F414878

General Info

Members Datasets Scaffolds Average Seq Length
341 211 341 128

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0242413|Ga0495670_0242413_48_506
Length 152
Sequence MHQRQVRRLKPAPLRFGTVGEVSDWTIISLLEVDDSAAGRLDGLEVRMSRKQMESRDVGVSLFRYGPNVRNPMSHQHREQEEAYVIVSGFGRVRLDDEIKEVRQWDVIRVAPEVLRAFEAGPEGMDVVAVGGPKPEGGDGALSDSPWPDAAN

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
149 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
152 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 9.97
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10457917 3300005327 Bacteria 1100
2 Ga0070683_100025203 3300005329 Bacteria 5338
3 Ga0070683_100039239 3300005329 Bacteria 4346
4 Ga0070683_100331596 3300005329 Bacteria 1448
5 Ga0070683_100531662 3300005329 Unclassified 1124
6 Ga0070683_101276224 3300005329 Bacteria 706
7 Ga0070683_102342179 3300005329 Bacteria 512
8 Ga0070670_100831432 3300005331 Bacteria 835
9 Ga0068869_100048830 3300005334 Bacteria 3062
10 Ga0070680_100199063 3300005336 Bacteria 1689
11 Ga0070682_100011987 3300005337 Bacteria 4959
12 Ga0070682_101262250 3300005337 Bacteria 626
13 Ga0070682_102057987 3300005337 Archaea 503
14 Ga0068868_100022174 3300005338 Bacteria 4790
15 Ga0068868_100994455 3300005338 Unclassified 767
16 Ga0070689_100106371 3300005340 Bacteria 2226
17 Ga0070691_10006421 3300005341 Bacteria 5375
18 Ga0070661_100033001 3300005344 Bacteria 3750
19 Ga0070661_100454944 3300005344 Bacteria 1019
20 Ga0070661_101455126 3300005344 Bacteria 577
21 Ga0070668_100509622 3300005347 Bacteria 1043
22 Ga0070668_100835138 3300005347 Bacteria 820
23 Ga0070675_100310785 3300005354 Bacteria 1390
24 Ga0070675_100652995 3300005354 Bacteria 956
25 Ga0070674_100382868 3300005356 Bacteria 1145
26 Ga0070673_100946738 3300005364 Bacteria 800
27 Ga0070659_100758042 3300005366 Bacteria 842
28 Ga0070659_100820445 3300005366 Unclassified 810
29 Ga0070659_101470351 3300005366 Bacteria 607
30 Ga0070710_10105801 3300005437 Bacteria 1683
31 Ga0070710_10246504 3300005437 Unclassified 1147
32 Ga0070711_100140359 3300005439 Bacteria 1811
33 Ga0070700_100003875 3300005441 Bacteria 7767
34 Ga0070663_100247207 3300005455 Unclassified 1410
35 Ga0070678_100110722 3300005456 Bacteria 2148
36 Ga0070678_100205085 3300005456 Unclassified 1630
37 Ga0070678_100857511 3300005456 Unclassified 828
38 Ga0070678_100920435 3300005456 Bacteria 800
39 Ga0070662_100967787 3300005457 Unclassified 728
40 Ga0070662_101359017 3300005457 Bacteria 612
41 Ga0070662_101580209 3300005457 Unclassified 566
42 Ga0070681_11526210 3300005458 Bacteria 593
43 Ga0068867_102021759 3300005459 Bacteria 545
44 Ga0070679_100057466 3300005530 Bacteria 3878
45 Ga0070684_100007099 3300005535 Bacteria 8704
46 Ga0070684_100358110 3300005535 Bacteria 1343
47 Ga0070672_101309790 3300005543 Bacteria 647
48 Ga0070672_101875887 3300005543 Unclassified 539
49 Ga0070686_101693417 3300005544 Bacteria 536
50 Ga0070704_100073831 3300005549 Bacteria 2486
51 Ga0068855_100759008 3300005563 Bacteria 1034
52 Ga0070664_100495549 3300005564 Bacteria 1126
53 Ga0070664_100981079 3300005564 Bacteria 794
54 Ga0068857_100043193 3300005577 Bacteria 3998
55 Ga0068857_100892801 3300005577 Bacteria 852
56 Ga0068854_100879577 3300005578 Bacteria 786
57 Ga0068854_100921510 3300005578 Bacteria 769
58 Ga0068856_100055563 3300005614 Bacteria 3907
