F415075

General Info

Members Datasets Scaffolds Average Seq Length
342 184 684 244

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100068200|Ga0070707_1000682003
Length 280
Sequence MKIIGTLGRAVKARPTKTNIDMKGSTKGQVALARALSKMGIMSRAEAARRIRSGEIVVNGTVVTDPDHPVVPEHASIQVAGATVRHEPALTLLFHKPRGVVTTRSDPQGRPTVFDLLGTLPRYVAPVGRLDLASTGLLLLTNDTRLADWLLDPAHAVPRVYIVTVRGELADETLDRARAGLRVDGDLLRAREIEVLKRSRRETHMRVTLVEGKNRELRRLFAACGCEVTRLKRVAFGGLELGTLTPGKWRVVRASELRRAFPRAPLKDERHDEKHGPRRH

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 0.58
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 11.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100068200 3300005468 Bacteria 3423
2 Ga0065707_10157119 3300005295 Bacteria 1598
3 Ga0070676_10151950 3300005328 Bacteria 1483
4 Ga0070670_100301870 3300005331 Bacteria 1401
5 Ga0070689_100104098 3300005340 Bacteria 2250
6 Ga0070675_100687069 3300005354 Unclassified 932
7 Ga0070673_100057420 3300005364 Bacteria 3075
8 Ga0070667_100126847 3300005367 Bacteria 2224
9 Ga0070667_100177570 3300005367 Bacteria 1882
10 Ga0070667_100275060 3300005367 Bacteria 1511
11 Ga0070714_100049928 3300005435 Bacteria 3561
12 Ga0070710_10026504 3300005437 Bacteria 3080
13 Ga0070694_100516155 3300005444 Unclassified 953
14 Ga0070678_100028903 3300005456 Bacteria 3788
15 Ga0070678_100042009 3300005456 Bacteria 3247
16 Ga0068867_100122204 3300005459 Unclassified 2014
17 Ga0070706_100043903 3300005467 Bacteria 4129
18 Ga0070698_100207352 3300005471 Unclassified 1895
19 Ga0070672_100259391 3300005543 Bacteria 1465
20 Ga0070686_100447975 3300005544 Bacteria 992
21 Ga0070686_100693802 3300005544 Bacteria 811
22 Ga0070693_100172891 3300005547 Bacteria 1385
23 Ga0070665_100556953 3300005548 Unclassified 1159
24 Ga0068854_100065381 3300005578 Bacteria 2644
25 Ga0068859_100060786 3300005617 Bacteria 3807
26 Ga0068859_100088572 3300005617 Bacteria 3145
27 Ga0068859_100356311 3300005617 Bacteria 1558
28 Ga0068859_100483249 3300005617 Bacteria 1334
29 Ga0068860_100245519 3300005843 Unclassified 1742
30 Ga0068860_100266215 3300005843 Bacteria 1672
31 Ga0068862_100180170 3300005844 Bacteria 1896
32 Ga0081455_10041554 3300005937 Bacteria 4042
33 Ga0081539_10003386 3300005985 Bacteria 19733
34 Ga0075368_10027801 3300006042 Bacteria 2183
35 Ga0075368_10098750 3300006042 Bacteria 1197
36 Ga0075363_100170857 3300006048 Bacteria 1234
37 Ga0075364_10158361 3300006051 Bacteria 1528
38 Ga0075367_10024619 3300006178 Bacteria 3396
39 Ga0075367_10112012 3300006178 Bacteria 1676
40 Ga0075367_10272980 3300006178 Unclassified 1062
41 Ga0075366_10039426 3300006195 Bacteria 2793
42 Ga0075366_10039595 3300006195 Bacteria 2786
43 Ga0075366_10055928 3300006195 Bacteria 2343
44 Ga0097621_100029563 3300006237 Bacteria 4329
45 Ga0097621_100086316 3300006237 Bacteria 2619
46 Ga0097621_100088704 3300006237 Bacteria 2585
47 Ga0068871_100007844 3300006358 Bacteria 7649
48 Ga0068871_100117852 3300006358 Bacteria 2240
49 Ga0068871_100119043 3300006358 Bacteria 2229
50 Ga0075428_100039496 3300006844 Bacteria 5195
51 Ga0075428_100046809 3300006844 Bacteria 4751
52 Ga0075433_10032730 3300006852 Bacteria 4455
53 Ga0075433_10050988 3300006852 Bacteria 3603
54 Ga0075433_10071776 3300006852 Unclassified 3043
55 Ga0075433_10170649 3300006852 Bacteria 1936
56 Ga0075433_10251804 3300006852 Bacteria 1567
57 Ga0075434_100000589 3300006871 Bacteria 28031
