000341185 105
69 3300005355 Ga0070671_100127377 Ga0070671_1001273773 105
70 3300005364 Ga0070673_100086947 Ga0070673_1000869472 105
71 3300005365 Ga0070688_101546747 Ga0070688_1015467471 105
72 3300005367 Ga0070667_100064974 Ga0070667_1000649742 105
73 3300005367 Ga0070667_102231629 Ga0070667_1022316291 105
74 3300005445 Ga0070708_101231187 Ga0070708_1012311872 105
75 3300005456 Ga0070678_100283583 Ga0070678_1002835832 105
76 3300005456 Ga0070678_101409203 Ga0070678_1014092031 105
77 3300005466 Ga0070685_10120501 Ga0070685_101205012 105
78 3300005543 Ga0070672_100010739 Ga0070672_1000107396 105
79 3300005548 Ga0070665_100278353 Ga0070665_1002783533 105
80 3300005548 Ga0070665_100668795 Ga0070665_1006687952 105
81 3300005564 Ga0070664_101779192 Ga0070664_1017791922 105
82 3300005577 Ga0068857_100162697 Ga0068857_1001626972 105
83 3300005616 Ga0068852_100913899 Ga0068852_1009138992 105
84 3300005617 Ga0068859_100306399 Ga0068859_1003063993 105
85 3300005618 Ga0068864_100014664 Ga0068864_1000146642 105
86 3300005840 Ga0068870_10115031 Ga0068870_101150313 105
87 3300005843 Ga0068860_100372691 Ga0068860_1003726912 105
88 3300005843 Ga0068860_101446200 Ga0068860_1014462001 105
89 3300005937 Ga0081455_10052821 Ga0081455_100528216 105
90 3300006038 Ga0075365_10025577 Ga0075365_100255773 105
91 3300006042 Ga0075368_10099559 Ga0075368_100995592 105
92 3300006042 Ga0075368_10209250 Ga0075368_102092502 105
93 3300006048 Ga0075363_100024058 Ga0075363_1000240583 105
94 3300006048 Ga0075363_100098285 Ga0075363_1000982853 105
95 3300006051 Ga0075364_10032521 Ga0075364_100325214 105
96 3300006177 Ga0075362_10012721 Ga0075362_100127212 105
97 3300006177 Ga0075362_10027795 Ga0075362_100277953 105
98 3300006177 Ga0075362_10061757 Ga0075362_100617573 105
99 3300006178 Ga0075367_10003489 Ga0075367_100034892 105
100 3300006178 Ga0075367_10061035 Ga0075367_100610352 105
101 3300006186 Ga0075369_10337016 Ga0075369_103370161 105
102 3300006186 Ga0075369_10401783 Ga0075369_104017832 105
103 3300006195 Ga0075366_10004367 Ga0075366_100043677 105
104 3300006195 Ga0075366_10005063 Ga0075366_100050639 105
105 3300006195 Ga0075366_10062816 Ga0075366_100628163 105
106 3300006195 Ga0075366_10108492 Ga0075366_101084923 105
107 3300006195 Ga0075366_10151140 Ga0075366_101511401 105
108 3300006195 Ga0075366_10184553 Ga0075366_101845532 105
109 3300006195 Ga0075366_10310856 Ga0075366_103108562 105
110 3300006195 Ga0075366_10425962 Ga0075366_104259622 105
111 3300006195 Ga0075366_10705571 Ga0075366_107055711 105
112 3300006237 Ga0097621_100321941 Ga0097621_1003219413 105
113 3300006237 Ga0097621_100455426 Ga0097621_1004554262 105
114 3300006353 Ga0075370_10011977 Ga0075370_100119772 105
115 3300006353 Ga0075370_10025251 Ga0075370_100252512 105
116 3300006353 Ga0075370_10067824 Ga0075370_100678243 105
117 3300006353 Ga0075370_10079534 Ga0075370_100795342 105
118 3300006353 Ga0075370_10178901 Ga0075370_101789012 105
119 3300006353 Ga0075370_10221285 Ga0075370_102212853 105
120 3300006353 Ga0075370_10415758 Ga0075370_104157582 105