59 Ga0068856_100951085 3300005614 Bacteria 878
60 Ga0070702_100086326 3300005615 Bacteria 1892
61 Ga0068852_100021358 3300005616 Bacteria 5168
62 Ga0068852_101155151 3300005616 Unclassified 795
63 Ga0068859_100319446 3300005617 Bacteria 1647
64 Ga0068864_100285692 3300005618 Bacteria 1541
65 Ga0068861_101105020 3300005719 Bacteria 762
66 Ga0068851_10742487 3300005834 Unclassified 607
67 Ga0068870_10998967 3300005840 Bacteria 597
68 Ga0068870_11203274 3300005840 Bacteria 549
69 Ga0068863_100383907 3300005841 Bacteria 1372
70 Ga0068858_101068040 3300005842 Bacteria 792
71 Ga0068860_100879202 3300005843 Bacteria 912
72 Ga0068862_100031415 3300005844 Bacteria 4482
73 Ga0081455_10354559 3300005937 Bacteria 1034
74 Ga0081538_10000701 3300005981 Bacteria 36744
75 Ga0075365_10376880 3300006038 Bacteria 1001
76 Ga0075363_100336562 3300006048 Bacteria 880
77 Ga0075364_10590570 3300006051 Bacteria 759
78 Ga0075364_10749709 3300006051 Unclassified 666
79 Ga0070712_100012095 3300006175 Bacteria 5484
80 Ga0070712_101446843 3300006175 Bacteria 600
81 Ga0097621_100120463 3300006237 Bacteria 2225
82 Ga0075428_100247724 3300006844 Bacteria 1921
83 Ga0075428_100955082 3300006844 Bacteria 908
84 Ga0075430_100038533 3300006846 Bacteria 4048
85 Ga0075430_100141613 3300006846 Bacteria 2003
86 Ga0075433_11374058 3300006852 Bacteria 611
87 Ga0075434_100583539 3300006871 Bacteria 1137
88 Ga0075434_100699663 3300006871 Bacteria 1031
89 Ga0075434_101074606 3300006871 Bacteria 818
90 Ga0075429_100574493 3300006880 Bacteria 988
91 Ga0068865_100740844 3300006881 Bacteria 843
92 Ga0097620_100319415 3300006931 Bacteria 1647
93 Ga0105240_10550445 3300009093 Bacteria 1277
94 Ga0111539_10028919 3300009094 Bacteria 6758
95 Ga0111539_10131287 3300009094 Bacteria 2933
96 Ga0111539_10470049 3300009094 Bacteria 1464
97 Ga0111539_10745032 3300009094 Unclassified 1140
98 Ga0111539_10788491 3300009094 Bacteria 1106
99 Ga0111539_11111438 3300009094 Bacteria 918
100 Ga0111539_11465442 3300009094 Bacteria 792
101 Ga0105245_10401099 3300009098 Bacteria 1370
102 Ga0105245_11080829 3300009098 Bacteria 848
103 Ga0105245_11738459 3300009098 Bacteria 676
104 Ga0105245_12808404 3300009098 Bacteria 540
105 Ga0105247_10308561 3300009101 Unclassified 1100
106 Ga0114129_10054564 3300009147 Bacteria 5603
107 Ga0114129_11060773 3300009147 Bacteria 1017
108 Ga0114129_11922588 3300009147 Bacteria 717
109 Ga0105243_11175985 3300009148 Bacteria 779
110 Ga0105243_11474263 3300009148 Bacteria 703
111 Ga0105243_12755961 3300009148 Bacteria 532
112 Ga0105241_11956436 3300009174 Unclassified 576
113 Ga0105242_10291777 3300009176 Bacteria 1485
114 Ga0105242_11097320 3300009176 Bacteria 809
115 Ga0105242_11125951 3300009176 Bacteria 800
116 Ga0105242_11631085 3300009176 Bacteria 679
117 Ga0105242_12196948 3300009176 Bacteria 597
118 Ga0105248_11036634 3300009177 Bacteria 927
119 Ga0105248_13283497 3300009177 Bacteria 514
120 Ga0105237_10320247 3300009545 Bacteria 1554
121 Ga0105237_11800564 3300009545 Bacteria 620
122 Ga0105249_10848480 3300009553 Bacteria 979
123 Ga0105249_10888532 3300009553 Unclassified 958
124 Ga0105249_10933908 3300009553 Bacteria 935
125 Ga0105239_10052258 3300010375 Bacteria 4480
126 Ga0105239_11472869 3300010375 Bacteria 786
127 Ga0105239_12627982 3300010375 Bacteria 587
128 Ga0105239_13012708 3300010375 Bacteria 549