58 Ga0075434_100007544 3300006871 Bacteria 10076
59 Ga0075429_100414091 3300006880 Bacteria 1180
60 Ga0068865_100038449 3300006881 Bacteria 3239
61 Ga0068865_100229269 3300006881 Bacteria 1456
62 Ga0075436_100000036 3300006914 Bacteria 84076
63 Ga0075436_100001233 3300006914 Bacteria 17415
64 Ga0075436_100038004 3300006914 Bacteria 3323
65 Ga0075436_100232152 3300006914 Bacteria 1311
66 Ga0097620_100060785 3300006931 Bacteria 3807
67 Ga0097620_100088572 3300006931 Bacteria 3145
68 Ga0097620_100356322 3300006931 Bacteria 1558
69 Ga0097620_100483216 3300006931 Bacteria 1334
70 Ga0097620_100547929 3300006931 Bacteria 1251
71 Ga0075435_100000014 3300007076 Bacteria 100771
72 Ga0075435_100183286 3300007076 Bacteria 1770
73 Ga0075435_100337147 3300007076 Bacteria 1292
74 Ga0105240_10297272 3300009093 Bacteria 1848
75 Ga0111539_10003531 3300009094 Bacteria 20612
76 Ga0111539_10067628 3300009094 Bacteria 4219
77 Ga0111539_10108740 3300009094 Bacteria 3254
78 Ga0105245_10084910 3300009098 Bacteria 2901
79 Ga0105245_10185673 3300009098 Bacteria 1989
80 Ga0114129_10000511 3300009147 Bacteria 47494
81 Ga0114129_10001265 3300009147 Bacteria 33730
82 Ga0114129_10007956 3300009147 Bacteria 15090
83 Ga0114129_10015307 3300009147 Bacteria 10914
84 Ga0114129_10020526 3300009147 Bacteria 9396
85 Ga0114129_10538088 3300009147 Bacteria 1521
86 Ga0114129_10931703 3300009147 Bacteria 1099
87 Ga0105243_11007491 3300009148 Unclassified 836
88 Ga0105242_10004545 3300009176 Bacteria 10765
89 Ga0105242_10055641 3300009176 Bacteria 3236
90 Ga0105242_10760507 3300009176 Bacteria 955
91 Ga0105248_10047524 3300009177 Bacteria 4813
92 Ga0105248_10047623 3300009177 Bacteria 4808
93 Ga0105248_10210072 3300009177 Unclassified 2193
94 Ga0105248_10238691 3300009177 Unclassified 2046
95 Ga0105248_10848284 3300009177 Unclassified 1031
96 Ga0105249_10358510 3300009553 Bacteria 1479
97 Ga0157378_10055575 3300013297 Bacteria 3527
98 Ga0157380_10279681 3300014326 Bacteria 1526
99 Ga0157376_10201857 3300014969 Unclassified 1830
100 Ga0157376_10639675 3300014969 Bacteria 1063
101 Ga0207692_10044164 3300025898 Bacteria 2222
102 Ga0207699_10016987 3300025906 Bacteria 3818
103 Ga0207645_10033404 3300025907 Bacteria 3307
104 Ga0207645_10041124 3300025907 Bacteria 2960
105 Ga0207662_10439909 3300025918 Bacteria 890
106 Ga0207646_10112791 3300025922 Bacteria 2440
107 Ga0207681_10000007 3300025923 Bacteria 483669
108 Ga0207659_10487212 3300025926 Bacteria 1042
109 Ga0207687_10024337 3300025927 Bacteria 4045
110 Ga0207664_10010678 3300025929 Bacteria 6494
111 Ga0207690_10486825 3300025932 Unclassified 996
112 Ga0207706_10240254 3300025933 Bacteria 1583
113 Ga0207686_10031648 3300025934 Bacteria 3143
114 Ga0207686_10064102 3300025934 Bacteria 2339
115 Ga0207686_10075891 3300025934 Bacteria 2177
116 Ga0207704_10228963 3300025938 Bacteria 1381
117 Ga0207704_10289743 3300025938 Bacteria 1249
118 Ga0207691_10098590 3300025940 Bacteria 2610
119 Ga0207711_10016331 3300025941 Bacteria 6168
120 Ga0207711_10136055 3300025941 Unclassified 2207
121 Ga0207661_10302301 3300025944 Bacteria 1435
122 Ga0207651_10053262 3300025960 Bacteria 2765
123 Ga0207668_10719793 3300025972 Unclassified 878
124 Ga0207640_10014165 3300025981 Bacteria 4584
125 Ga0207658_10326274 3300025986 Bacteria 1330
126 Ga0207658_10672950 3300025986 Bacteria 934