121 3300006881 Ga0068865_100211493 Ga0068865_1002114932 105
122 3300006931 Ga0097620_100306401 Ga0097620_1003064013 105
123 3300009098 Ga0105245_10011498 Ga0105245_100114987 105
124 3300009098 Ga0105245_10147538 Ga0105245_101475382 105
125 3300009174 Ga0105241_11626778 Ga0105241_116267781 105
126 3300009177 Ga0105248_11070018 Ga0105248_110700181 105
127 3300009545 Ga0105237_10210367 Ga0105237_102103673 105
128 3300009545 Ga0105237_10211438 Ga0105237_102114382 105
129 3300011119 Ga0105246_10116212 Ga0105246_101162123 105
130 3300011119 Ga0105246_11085690 Ga0105246_110856901 105
131 3300013296 Ga0157374_10237908 Ga0157374_102379082 105
132 3300013297 Ga0157378_10382884 Ga0157378_103828842 105
133 3300013308 Ga0157375_10277498 Ga0157375_102774982 105
134 3300013308 Ga0157375_10448228 Ga0157375_104482282 105
135 3300014325 Ga0163163_10574875 Ga0163163_105748752 105
136 3300014968 Ga0157379_10344909 Ga0157379_103449092 105
137 3300014968 Ga0157379_10679915 Ga0157379_106799152 105
138 3300014968 Ga0157379_11623683 Ga0157379_116236831 105
139 3300014969 Ga0157376_11158350 Ga0157376_111583502 105
140 3300025901 Ga0207688_11011810 Ga0207688_110118102 105
141 3300025903 Ga0207680_11026067 Ga0207680_110260671 105
142 3300025907 Ga0207645_10004614 Ga0207645_100046147 105
143 3300025907 Ga0207645_10013156 Ga0207645_100131562 105
144 3300025908 Ga0207643_10009830 Ga0207643_100098304 105
145 3300025911 Ga0207654_10646166 Ga0207654_106461662 105
146 3300025920 Ga0207649_10527986 Ga0207649_105279862 105
147 3300025926 Ga0207659_11033483 Ga0207659_110334832 105
148 3300025927 Ga0207687_10056676 Ga0207687_100566763 105
149 3300025927 Ga0207687_10078852 Ga0207687_100788521 105
150 3300025927 Ga0207687_10211834 Ga0207687_102118341 105
151 3300025927 Ga0207687_10392238 Ga0207687_103922381 105
152 3300025931 Ga0207644_10065196 Ga0207644_100651961 105
153 3300025931 Ga0207644_10070563 Ga0207644_100705631 105
154 3300025931 Ga0207644_10382331 Ga0207644_103823312 105
155 3300025934 Ga0207686_10769056 Ga0207686_107690562 105
156 3300025938 Ga0207704_10382054 Ga0207704_103820542 105
157 3300025940 Ga0207691_10153924 Ga0207691_101539243 105
158 3300025940 Ga0207691_11425814 Ga0207691_114258141 105
159 3300025942 Ga0207689_10120756 Ga0207689_101207563 105
160 3300025942 Ga0207689_10180386 Ga0207689_101803863 105
161 3300025942 Ga0207689_10269083 Ga0207689_102690833 105
162 3300025942 Ga0207689_10923446 Ga0207689_109234461 105
163 3300025960 Ga0207651_10128082 Ga0207651_101280823 105
164 3300025960 Ga0207651_11743862 Ga0207651_117438622 105
165 3300025981 Ga0207640_10427674 Ga0207640_104276742 105
166 3300025981 Ga0207640_11697448 Ga0207640_116974481 105
167 3300025986 Ga0207658_10017295 Ga0207658_100172956 105
168 3300025986 Ga0207658_10772969 Ga0207658_107729692 105
169 3300025986 Ga0207658_12164338 Ga0207658_121643381 105
170 3300026023 Ga0207677_10117791 Ga0207677_101177912 105
171 3300026023 Ga0207677_10426178 Ga0207677_104261782 105
172 3300026023 Ga0207677_12093283 Ga0207677_120932831 105