129 Ga0105246_10009307 3300011119 Bacteria 6049
130 Ga0157369_10233741 3300013105 Bacteria 1921
131 Ga0157374_10067749 3300013296 Unclassified 3357
132 Ga0157372_10023583 3300013307 Bacteria 6673
133 Ga0157372_11659493 3300013307 Bacteria 735
134 Ga0157375_10211663 3300013308 Bacteria 2096
135 Ga0157375_11240142 3300013308 Bacteria 875
136 Ga0163163_10102314 3300014325 Bacteria 2888
137 Ga0163163_11643200 3300014325 Bacteria 703
138 Ga0157380_10208572 3300014326 Bacteria 1739
139 Ga0157380_10259307 3300014326 Bacteria 1578
140 Ga0157380_10283194 3300014326 Unclassified 1518
141 Ga0157380_10496738 3300014326 Bacteria 1184
142 Ga0157380_11880430 3300014326 Bacteria 659
143 Ga0157380_12511481 3300014326 Unclassified 581
144 Ga0157380_13004610 3300014326 Bacteria 537
145 Ga0157377_10324006 3300014745 Bacteria 1025
146 Ga0157379_11151084 3300014968 Bacteria 745
147 Ga0157379_11639523 3300014968 Unclassified 629
148 Ga0157376_10411204 3300014969 Unclassified 1310
149 Ga0206354_11647580 3300020081 Bacteria 1215
150 Ga0213874_10232819 3300021377 Bacteria 673
151 Ga0213875_10289273 3300021388 Bacteria 774
152 Ga0207692_10178791 3300025898 Unclassified 1235
153 Ga0207642_10499532 3300025899 Bacteria 744
154 Ga0207710_10202331 3300025900 Unclassified 981
155 Ga0207643_10395113 3300025908 Bacteria 873
156 Ga0207707_11595494 3300025912 Bacteria 514
157 Ga0207695_11606023 3300025913 Unclassified 531
158 Ga0207671_10946803 3300025914 Bacteria 680
159 Ga0207671_11089188 3300025914 Bacteria 628
160 Ga0207693_10015600 3300025915 Bacteria 6093
161 Ga0207663_10154324 3300025916 Bacteria 1614
162 Ga0207660_10471225 3300025917 Unclassified 1017
163 Ga0207662_10138790 3300025918 Bacteria 1538
164 Ga0207662_10332983 3300025918 Bacteria 1016
165 Ga0207649_10308305 3300025920 Unclassified 1159
166 Ga0207649_11253107 3300025920 Bacteria 586
167 Ga0207652_10609671 3300025921 Bacteria 978
168 Ga0207681_11064738 3300025923 Bacteria 679
169 Ga0207659_10274496 3300025926 Bacteria 1376
170 Ga0207644_10070988 3300025931 Bacteria 2547
171 Ga0207706_10037496 3300025933 Bacteria 4304
172 Ga0207706_10450203 3300025933 Bacteria 1114
173 Ga0207706_10924914 3300025933 Bacteria 736
174 Ga0207686_10990844 3300025934 Bacteria 682
175 Ga0207686_11759669 3300025934 Bacteria 513
176 Ga0207709_10125459 3300025935 Bacteria 1740
177 Ga0207709_11342333 3300025935 Bacteria 591
178 Ga0207709_11845490 3300025935 Bacteria 503
179 Ga0207670_10074463 3300025936 Bacteria 2357
180 Ga0207669_10294401 3300025937 Bacteria 1231
181 Ga0207669_10900587 3300025937 Bacteria 739
182 Ga0207704_10128327 3300025938 Bacteria 1750
183 Ga0207704_11130660 3300025938 Bacteria 666
184 Ga0207704_11271743 3300025938 Bacteria 628
185 Ga0207691_10779382 3300025940 Bacteria 804
186 Ga0207691_10810006 3300025940 Bacteria 787
187 Ga0207689_10057322 3300025942 Bacteria 3205
188 Ga0207689_10336285 3300025942 Bacteria 1254
189 Ga0207661_10104081 3300025944 Bacteria 2390
190 Ga0207661_11006482 3300025944 Bacteria 768
191 Ga0207679_10331319 3300025945 Bacteria 1321
192 Ga0207679_10788085 3300025945 Unclassified 866
193 Ga0207712_11247620 3300025961 Unclassified 664
194 Ga0207668_10304870 3300025972 Bacteria 1316
195 Ga0207668_10749015 3300025972 Bacteria 862
196 Ga0207640_10215257 3300025981 Bacteria 1467
197 Ga0207640_10677972 3300025981 Bacteria 881
198 Ga0207640_10754705 3300025981 Bacteria 839