127 Ga0207676_10183183 3300026095 Bacteria 1836
128 Ga0207674_10559578 3300026116 Bacteria 1105
129 Ga0207683_10004352 3300026121 Bacteria 12233
130 Ga0207683_10020641 3300026121 Bacteria 5638
131 Ga0209983_1009361 3300027665 Bacteria 2003
132 Ga0209971_1000356 3300027682 Bacteria 12562
133 Ga0209974_10044675 3300027876 Bacteria 1478
134 Ga0207428_10013789 3300027907 Bacteria 7043
135 Ga0207428_10065249 3300027907 Bacteria 2873
136 Ga0207428_10074374 3300027907 Bacteria 2664
137 Ga0268265_10089478 3300028380 Bacteria 2456
138 Ga0268264_10216833 3300028381 Bacteria 1760
139 Ga0268264_10257709 3300028381 Unclassified 1623
140 Ga0265323_10006536 3300028653 Bacteria 4898
141 Ga0265332_10079425 3300031238 Bacteria 1392
142 Ga0265314_10079486 3300031711 Unclassified 2168
143 Ga0265342_10140692 3300031712 Bacteria 1346
144 Ga0307405_10043217 3300031731 Bacteria 2748
145 Ga0307413_10173816 3300031824 Bacteria 1528
146 Ga0307416_100949146 3300032002 Bacteria 962
147 Ga0373930_0002090 3300034816 Bacteria 3057
148 Ga0373934_0094916 3300035086 Bacteria 1204
149 Ga0373940_0000991 3300035088 Bacteria 4847
150 Ga0373949_0005473 3300035090 Unclassified 2831
151 Ga0373951_0001033 3300035091 Bacteria 7492
152 Ga0373923_0066091 3300035111 Bacteria 1545
153 Ga0373932_0000671 3300035112 Bacteria 10379
154 Ga0373939_0001445 3300035114 Bacteria 5752
155 Ga0373945_0042670 3300035116 Bacteria 1644
156 Ga0373953_0026022 3300035117 Unclassified 2240
157 Ga0373953_0058020 3300035117 Bacteria 1577
158 Ga0373954_0019828 3300035118 Bacteria 3036
159 Ga0373956_0003798 3300035119 Bacteria 6072
160 Ga0373957_0007492 3300035120 Bacteria 3492
161 Ga0373946_0003691 3300035171 Bacteria 5424
162 Ga0373955_0023573 3300035172 Bacteria 3137
163 Ga0373962_0002770 3300035242 Bacteria 4182
164 Ga0373924_0003001 3300035410 Bacteria 5743
165 Ga0373931_0000904 3300035691 Bacteria 12543
166 Ga0373935_0020403 3300035692 Bacteria 4050
167 Ga0373933_0008476 3300035724 Bacteria 5608
168 Ga0373933_0231939 3300035724 Bacteria 1186
169 Ga0373937_0000136 3300036401 Bacteria 71049
170 Ga0373937_0100526 3300036401 Bacteria 2684
171 Ga0373937_0216937 3300036401 Unclassified 1801
172 Ga0436365_0465032 3300039437 Bacteria 1660
173 Ga0453684_0000027 3300044712 Bacteria 778857
174 Ga0453684_0001338 3300044712 Bacteria 72311
175 Ga0451576_0017555 3300045051 Bacteria 7864
176 Ga0495592_0037332 3300046454 Bacteria 3658
177 Ga0495592_0048375 3300046454 Unclassified 3164
178 Ga0495580_0000111 3300046472 Bacteria 55138
179 Ga0495582_0070637 3300046473 Bacteria 1932
180 Ga0495664_0134979 3300046477 Unclassified 1495
181 Ga0495608_0041398 3300046511 Unclassified 3083
182 Ga0495628_0028884 3300046516 Bacteria 4502
183 Ga0495628_0193894 3300046516 Bacteria 1533
184 Ga0495630_0368139 3300046517 Unclassified 1100
185 Ga0495645_0049632 3300046543 Unclassified 3056
186 Ga0495599_0072073 3300046678 Unclassified 2156
187 Ga0495623_0038690 3300046679 Unclassified 3050
188 Ga0495658_0113825 3300046683 Unclassified 1629
189 Ga0495669_0002285 3300046684 Bacteria 7863
190 Ga0495613_0000736 3300046689 Bacteria 25671
191 Ga0495613_0151685 3300046689 Unclassified 1652
192 Ga0495600_0068401 3300046809 Unclassified 2321
193 Ga0495604_0010089 3300047317 Bacteria 7480
194 Ga0495674_0012126 3300047319 Bacteria 8124
195 Ga0495674_0014964 3300047319 Bacteria 7261
196 Ga0495684_0000105 3300047471 Bacteria 59779