173 3300026035 Ga0207703_11550812 Ga0207703_115508122 105
174 3300026067 Ga0207678_10742731 Ga0207678_107427312 105
175 3300026089 Ga0207648_10017873 Ga0207648_100178735 105
176 3300026089 Ga0207648_10019036 Ga0207648_100190363 105
177 3300026095 Ga0207676_10194516 Ga0207676_101945162 105
178 3300026116 Ga0207674_10219577 Ga0207674_102195772 105
179 3300026116 Ga0207674_10604400 Ga0207674_106044001 105
180 3300026121 Ga0207683_10237209 Ga0207683_102372092 105
181 3300027395 Ga0209996_1001867 Ga0209996_10018671 105
182 3300027526 Ga0209968_1000702 Ga0209968_10007025 105
183 3300027695 Ga0209966_1000040 Ga0209966_100004038 105
184 3300027866 Ga0209813_10116668 Ga0209813_101166682 105
185 3300028379 Ga0268266_10010170 Ga0268266_100101702 105
186 3300028379 Ga0268266_10455050 Ga0268266_104550501 105
187 3300028380 Ga0268265_10087552 Ga0268265_100875521 105
188 3300028381 Ga0268264_10180300 Ga0268264_101803002 105
189 3300028381 Ga0268264_10275052 Ga0268264_102750522 105
190 3300028381 Ga0268264_11259302 Ga0268264_112593021 105
191 3300028786 Ga0307517_10000160 Ga0307517_1000016045 105
192 3300028786 Ga0307517_10000395 Ga0307517_1000039560 105
193 3300028786 Ga0307517_10589362 Ga0307517_105893621 105
194 3300028794 Ga0307515_10000006 Ga0307515_10000006470 105
195 3300028794 Ga0307515_10000332 Ga0307515_1000033224 105
196 3300028794 Ga0307515_10060601 Ga0307515_100606015 105
197 3300030521 Ga0307511_10013142 Ga0307511_100131422 105
198 3300030522 Ga0307512_10041345 Ga0307512_100413453 105
199 3300030522 Ga0307512_10130900 Ga0307512_101309002 105
200 3300030522 Ga0307512_10139063 Ga0307512_101390633 105
201 3300031456 Ga0307513_10020560 Ga0307513_100205604 105
202 3300031456 Ga0307513_10801884 Ga0307513_108018842 105
203 3300031507 Ga0307509_10000212 Ga0307509_1000021236 105
204 3300031507 Ga0307509_10001515 Ga0307509_1000151521 105
205 3300031507 Ga0307509_10161551 Ga0307509_101615513 105
206 3300031507 Ga0307509_10250752 Ga0307509_102507522 105
207 3300031507 Ga0307509_10330913 Ga0307509_103309132 105
208 3300031507 Ga0307509_10548735 Ga0307509_105487351 105
209 3300031507 Ga0307509_10552386 Ga0307509_105523862 105
210 3300031548 Ga0307408_101484153 Ga0307408_1014841532 105
211 3300031616 Ga0307508_10000332 Ga0307508_100003324 105
212 3300031616 Ga0307508_10001697 Ga0307508_1000169711 105
213 3300031616 Ga0307508_10006375 Ga0307508_100063757 105
214 3300031616 Ga0307508_10041135 Ga0307508_100411352 105
215 3300031649 Ga0307514_10066783 Ga0307514_100667832 105
216 3300031649 Ga0307514_10176693 Ga0307514_101766933 105
217 3300031730 Ga0307516_10063251 Ga0307516_100632513 105
218 3300031730 Ga0307516_10236422 Ga0307516_102364222 105
219 3300031730 Ga0307516_10257903 Ga0307516_102579032 105
220 3300031730 Ga0307516_10291613 Ga0307516_102916132 105
221 3300031730 Ga0307516_10362311 Ga0307516_103623112 105
222 3300031731 Ga0307405_10583186 Ga0307405_105831862 105
223 3300031901 Ga0307406_10067497 Ga0307406_100674971 105
224 3300031901 Ga0307406_11343612 Ga0307406_113436122 105
225 3300031903 Ga0307407_11518503 Ga0307407_115185032 105