199 Ga0207640_11355269 3300025981 Bacteria 636
200 Ga0207677_10167238 3300026023 Bacteria 1715
201 Ga0207639_11923984 3300026041 Unclassified 552
202 Ga0207678_10058936 3300026067 Bacteria 3304
203 Ga0207708_10000262 3300026075 Bacteria 41463
204 Ga0207708_10240331 3300026075 Bacteria 1456
205 Ga0207708_10247071 3300026075 Bacteria 1437
206 Ga0207702_10571816 3300026078 Bacteria 1107
207 Ga0207702_10823214 3300026078 Unclassified 918
208 Ga0207648_10323525 3300026089 Unclassified 1386
209 Ga0207674_10060786 3300026116 Bacteria 3820
210 Ga0207675_100049127 3300026118 Bacteria 3938
211 Ga0207675_100145222 3300026118 Bacteria 2255
212 Ga0207683_10061800 3300026121 Bacteria 3297
213 Ga0207683_10198068 3300026121 Bacteria 1825
214 Ga0207683_10575237 3300026121 Bacteria 1042
215 Ga0268266_10479395 3300028379 Bacteria 1186
216 Ga0268265_10335337 3300028380 Bacteria 1375
217 Ga0265338_10149631 3300028800 Bacteria 1815
218 Ga0265320_10025930 3300031240 Unclassified 3075
219 Ga0265316_10655882 3300031344 Unclassified 742
220 Ga0307408_100977674 3300031548 Bacteria 779
221 Ga0307413_10259416 3300031824 Bacteria 1295
222 Ga0307413_10629015 3300031824 Bacteria 882
223 Ga0307413_12154321 3300031824 Bacteria 505
224 Ga0307407_11676704 3300031903 Bacteria 506
225 Ga0307409_100319229 3300031995 Bacteria 1453
226 Ga0307409_100333056 3300031995 Bacteria 1425
227 Ga0307409_100400646 3300031995 Bacteria 1311
228 Ga0307409_100974755 3300031995 Bacteria 865
229 Ga0307416_100148280 3300032002 Bacteria 2147
230 Ga0307416_101566943 3300032002 Bacteria 764
231 Ga0307414_11165555 3300032004 Bacteria 713
232 Ga0307415_101200665 3300032126 Bacteria 715
233 Ga0307415_101425296 3300032126 Bacteria 660
234 Ga0373953_0016327 3300035117 Bacteria 2709
235 Ga0373957_0088784 3300035120 Unclassified 1227
236 Ga0373960_0173918 3300035121 Bacteria 748
237 Ga0373955_0061190 3300035172 Bacteria 2079
238 Ga0373962_0098527 3300035242 Bacteria 909
239 Ga0373933_0072747 3300035724 Bacteria 2094
240 Ga0373947_1056575 3300035725 Bacteria 554
241 Ga0373937_0469562 3300036401 Bacteria 1195
242 Ga0395900_0016182 3300037418 Bacteria 7598
243 Ga0395898_0007451 3300037466 Bacteria 11617
244 Ga0436364_0073896 3300037853 Bacteria 1093
245 Ga0395901_0330084 3300038443 Bacteria 1577
246 Ga0451847_0960767 3300041503 Bacteria 570
247 Ga0451853_0306076 3300041512 Unclassified 608
248 Ga0451853_2222635 3300041512 Bacteria 566
249 Ga0439450_043885 3300042008 Bacteria 1045
250 Ga0439454_087941 3300042011 Bacteria 571
251 Ga0439455_0034804 3300042012 Bacteria 1269
252 Ga0450914_006913 3300042118 Bacteria 1010
253 Ga0450890_016697 3300042127 Bacteria 973
254 Ga0439444_0017709 3300042437 Bacteria 1226
255 Ga0439459_0019936 3300042438 Bacteria 1276
256 Ga0439464_0232550 3300042439 Bacteria 593
257 Ga0439440_0077727 3300042993 Bacteria 873
258 Ga0466964_0256136 3300044706 Bacteria 865
259 Ga0466957_0796352 3300044842 Bacteria 671
260 Ga0466960_0160333 3300044901 Unclassified 1207
261 Ga0466967_0009633 3300045976 Bacteria 7180
262 Ga0466967_0010256 3300045976 Bacteria 7013
263 Ga0466967_0047932 3300045976 Bacteria 3728
264 Ga0466967_0899329 3300045976 Bacteria 880
265 Ga0495629_0441585 3300046459 Unclassified 882
266 Ga0495653_0225619 3300046463 Bacteria 1257
267 Ga0495608_0292499 3300046511 Bacteria 1009
268 Ga0495645_0561002 3300046543 Bacteria 707