197 Ga0495602_0064699 3300048088 Bacteria 3160
198 Ga0496105_0090257 3300048908 Bacteria 2531
199 Ga0496114_0000007 3300048917 Bacteria 463098
200 Ga0501031_0013541 3300049568 Bacteria 5314
201 Ga0501032_0029923 3300049569 Bacteria 3734
202 Ga0501032_0054057 3300049569 Bacteria 2703
203 Ga0501033_0002088 3300049570 Bacteria 17315
204 Ga0501033_0035457 3300049570 Bacteria 3740
205 Ga0501033_0048177 3300049570 Bacteria 3165
206 Ga0501033_0081602 3300049570 Bacteria 2372
207 Ga0501034_0290651 3300049571 Bacteria 1572
208 Ga0501034_0308537 3300049571 Bacteria 1517
209 Ga0501034_0476573 3300049571 Bacteria 1163
210 Ga0501036_0001614 3300049572 Bacteria 17443
211 Ga0501036_0003269 3300049572 Bacteria 12927
212 Ga0501036_0048886 3300049572 Bacteria 3581
213 Ga0501036_0082778 3300049572 Bacteria 2712
214 Ga0501036_0716967 3300049572 Bacteria 826
215 Ga0501037_0064447 3300049573 Bacteria 2670
216 Ga0501038_0025122 3300049574 Bacteria 5311
217 Ga0501038_0044365 3300049574 Bacteria 3863
218 Ga0501038_0116360 3300049574 Bacteria 2209
219 Ga0501039_0035129 3300049575 Bacteria 3868
220 Ga0501039_0073885 3300049575 Bacteria 2649
221 Ga0501040_0006885 3300049576 Bacteria 7362
222 Ga0501040_0011117 3300049576 Bacteria 5884
223 Ga0501040_0347599 3300049576 Bacteria 1062
224 Ga0501041_0001835 3300049577 Bacteria 11904
225 Ga0501042_0011400 3300049578 Bacteria 5998
226 Ga0501042_0070884 3300049578 Bacteria 2493
227 Ga0501042_0213059 3300049578 Bacteria 1393
228 Ga0501043_0015619 3300049579 Bacteria 5952
229 Ga0501043_0023406 3300049579 Bacteria 4845
230 Ga0501046_0008901 3300049580 Bacteria 8713
231 Ga0501046_0024591 3300049580 Bacteria 4939
232 Ga0501046_0027288 3300049580 Bacteria 4660
233 Ga0501046_0050651 3300049580 Bacteria 3279
234 Ga0501047_0028971 3300049581 Bacteria 5340
235 Ga0501047_0133611 3300049581 Bacteria 2361
236 Ga0501047_0171433 3300049581 Bacteria 2038
237 Ga0501048_0011836 3300049582 Bacteria 6503
238 Ga0501048_0013860 3300049582 Bacteria 5979
239 Ga0501048_0061597 3300049582 Bacteria 2657
240 Ga0501048_0083012 3300049582 Bacteria 2259
241 Ga0501067_0006034 3300049583 Bacteria 6716
242 Ga0501068_0003213 3300049584 Bacteria 8753
243 Ga0501068_0038170 3300049584 Unclassified 2877
244 Ga0501068_0069821 3300049584 Bacteria 2142
245 Ga0501069_0040979 3300049585 Bacteria 2558
246 Ga0501069_0115277 3300049585 Bacteria 1532
247 Ga0501070_0005435 3300049586 Bacteria 10875
248 Ga0501070_0049580 3300049586 Bacteria 3486
249 Ga0501070_0104620 3300049586 Bacteria 2340
250 Ga0501071_0003322 3300049587 Bacteria 10045
251 Ga0501071_0009428 3300049587 Bacteria 6500
252 Ga0501071_0015493 3300049587 Bacteria 5235
253 Ga0501071_0454615 3300049587 Bacteria 980
254 Ga0501071_0777989 3300049587 Bacteria 738
255 Ga0501072_0006288 3300049588 Bacteria 9040
256 Ga0501072_0091957 3300049588 Bacteria 2409
257 Ga0501072_0292439 3300049588 Bacteria 1295
258 Ga0501072_0492733 3300049588 Bacteria 969
259 Ga0501073_0002055 3300049589 Bacteria 15038
260 Ga0501073_0009868 3300049589 Bacteria 7025
261 Ga0501074_0001487 3300049590 Bacteria 15771
262 Ga0501074_0004924 3300049590 Bacteria 9571
263 Ga0501074_0077023 3300049590 Bacteria 2393
264 Ga0501074_0256254 3300049590 Bacteria 1244
265 Ga0501075_0014017 3300049591 Bacteria 5738
266 Ga0501075_0097326 3300049591 Bacteria 2233
267 Ga0501076_0001443 3300049592 Bacteria 15979