226 3300031911 Ga0307412_10647465 Ga0307412_106474652 105
227 3300032002 Ga0307416_102171744 Ga0307416_1021717441 105
228 3300033179 Ga0307507_10003609 Ga0307507_1000360929 105
229 3300033179 Ga0307507_10084452 Ga0307507_100844523 105
230 3300033180 Ga0307510_10286704 Ga0307510_102867042 105
231 3300034816 Ga0373930_0047804 Ga0373930_0047804_545_862 105
232 3300035112 Ga0373932_0020198 Ga0373932_0020198_1012_1329 105
233 3300035171 Ga0373946_0292386 Ga0373946_0292386_421_738 105
234 3300035691 Ga0373931_0010336 Ga0373931_0010336_2438_2755 105
235 3300035691 Ga0373931_0410910 Ga0373931_0410910_337_654 105
236 3300035695 Ga0373927_0949771 Ga0373927_0949771_228_545 105
237 3300037068 Ga0373925_0057822 Ga0373925_0057822_212_529 105
238 3300037471 Ga0395905_0115052 Ga0395905_0115052_643_960 105
239 3300037471 Ga0395905_0154779 Ga0395905_0154779_1461_1778 105
240 3300039438 Ga0436360_0650797 Ga0436360_0650797_1140_1460 105
241 3300039438 Ga0436360_1132277 Ga0436360_1132277_280_600 105
242 3300039447 Ga0436361_0207225 Ga0436361_0207225_508_828 105
243 3300041408 Ga0439453_0117999 Ga0439453_0117999_186_503 105
244 3300041443 Ga0451789_1314594 Ga0451789_1314594_57_374 105
245 3300041498 Ga0451841_0288774 Ga0451841_0288774_54_371 105
246 3300041505 Ga0451849_1178856 Ga0451849_1178856_250_594 105
247 3300041511 Ga0451855_1378282 Ga0451855_1378282_192_509 105
248 3300042012 Ga0439455_0003947 Ga0439455_0003947_531_848 105
249 3300042131 Ga0450894_025442 Ga0450894_025442_196_513 105
250 3300042142 Ga0450905_054341 Ga0450905_054341_316_633 105
251 3300042876 Ga0451577_0680706 Ga0451577_0680706_399_734 105
252 3300046454 Ga0495592_0000175 Ga0495592_0000175_21237_21554 105
253 3300046454 Ga0495592_0003711 Ga0495592_0003711_1710_2027 105
254 3300046457 Ga0495590_0290648 Ga0495590_0290648_39_356 105
255 3300046460 Ga0495638_0105756 Ga0495638_0105756_1239_1556 105
256 3300046460 Ga0495638_0365313 Ga0495638_0365313_393_710 105
257 3300046460 Ga0495638_0381748 Ga0495638_0381748_350_667 105
258 3300046471 Ga0495650_0113324 Ga0495650_0113324_157_474 105
259 3300046492 Ga0495585_0626440 Ga0495585_0626440_114_431 105
260 3300046507 Ga0495606_0530436 Ga0495606_0530436_17_334 105
261 3300046512 Ga0495610_0276498 Ga0495610_0276498_109_426 105
262 3300046512 Ga0495610_0293728 Ga0495610_0293728_236_553 105
263 3300046517 Ga0495630_0194883 Ga0495630_0194883_964_1281 105
264 3300046519 Ga0495632_0008164 Ga0495632_0008164_5411_5728 105
265 3300046524 Ga0495648_0023383 Ga0495648_0023383_3796_4113 105
266 3300046524 Ga0495648_0115262 Ga0495648_0115262_529_846 105
267 3300046524 Ga0495648_0193289 Ga0495648_0193289_624_941 105
268 3300046524 Ga0495648_0194533 Ga0495648_0194533_359_676 105
269 3300046524 Ga0495648_0402425 Ga0495648_0402425_85_402 105
270 3300046528 Ga0495642_0099496 Ga0495642_0099496_336_653 105
271 3300046542 Ga0495597_0084653 Ga0495597_0084653_277_639 105
272 3300046616 Ga0495668_0051691 Ga0495668_0051691_830_1147 105
273 3300046660 Ga0495625_0147503 Ga0495625_0147503_990_1307 105