269 Ga0495667_0276597 3300046559 Bacteria 1066
270 Ga0495656_0115529 3300046615 Bacteria 1261
271 Ga0495656_0522805 3300046615 Unclassified 631
272 Ga0495625_0000587 3300046660 Bacteria 52838
273 Ga0495670_0242413 3300046691 Bacteria 960
274 Ga0495604_0780760 3300047317 Bacteria 603
275 Ga0496100_0044606 3300048903 Bacteria 2841
276 Ga0496100_1257259 3300048903 Bacteria 584
277 Ga0496101_0026432 3300048904 Bacteria 4036
278 Ga0496101_0037741 3300048904 Bacteria 3429
279 Ga0496102_0056410 3300048905 Bacteria 3583
280 Ga0496102_0084887 3300048905 Bacteria 2923
281 Ga0496102_1325067 3300048905 Unclassified 639
282 Ga0496103_0319771 3300048906 Unclassified 998
283 Ga0496104_0588091 3300048907 Unclassified 1023
284 Ga0496105_0217352 3300048908 Bacteria 1556
285 Ga0496105_0351882 3300048908 Unclassified 1176
286 Ga0496106_0005657 3300048909 Bacteria 9247
287 Ga0496106_0303115 3300048909 Bacteria 1281
288 Ga0496106_1175518 3300048909 Bacteria 599
289 Ga0496106_1179718 3300048909 Bacteria 598
290 Ga0496107_0418062 3300048910 Unclassified 997
291 Ga0496107_0826418 3300048910 Bacteria 677
292 Ga0496107_0908137 3300048910 Bacteria 642
293 Ga0496108_0196081 3300048911 Bacteria 1751
294 Ga0496108_0739306 3300048911 Unclassified 851
295 Ga0496109_0127016 3300048912 Bacteria 2378
296 Ga0496109_0209451 3300048912 Bacteria 1833
297 Ga0496109_0232044 3300048912 Bacteria 1736
298 Ga0496110_0030438 3300048913 Bacteria 4653
299 Ga0496110_0201536 3300048913 Unclassified 1808
300 Ga0496111_0016214 3300048914 Bacteria 5133
301 Ga0496111_0388695 3300048914 Unclassified 1031
302 Ga0496112_0037285 3300048915 Bacteria 4745
303 Ga0496112_0948223 3300048915 Unclassified 781
304 Ga0496112_1378737 3300048915 Bacteria 620
305 Ga0496113_0004197 3300048916 Bacteria 8806
306 Ga0496113_1112423 3300048916 Bacteria 619
307 Ga0496114_1340455 3300048917 Bacteria 603
308 Ga0496115_0489109 3300048918 Bacteria 990
309 Ga0501039_1256188 3300049575 Bacteria 572
310 Ga0501040_0335196 3300049576 Bacteria 1083
311 Ga0501041_0560487 3300049577 Bacteria 728
312 Ga0501042_0042608 3300049578 Bacteria 3232
313 Ga0501048_1130015 3300049582 Bacteria 564
314 Ga0501067_0435952 3300049583 Bacteria 732
315 Ga0501069_0257787 3300049585 Bacteria 1018
316 Ga0501070_0310940 3300049586 Bacteria 1283
317 Ga0501071_0522137 3300049587 Bacteria 911
318 Ga0501071_0627804 3300049587 Bacteria 826
319 Ga0501074_1021184 3300049590 Unclassified 581
320 Ga0501075_0819126 3300049591 Bacteria 708
321 Ga0501076_0238692 3300049592 Bacteria 1487
322 Ga0501076_0284086 3300049592 Unclassified 1356
323 Ga0501079_0464690 3300049741 Bacteria 994
324 Ga0501044_1671988 3300049823 Unclassified 502
325 Ga0501045_0095787 3300049824 Bacteria 2196
326 nmdc:mga0yw44_1242540_c1 3300050492 Bacteria 502
327 nmdc:mga0yw44_445517_c1 3300050492 Bacteria 877
328 nmdc:mga05p37_446634_c1 3300050507 Bacteria 1498
329 nmdc:mga05p37_974469_c1 3300050507 Bacteria 904
330 nmdc:mga09592_807267_c1 3300050508 Bacteria 793
331 nmdc:mga0qj67_641566_c1 3300050509 Bacteria 848
332 nmdc:mga08y16_1732684_c1 3300050511 Bacteria 579
333 nmdc:mga08y16_331073_c1 3300050511 Bacteria 1566
334 nmdc:mga08y16_46948_c1 3300050511 Bacteria 4521
335 nmdc:mga08y16_606138_c1 3300050511 Bacteria 1103
336 nmdc:mga0n895_651053_c1 3300050512 Bacteria 1052
337 nmdc:mga0rr50_842286_c1 3300050513 Unclassified 782