268 Ga0501076_0004506 3300049592 Bacteria 9923
269 Ga0501076_0031696 3300049592 Bacteria 4125
270 Ga0501076_0150822 3300049592 Bacteria 1891
271 Ga0501077_0021030 3300049593 Bacteria 4127
272 Ga0501079_0000438 3300049741 Bacteria 27016
273 Ga0501079_0010558 3300049741 Bacteria 7023
274 Ga0501079_0013109 3300049741 Bacteria 6321
275 Ga0501079_0014204 3300049741 Bacteria 6072
276 Ga0501079_0085336 3300049741 Bacteria 2443
277 Ga0501080_0012963 3300049742 Bacteria 7653
278 Ga0501080_0104064 3300049742 Bacteria 2632
279 Ga0501080_0140418 3300049742 Bacteria 2233
280 Ga0501080_0214176 3300049742 Bacteria 1765
281 Ga0501080_0421863 3300049742 Unclassified 1198
282 Ga0501081_0001694 3300049743 Bacteria 13661
283 Ga0501081_0010432 3300049743 Bacteria 6059
284 Ga0501081_0178080 3300049743 Bacteria 1537
285 Ga0501083_0006681 3300049744 Bacteria 8182
286 Ga0501083_0014756 3300049744 Bacteria 5464
287 Ga0501083_0073699 3300049744 Bacteria 2269
288 Ga0501083_0140425 3300049744 Bacteria 1582
289 Ga0501035_0003221 3300049822 Bacteria 15638
290 Ga0501035_0025342 3300049822 Bacteria 5437
291 Ga0501035_0095061 3300049822 Bacteria 2620
292 Ga0501035_0126226 3300049822 Bacteria 2233
293 Ga0501044_0006987 3300049823 Bacteria 12417
294 Ga0501044_0043577 3300049823 Bacteria 4660
295 Ga0501045_0012340 3300049824 Bacteria 6017
296 Ga0501045_0013344 3300049824 Bacteria 5801
297 Ga0501045_0044281 3300049824 Bacteria 3241
298 Ga0501045_0068093 3300049824 Bacteria 2615
299 Ga0501045_0140358 3300049824 Bacteria 1797
300 nmdc:mga0yw44_559840_c1 3300050492 Unclassified 776
301 nmdc:mga0k408_102963_c1 3300050493 Bacteria 1684
302 nmdc:mga0k408_7892_c1 3300050493 Bacteria 5699
303 nmdc:mga06z11_307526_c1 3300050494 Bacteria 943
304 nmdc:mga07m45_73416_c1 3300050496 Bacteria 1947
305 nmdc:mga05p37_11227_c1 3300050507 Bacteria 10650
306 nmdc:mga05p37_11_c1 3300050507 Bacteria 149577
307 nmdc:mga05p37_209780_c1 3300050507 Bacteria 2355
308 nmdc:mga05p37_238150_c1 3300050507 Bacteria 2190
309 nmdc:mga05p37_31258_c1 3300050507 Bacteria 6504
310 nmdc:mga05p37_58309_c1 3300050507 Unclassified 3425
311 nmdc:mga05p37_921902_c1 3300050507 Bacteria 939
312 nmdc:mga06r32_197465_c1 3300050510 Unclassified 1999
313 nmdc:mga08y16_131105_c1 3300050511 Bacteria 2607
314 nmdc:mga08y16_6012_c1 3300050511 Bacteria 12720
315 nmdc:mga0n895_199104_c1 3300050512 Bacteria 2034
316 nmdc:mga0n895_22263_c1 3300050512 Bacteria 5942
317 nmdc:mga0n895_456448_c1 3300050512 Bacteria 1290
318 nmdc:mga0n895_6732_c1 3300050512 Bacteria 9801
319 nmdc:mga0rr50_43658_c1 3300050513 Unclassified 3283
320 nmdc:mga0rr50_9121_c1 3300050513 Bacteria 6213
321 nmdc:mga08x19_108033_c1 3300050514 Bacteria 1853
322 nmdc:mga08x19_1263_c1 3300050514 Bacteria 15698
323 nmdc:mga0a205_53298_c1 3300050515 Bacteria 3612
324 nmdc:mga0a205_77482_c1 3300050515 Bacteria 3212
325 Ga0495601_0001839 3300053077 Bacteria 11790
326 Ga0495595_0056431 3300053084 Unclassified 1830
327 Ga0495595_0076282 3300053084 Unclassified 1591
328 Ga0495619_0003208 3300053085 Bacteria 10584
329 Ga0500568_0005122 3300053139 Bacteria 6843
330 Ga0501084_0000668 3300054114 Bacteria 26166
331 Ga0501084_0004244 3300054114 Bacteria 11671
332 Ga0501084_0034037 3300054114 Bacteria 4261
333 Ga0501084_0371419 3300054114 Bacteria 1209
334 Ga0590071_000978 3300059421 Bacteria 7836
335 Ga0590077_040210 3300059426 Bacteria 1037