274 3300046680 Ga0495646_0005993 Ga0495646_0005993_4681_4998 105
275 3300046684 Ga0495669_0193509 Ga0495669_0193509_306_623 105
276 3300046690 Ga0495624_0215218 Ga0495624_0215218_758_1075 105
277 3300046694 Ga0495649_0007850 Ga0495649_0007850_1003_1320 105
278 3300046810 Ga0495660_0202517 Ga0495660_0202517_351_668 105
279 3300047321 Ga0495676_0144215 Ga0495676_0144215_1131_1448 105
280 3300047443 Ga0495687_013163 Ga0495687_013163_2839_3156 105
281 3300047443 Ga0495687_031321 Ga0495687_031321_1801_2118 105
282 3300047472 Ga0495686_0001324 Ga0495686_0001324_19719_20036 105
283 3300047472 Ga0495686_0668610 Ga0495686_0668610_139_456 105
284 3300048089 Ga0495614_0367677 Ga0495614_0367677_32_349 105
285 3300048091 Ga0495626_0146678 Ga0495626_0146678_426_743 105
286 3300048904 Ga0496101_0561846 Ga0496101_0561846_400_717 105
287 3300048916 Ga0496113_0133633 Ga0496113_0133633_1336_1653 105
288 3300048919 Ga0496116_0001220 Ga0496116_0001220_14874_15212 105
289 3300048924 Ga0496121_0089403 Ga0496121_0089403_1081_1398 105
290 3300048928 Ga0496125_0622828 Ga0496125_0622828_143_460 105
291 3300049460 Ga0495682_0068522 Ga0495682_0068522_113_430 105
292 3300049653 Ga0501206_015062 Ga0501206_015062_727_1044 105
293 3300049706 Ga0501229_049893 Ga0501229_049893_269_586 105
294 3300049769 Ga0501272_071595 Ga0501272_071595_52_369 105
295 3300050489 nmdc:mga03683_28002_c1 nmdc:mga03683_28002_c1_452_769 105
296 3300050489 nmdc:mga03683_9830_c1 nmdc:mga03683_9830_c1_359_676 105
297 3300050490 nmdc:mga03n38_132691_c1 nmdc:mga03n38_132691_c1_387_704 105
298 3300050490 nmdc:mga03n38_44662_c1 nmdc:mga03n38_44662_c1_583_900 105
299 3300050491 nmdc:mga00v17_22087_c1 nmdc:mga00v17_22087_c1_589_906 105
300 3300050492 nmdc:mga0yw44_32210_c1 nmdc:mga0yw44_32210_c1_2222_2539 105
301 3300050493 nmdc:mga0k408_12545_c1 nmdc:mga0k408_12545_c1_1285_1602 105
302 3300050493 nmdc:mga0k408_133_c1 nmdc:mga0k408_133_c1_3407_3724 105
303 3300050493 nmdc:mga0k408_136604_c1 nmdc:mga0k408_136604_c1_404_721 105
304 3300050493 nmdc:mga0k408_359923_c1 nmdc:mga0k408_359923_c1_295_612 105
305 3300050493 nmdc:mga0k408_41756_c1 nmdc:mga0k408_41756_c1_1109_1426 105
306 3300050493 nmdc:mga0k408_509237_c1 nmdc:mga0k408_509237_c1_163_480 105
307 3300050493 nmdc:mga0k408_79993_c1 nmdc:mga0k408_79993_c1_1461_1778 105
308 3300050493 nmdc:mga0k408_83142_c1 nmdc:mga0k408_83142_c1_493_810 105
309 3300050494 nmdc:mga06z11_3475_c1 nmdc:mga06z11_3475_c1_1059_1376 105
310 3300050494 nmdc:mga06z11_365783_c1 nmdc:mga06z11_365783_c1_312_629 105
311 3300050495 nmdc:mga04h51_180803_c1 nmdc:mga04h51_180803_c1_368_685 105
312 3300050496 nmdc:mga07m45_117139_c1 nmdc:mga07m45_117139_c1_99_416 105
313 3300050496 nmdc:mga07m45_127_c1 nmdc:mga07m45_127_c1_10915_11232 105
314 3300050496 nmdc:mga07m45_247529_c1 nmdc:mga07m45_247529_c1_240_557 105
315 3300050496 nmdc:mga07m45_257119_c1 nmdc:mga07m45_257119_c1_69_386 105
316 3300050496 nmdc:mga07m45_43309_c1 nmdc:mga07m45_43309_c1_231_548 105
317 3300050496 nmdc:mga07m45_88815_c1 nmdc:mga07m45_88815_c1_594_911 105