338 nmdc:mga0a205_1095774_c1 3300050515 Bacteria 644
339 Ga0495601_0115973 3300053077 Bacteria 1737
340 Ga0495655_0014507 3300053083 Unclassified 1654
341 Ga0500556_0000103 3300053104 Bacteria 76442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_101359017 Ga0070662_1013590171 117
2 3300025933 Ga0207706_10450203 Ga0207706_104502032 117
3 3300025981 Ga0207640_10677972 Ga0207640_106779721 117
4 3300049587 Ga0501071_0522137 Ga0501071_0522137_131_520 117
5 3300053083 Ga0495655_0014507 Ga0495655_0014507_820_1215 122
6 3300005530 Ga0070679_100057466 Ga0070679_1000574662 123
7 3300025921 Ga0207652_10609671 Ga0207652_106096711 123
8 3300037418 Ga0395900_0016182 Ga0395900_0016182_2172_2546 123
9 3300037466 Ga0395898_0007451 Ga0395898_0007451_4864_5238 123
10 3300038443 Ga0395901_0330084 Ga0395901_0330084_868_1242 123
11 3300006038 Ga0075365_10376880 Ga0075365_103768802 124
12 3300006048 Ga0075363_100336562 Ga0075363_1003365622 124
13 3300006051 Ga0075364_10749709 Ga0075364_107497091 124
14 3300050492 nmdc:mga0yw44_1242540_c1 nmdc:mga0yw44_1242540_c1_70_465 124
15 3300028800 Ga0265338_10149631 Ga0265338_101496312 125
16 3300031240 Ga0265320_10025930 Ga0265320_100259304 125
17 3300035117 Ga0373953_0016327 Ga0373953_0016327_2024_2401 125
18 3300035120 Ga0373957_0088784 Ga0373957_0088784_228_605 125
19 3300035172 Ga0373955_0061190 Ga0373955_0061190_1302_1679 125
20 3300035724 Ga0373933_0072747 Ga0373933_0072747_1576_1953 125
21 3300035725 Ga0373947_1056575 Ga0373947_1056575_104_481 125
22 3300036401 Ga0373937_0469562 Ga0373937_0469562_88_465 125
23 3300046459 Ga0495629_0441585 Ga0495629_0441585_103_480 125
24 3300046463 Ga0495653_0225619 Ga0495653_0225619_793_1170 125
25 3300046511 Ga0495608_0292499 Ga0495608_0292499_218_595 125
26 3300046543 Ga0495645_0561002 Ga0495645_0561002_163_540 125
27 3300046559 Ga0495667_0276597 Ga0495667_0276597_288_665 125
28 3300047317 Ga0495604_0780760 Ga0495604_0780760_35_412 125
29 3300053077 Ga0495601_0115973 Ga0495601_0115973_223_600 125
30 3300006846 Ga0075430_100038533 Ga0075430_1000385335 126
31 3300046660 Ga0495625_0000587 Ga0495625_0000587_13853_14233 126
32 3300050509 nmdc:mga0qj67_641566_c1 nmdc:mga0qj67_641566_c1_426_806 126
33 3300005329 Ga0070683_100025203 Ga0070683_1000252037 127
34 3300005329 Ga0070683_100039239 Ga0070683_1000392395 127
35 3300005331 Ga0070670_100831432 Ga0070670_1008314322 127
36 3300005334 Ga0068869_100048830 Ga0068869_1000488304 127
37 3300005336 Ga0070680_100199063 Ga0070680_1001990633 127
38 3300005337 Ga0070682_100011987 Ga0070682_1000119872 127
39 3300005338 Ga0068868_100022174 Ga0068868_1000221742 127
40 3300005340 Ga0070689_100106371 Ga0070689_1001063713 127
41 3300005341 Ga0070691_10006421 Ga0070691_100064212 127
42 3300005344 Ga0070661_100033001 Ga0070661_1000330012 127
43 3300005344 Ga0070661_101455126 Ga0070661_1014551261 127
44 3300005354 Ga0070675_100310785 Ga0070675_1003107852 127
45 3300005354 Ga0070675_100652995 Ga0070675_1006529952 127
46 3300005366 Ga0070659_101470351 Ga0070659_1014703511 127
47 3300005437 Ga0070710_10246504 Ga0070710_102465042 127
48 3300005439 Ga0070711_100140359 Ga0070711_1001403592 127
49 3300005441 Ga0070700_100003875 Ga0070700_1000038751 127
50 3300005455 Ga0070663_100247207 Ga0070663_1002472072 127
51 3300005456 Ga0070678_100110722 Ga0070678_1001107221 127
52 3300005457 Ga0070662_101580209 Ga0070662_1015802092 127