336 Ga0501082_0000338 3300060353 Bacteria 41312
337 Ga0501082_0002168 3300060353 Bacteria 17204
338 Ga0501082_0011007 3300060353 Bacteria 7778
339 Ga0501082_0037536 3300060353 Bacteria 4176
340 Ga0501082_0064501 3300060353 Bacteria 3154
341 Ga0501082_0265939 3300060353 Bacteria 1492
342 Ga0530510_0005208 3300061734 Bacteria 8973
343 Ga0070707_100068200
344 Ga0065707_10157119
345 Ga0070676_10151950
346 Ga0070670_100301870
347 Ga0070689_100104098
348 Ga0070675_100687069
349 Ga0070673_100057420
350 Ga0070667_100126847
351 Ga0070667_100177570
352 Ga0070667_100275060
353 Ga0070714_100049928
354 Ga0070710_10026504
355 Ga0070694_100516155
356 Ga0070678_100028903
357 Ga0070678_100042009
358 Ga0068867_100122204
359 Ga0070706_100043903
360 Ga0070698_100207352
361 Ga0070672_100259391
362 Ga0070686_100447975
363 Ga0070686_100693802
364 Ga0070693_100172891
365 Ga0070665_100556953
366 Ga0068854_100065381
367 Ga0068859_100060786
368 Ga0068859_100088572
369 Ga0068859_100356311
370 Ga0068859_100483249
371 Ga0068860_100245519
372 Ga0068860_100266215
373 Ga0068862_100180170
374 Ga0081455_10041554
375 Ga0081539_10003386
376 Ga0075368_10027801
377 Ga0075368_10098750
378 Ga0075363_100170857
379 Ga0075364_10158361
380 Ga0075367_10024619
381 Ga0075367_10112012
382 Ga0075367_10272980
383 Ga0075366_10039426
384 Ga0075366_10039595
385 Ga0075366_10055928
386 Ga0097621_100029563
387 Ga0097621_100086316
388 Ga0097621_100088704
389 Ga0068871_100007844
390 Ga0068871_100117852
391 Ga0068871_100119043
392 Ga0075428_100039496
393 Ga0075428_100046809
394 Ga0075433_10032730
395 Ga0075433_10050988
396 Ga0075433_10071776
397 Ga0075433_10170649
398 Ga0075433_10251804
399 Ga0075434_100000589
400 Ga0075434_100007544
401 Ga0075429_100414091
402 Ga0068865_100038449
403 Ga0068865_100229269
404 Ga0075436_100000036
405 Ga0075436_100001233
406 Ga0075436_100038004
407 Ga0075436_100232152
408 Ga0097620_100060785
409 Ga0097620_100088572
410 Ga0097620_100356322
411 Ga0097620_100483216
412 Ga0097620_100547929
413 Ga0075435_100000014
414 Ga0075435_100183286
415 Ga0075435_100337147
416 Ga0105240_10297272
417 Ga0111539_10003531
418 Ga0111539_10067628
419 Ga0111539_10108740
420 Ga0105245_10084910
421 Ga0105245_10185673
422 Ga0114129_10000511
423 Ga0114129_10001265
424 Ga0114129_10007956
425 Ga0114129_10015307
426 Ga0114129_10020526
427 Ga0114129_10538088
428 Ga0114129_10931703
429 Ga0105243_11007491
430 Ga0105242_10004545
431 Ga0105242_10055641
432 Ga0105242_10760507
433 Ga0105248_10047524
434 Ga0105248_10047623
435 Ga0105248_10210072
436 Ga0105248_10238691
437 Ga0105248_10848284
438 Ga0105249_10358510
439 Ga0157378_10055575
440 Ga0157380_10279681
441 Ga0157376_10201857
442 Ga0157376_10639675
443 Ga0207692_10044164
444 Ga0207699_10016987
445 Ga0207645_10033404
446 Ga0207645_10041124
447 Ga0207662_10439909
448 Ga0207646_10112791
449 Ga0207681_10000007
450 Ga0207659_10487212
451 Ga0207687_10024337
452 Ga0207664_10010678
453 Ga0207690_10486825
454 Ga0207706_10240254
455 Ga0207686_10031648
456 Ga0207686_10064102
457 Ga0207686_10075891
458 Ga0207704_10228963
459 Ga0207704_10289743
460 Ga0207691_10098590
461 Ga0207711_10016331
462 Ga0207711_10136055
463 Ga0207661_10302301
464 Ga0207651_10053262
465 Ga0207668_10719793
466 Ga0207640_10014165
467 Ga0207658_10326274
468 Ga0207658_10672950
469 Ga0207676_10183183
470 Ga0207674_10559578