318 3300050516 nmdc:mga0sz30_58547_c1 nmdc:mga0sz30_58547_c1_1096_1413 105
319 3300053086 Ga0500578_0168990 Ga0500578_0168990_719_1036 105
320 3300053087 Ga0500643_222807 Ga0500643_222807_82_399 105
321 3300053088 Ga0500644_0014654 Ga0500644_0014654_871_1188 105
322 3300053090 Ga0500646_0027077 Ga0500646_0027077_975_1292 105
323 3300053092 Ga0500583_0125474 Ga0500583_0125474_644_961 105
324 3300053092 Ga0500583_0366783 Ga0500583_0366783_243_560 105
325 3300053093 Ga0500651_0211259 Ga0500651_0211259_559_876 105
326 3300053118 Ga0500594_0003320 Ga0500594_0003320_2816_3133 105
327 3300053121 Ga0500607_135680 Ga0500607_135680_629_946 105
328 3300053131 Ga0500652_029224 Ga0500652_029224_233_550 105
329 3300053134 Ga0500658_0042452 Ga0500658_0042452_444_761 105
330 3300053136 Ga0500559_0001694 Ga0500559_0001694_10931_11248 105
331 3300053154 Ga0500619_017417 Ga0500619_017417_1289_1606 105
332 3300053156 Ga0500622_0008524 Ga0500622_0008524_591_908 105
333 3300053739 Ga0500587_009667 Ga0500587_009667_288_605 105
334 3300006177 Ga0075362_10078719 Ga0075362_100787193 107
335 3300006195 Ga0075366_10103288 Ga0075366_101032882 107
336 3300006195 Ga0075366_10327738 Ga0075366_103277382 107
337 3300037471 Ga0395905_0003396 Ga0395905_0003396_4883_5209 107
338 3300039450 Ga0436363_0750708 Ga0436363_0750708_266_598 107
339 3300050493 nmdc:mga0k408_143867_c1 nmdc:mga0k408_143867_c1_393_716 107
340 3300050493 nmdc:mga0k408_244486_c1 nmdc:mga0k408_244486_c1_375_698 107
341 3300003316 rootH1_10019512 rootH1_100195128 108
342 3300003322 rootL2_10161818 rootL2_101618182 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

6

94

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

6

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9789 6 108
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9762 9 108
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9696 6 108
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9528 8 105
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9483 9 108
ID Description Score Start End Superfamily
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9763 9 108 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9529 11 108 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9506 11 108 2.102.10.10
af_Q9VJ03_9_118_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9502 10 108 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9484 9 108 2.102.10.10
ID Description Score Start End GO Terms
AF-O07823-F1-model_v4 Naphthalene 1,2-dioxygenase system, ferredoxin component 0.9909 22 108 GO:0009056
GO:0046872
GO:0051537
AF-A0A176XVG0-F1-model_v4 Naphthalene 1,2-dioxygenase 0.9855 8 107 GO:0009056
GO:0046872
GO:0051213
GO:0051537
AF-A0A4D6EZ52-F1-model_v4 PAH ring hydroxylating dioxygenase 0.9853 8 98 GO:0046872
GO:0051213
GO:0051537
AF-A0A1G6NR79-F1-model_v4 Naphthalene 1,2-dioxygenase system ferredoxin subunit 0.9844 6 108 GO:0009056
GO:0046872
GO:0051213
GO:0051537
AF-A0A7U3GEJ0-F1-model_v4 deleted 0.984 8 105

Feature Viewer

pLDDT pTM Quality
94.6 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map