53 3300005535 Ga0070684_100007099 Ga0070684_1000070999 127
54 3300005535 Ga0070684_100358110 Ga0070684_1003581102 127
55 3300005543 Ga0070672_101875887 Ga0070672_1018758872 127
56 3300005549 Ga0070704_100073831 Ga0070704_1000738311 127
57 3300005563 Ga0068855_100759008 Ga0068855_1007590082 127
58 3300005564 Ga0070664_100981079 Ga0070664_1009810792 127
59 3300005577 Ga0068857_100043193 Ga0068857_1000431934 127
60 3300005578 Ga0068854_100879577 Ga0068854_1008795772 127
61 3300005614 Ga0068856_100055563 Ga0068856_1000555634 127
62 3300005615 Ga0070702_100086326 Ga0070702_1000863262 127
63 3300005616 Ga0068852_100021358 Ga0068852_1000213583 127
64 3300005617 Ga0068859_100319446 Ga0068859_1003194463 127
65 3300005618 Ga0068864_100285692 Ga0068864_1002856923 127
66 3300005841 Ga0068863_100383907 Ga0068863_1003839072 127
67 3300005844 Ga0068862_100031415 Ga0068862_1000314156 127
68 3300006175 Ga0070712_100012095 Ga0070712_1000120957 127
69 3300006237 Ga0097621_100120463 Ga0097621_1001204633 127
70 3300006871 Ga0075434_100699663 Ga0075434_1006996632 127
71 3300006931 Ga0097620_100319415 Ga0097620_1003194153 127
72 3300009093 Ga0105240_10550445 Ga0105240_105504452 127
73 3300009094 Ga0111539_10131287 Ga0111539_101312873 127
74 3300009094 Ga0111539_10745032 Ga0111539_107450322 127
75 3300009098 Ga0105245_12808404 Ga0105245_128084041 127
76 3300009101 Ga0105247_10308561 Ga0105247_103085612 127
77 3300009174 Ga0105241_11956436 Ga0105241_119564361 127
78 3300009176 Ga0105242_10291777 Ga0105242_102917773 127
79 3300009176 Ga0105242_11125951 Ga0105242_111259512 127
80 3300009545 Ga0105237_10320247 Ga0105237_103202472 127
81 3300009553 Ga0105249_10888532 Ga0105249_108885322 127
82 3300010375 Ga0105239_10052258 Ga0105239_100522583 127
83 3300010375 Ga0105239_11472869 Ga0105239_114728692 127
84 3300011119 Ga0105246_10009307 Ga0105246_100093073 127
85 3300013105 Ga0157369_10233741 Ga0157369_102337413 127
86 3300013296 Ga0157374_10067749 Ga0157374_100677493 127
87 3300013307 Ga0157372_10023583 Ga0157372_100235835 127
88 3300013308 Ga0157375_10211663 Ga0157375_102116633 127
89 3300014325 Ga0163163_10102314 Ga0163163_101023144 127
90 3300014326 Ga0157380_10283194 Ga0157380_102831942 127
91 3300014326 Ga0157380_10496738 Ga0157380_104967382 127
92 3300014968 Ga0157379_11151084 Ga0157379_111510841 127
93 3300014968 Ga0157379_11639523 Ga0157379_116395232 127
94 3300014969 Ga0157376_10411204 Ga0157376_104112042 127
95 3300025898 Ga0207692_10178791 Ga0207692_101787912 127
96 3300025900 Ga0207710_10202331 Ga0207710_102023312 127
97 3300025913 Ga0207695_11606023 Ga0207695_116060232 127
98 3300025914 Ga0207671_10946803 Ga0207671_109468032 127
99 3300025915 Ga0207693_10015600 Ga0207693_100156004 127
100 3300025916 Ga0207663_10154324 Ga0207663_101543242 127
101 3300025917 Ga0207660_10471225 Ga0207660_104712252 127
102 3300025918 Ga0207662_10138790 Ga0207662_101387902 127
103 3300025920 Ga0207649_10308305 Ga0207649_103083052 127
104 3300025926 Ga0207659_10274496 Ga0207659_102744963 127
105 3300025931 Ga0207644_10070988 Ga0207644_100709883 127
106 3300025933 Ga0207706_10037496 Ga0207706_100374966 127
107 3300025935 Ga0207709_10125459 Ga0207709_101254593 127
108 3300025936 Ga0207670_10074463 Ga0207670_100744634 127
109 3300025938 Ga0207704_10128327 Ga0207704_101283273 127
110 3300025938 Ga0207704_11130660 Ga0207704_111306602 127