471 Ga0207683_10004352
472 Ga0207683_10020641
473 Ga0209983_1009361
474 Ga0209971_1000356
475 Ga0209974_10044675
476 Ga0207428_10013789
477 Ga0207428_10065249
478 Ga0207428_10074374
479 Ga0268265_10089478
480 Ga0268264_10216833
481 Ga0268264_10257709
482 Ga0265323_10006536
483 Ga0265332_10079425
484 Ga0265314_10079486
485 Ga0265342_10140692
486 Ga0307405_10043217
487 Ga0307413_10173816
488 Ga0307416_100949146
489 Ga0373930_0002090
490 Ga0373934_0094916
491 Ga0373940_0000991
492 Ga0373949_0005473
493 Ga0373951_0001033
494 Ga0373923_0066091
495 Ga0373932_0000671
496 Ga0373939_0001445
497 Ga0373945_0042670
498 Ga0373953_0026022
499 Ga0373953_0058020
500 Ga0373954_0019828
501 Ga0373956_0003798
502 Ga0373957_0007492
503 Ga0373946_0003691
504 Ga0373955_0023573
505 Ga0373962_0002770
506 Ga0373924_0003001
507 Ga0373931_0000904
508 Ga0373935_0020403
509 Ga0373933_0008476
510 Ga0373933_0231939
511 Ga0373937_0000136
512 Ga0373937_0100526
513 Ga0373937_0216937
514 Ga0436365_0465032
515 Ga0453684_0000027
516 Ga0453684_0001338
517 Ga0451576_0017555
518 Ga0495592_0037332
519 Ga0495592_0048375
520 Ga0495580_0000111
521 Ga0495582_0070637
522 Ga0495664_0134979
523 Ga0495608_0041398
524 Ga0495628_0028884
525 Ga0495628_0193894
526 Ga0495630_0368139
527 Ga0495645_0049632
528 Ga0495599_0072073
529 Ga0495623_0038690
530 Ga0495658_0113825
531 Ga0495669_0002285
532 Ga0495613_0000736
533 Ga0495613_0151685
534 Ga0495600_0068401
535 Ga0495604_0010089
536 Ga0495674_0012126
537 Ga0495674_0014964
538 Ga0495684_0000105
539 Ga0495602_0064699
540 Ga0496105_0090257
541 Ga0496114_0000007
542 Ga0501031_0013541
543 Ga0501032_0029923
544 Ga0501032_0054057
545 Ga0501033_0002088
546 Ga0501033_0035457
547 Ga0501033_0048177
548 Ga0501033_0081602
549 Ga0501034_0290651
550 Ga0501034_0308537
551 Ga0501034_0476573
552 Ga0501036_0001614
553 Ga0501036_0003269
554 Ga0501036_0048886
555 Ga0501036_0082778
556 Ga0501036_0716967
557 Ga0501037_0064447
558 Ga0501038_0025122
559 Ga0501038_0044365
560 Ga0501038_0116360
561 Ga0501039_0035129
562 Ga0501039_0073885
563 Ga0501040_0006885
564 Ga0501040_0011117
565 Ga0501040_0347599
566 Ga0501041_0001835
567 Ga0501042_0011400
568 Ga0501042_0070884
569 Ga0501042_0213059
570 Ga0501043_0015619
571 Ga0501043_0023406
572 Ga0501046_0008901
573 Ga0501046_0024591
574 Ga0501046_0027288
575 Ga0501046_0050651
576 Ga0501047_0028971
577 Ga0501047_0133611
578 Ga0501047_0171433
579 Ga0501048_0011836
580 Ga0501048_0013860
581 Ga0501048_0061597
582 Ga0501048_0083012
583 Ga0501067_0006034
584 Ga0501068_0003213
585 Ga0501068_0038170
586 Ga0501068_0069821
587 Ga0501069_0040979
588 Ga0501069_0115277
589 Ga0501070_0005435
590 Ga0501070_0049580
591 Ga0501070_0104620
592 Ga0501071_0003322
593 Ga0501071_0009428
594 Ga0501071_0015493
595 Ga0501071_0454615
596 Ga0501071_0777989
597 Ga0501072_0006288
598 Ga0501072_0091957
599 Ga0501072_0292439
600 Ga0501072_0492733
601 Ga0501073_0002055
602 Ga0501073_0009868
603 Ga0501074_0001487
604 Ga0501074_0004924
605 Ga0501074_0077023
606 Ga0501074_0256254
607 Ga0501075_0014017
608 Ga0501075_0097326
609 Ga0501076_0001443
610 Ga0501076_0004506
611 Ga0501076_0031696
612 Ga0501076_0150822
613 Ga0501077_0021030
614 Ga0501079_0000438
615 Ga0501079_0010558
616 Ga0501079_0013109
617 Ga0501079_0014204
618 Ga0501079_0085336
619 Ga0501080_0012963
620 Ga0501080_0104064
621 Ga0501080_0140418
622 Ga0501080_0214176
623 Ga0501080_0421863
624 Ga0501081_0001694
625 Ga0501081_0010432
626 Ga0501081_0178080
627 Ga0501083_0006681
628 Ga0501083_0014756
629 Ga0501083_0073699
630 Ga0501083_0140425
631 Ga0501035_0003221
632 Ga0501035_0025342
633 Ga0501035_0095061
634 Ga0501035_0126226
635 Ga0501044_0006987
636 Ga0501044_0043577
637 Ga0501045_0012340
638 Ga0501045_0013344
639 Ga0501045_0044281
640 Ga0501045_0068093
641 Ga0501045_0140358
642 nmdc:mga0yw44_559840_c1
643 nmdc:mga0k408_102963_c1
644 nmdc:mga0k408_7892_c1
645 nmdc:mga06z11_307526_c1
646 nmdc:mga07m45_73416_c1
647 nmdc:mga05p37_11227_c1
648 nmdc:mga05p37_11_c1
649 nmdc:mga05p37_209780_c1
650 nmdc:mga05p37_238150_c1
651 nmdc:mga05p37_31258_c1
652 nmdc:mga05p37_58309_c1
653 nmdc:mga05p37_921902_c1
654 nmdc:mga06r32_197465_c1
655 nmdc:mga08y16_131105_c1
656 nmdc:mga08y16_6012_c1
657 nmdc:mga0n895_199104_c1
658 nmdc:mga0n895_22263_c1
659 nmdc:mga0n895_456448_c1
660 nmdc:mga0n895_6732_c1
661 nmdc:mga0rr50_43658_c1
662 nmdc:mga0rr50_9121_c1
663 nmdc:mga08x19_108033_c1
664 nmdc:mga08x19_1263_c1
665 nmdc:mga0a205_53298_c1
666 nmdc:mga0a205_77482_c1
667 Ga0495601_0001839
668 Ga0495595_0056431
669 Ga0495595_0076282
670 Ga0495619_0003208
671 Ga0500568_0005122
672 Ga0501084_0000668
673 Ga0501084_0004244
674 Ga0501084_0034037
675 Ga0501084_0371419
676 Ga0590071_000978
677 Ga0590077_040210
678 Ga0501082_0000338
679 Ga0501082_0002168
680 Ga0501082_0011007
681 Ga0501082_0037536
682 Ga0501082_0064501
683 Ga0501082_0265939
684 Ga0530510_0005208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

32

75

0.9

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

91

223

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b2l-assembly1.cif.gz_b1 cryo-em structure of the plant 80s ribosome 0.9509 5 45
8ove-assembly1.cif.gz_A6 cryo-em structure of trypanosoma brucei procyclic form 80s ribosome : tb11cs6h1 snorna mutant 0.9473 5 45
8btk-assembly1.cif.gz_Ai structure of the trap complex with the sec translocon and a translating ribosome 0.945 5 45
7pzy-assembly1.cif.gz_K structure of the vacant candida albicans 80s ribosome 0.9435 5 45
7oyc-assembly1.cif.gz_J2 cryo-em structure of the xenopus egg 80s ribosome 0.9407 5 45
ID Description Score Start End Superfamily
af_A0A144A2N8_107_181_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9705 6 45 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9683 6 45 3.10.290.10
af_P9WHQ1_10_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9616 6 59 3.10.290.10
af_Q2FXH7_1_58_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9571 6 60 3.10.290.10
af_Q9LXG1_108_164_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9565 5 45 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A645GEC8-F1-model_v4 Ribosomal small subunit pseudouridine synthase A (EC 5.4.99.19) 0.9175 69 230 GO:0001522
GO:0003723
GO:0160136
AF-A0A660MPT5-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9085 66 224 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A353DG61-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.908 66 230 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A1V6CBE8-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.903 49 228 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098
AF-A0A847JMG3-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.899 49 230 GO:0001522
GO:0003723
GO:0006364
GO:0009982
GO:0140098

Map