111 3300025940 Ga0207691_10779382 Ga0207691_107793822 127
112 3300025942 Ga0207689_10057322 Ga0207689_100573223 127
113 3300025944 Ga0207661_10104081 Ga0207661_101040812 127
114 3300025945 Ga0207679_10788085 Ga0207679_107880852 127
115 3300025961 Ga0207712_11247620 Ga0207712_112476202 127
116 3300025981 Ga0207640_10754705 Ga0207640_107547052 127
117 3300026023 Ga0207677_10167238 Ga0207677_101672382 127
118 3300026041 Ga0207639_11923984 Ga0207639_119239842 127
119 3300026067 Ga0207678_10058936 Ga0207678_100589364 127
120 3300026075 Ga0207708_10000262 Ga0207708_1000026237 127
121 3300026078 Ga0207702_10823214 Ga0207702_108232142 127
122 3300026116 Ga0207674_10060786 Ga0207674_100607864 127
123 3300026118 Ga0207675_100049127 Ga0207675_1000491274 127
124 3300026121 Ga0207683_10061800 Ga0207683_100618004 127
125 3300028380 Ga0268265_10335337 Ga0268265_103353371 127
126 3300044706 Ga0466964_0256136 Ga0466964_0256136_204_587 127
127 3300048904 Ga0496101_0026432 Ga0496101_0026432_2981_3364 127
128 3300048905 Ga0496102_0056410 Ga0496102_0056410_950_1333 127
129 3300048906 Ga0496103_0319771 Ga0496103_0319771_564_947 127
130 3300048907 Ga0496104_0588091 Ga0496104_0588091_605_988 127
131 3300048908 Ga0496105_0217352 Ga0496105_0217352_321_704 127
132 3300048909 Ga0496106_0005657 Ga0496106_0005657_8082_8465 127
133 3300048910 Ga0496107_0826418 Ga0496107_0826418_214_597 127
134 3300048911 Ga0496108_0739306 Ga0496108_0739306_125_508 127
135 3300048912 Ga0496109_0209451 Ga0496109_0209451_813_1196 127
136 3300048913 Ga0496110_0030438 Ga0496110_0030438_36_419 127
137 3300048914 Ga0496111_0016214 Ga0496111_0016214_341_724 127
138 3300048915 Ga0496112_0037285 Ga0496112_0037285_1129_1512 127
139 3300048916 Ga0496113_0004197 Ga0496113_0004197_341_724 127
140 3300050492 nmdc:mga0yw44_445517_c1 nmdc:mga0yw44_445517_c1_328_711 127
141 3300050511 nmdc:mga08y16_331073_c1 nmdc:mga08y16_331073_c1_796_1179 127
142 3300050511 nmdc:mga08y16_606138_c1 nmdc:mga08y16_606138_c1_620_1003 127
143 3300050512 nmdc:mga0n895_651053_c1 nmdc:mga0n895_651053_c1_346_729 127
144 3300053104 Ga0500556_0000103 Ga0500556_0000103_27000_27383 127
145 3300005329 Ga0070683_101276224 Ga0070683_1012762242 128
146 3300005329 Ga0070683_102342179 Ga0070683_1023421791 128
147 3300005337 Ga0070682_102057987 Ga0070682_1020579871 128
148 3300005338 Ga0068868_100994455 Ga0068868_1009944551 128
149 3300005366 Ga0070659_100758042 Ga0070659_1007580421 128
150 3300005437 Ga0070710_10105801 Ga0070710_101058011 128
151 3300005457 Ga0070662_100967787 Ga0070662_1009677872 128
152 3300005459 Ga0068867_102021759 Ga0068867_1020217591 128
153 3300005543 Ga0070672_101309790 Ga0070672_1013097902 128
154 3300005544 Ga0070686_101693417 Ga0070686_1016934171 128
155 3300005719 Ga0068861_101105020 Ga0068861_1011050202 128
156 3300005834 Ga0068851_10742487 Ga0068851_107424871 128
157 3300005840 Ga0068870_11203274 Ga0068870_112032741 128
158 3300006871 Ga0075434_101074606 Ga0075434_1010746062 128
159 3300009094 Ga0111539_11465442 Ga0111539_114654422 128
160 3300009148 Ga0105243_11175985 Ga0105243_111759852 128
161 3300009148 Ga0105243_12755961 Ga0105243_127559611 128
162 3300009176 Ga0105242_11097320 Ga0105242_110973202 128
163 3300009553 Ga0105249_10848480 Ga0105249_108484802 128
164 3300013307 Ga0157372_11659493 Ga0157372_116594931 128
165 3300014325 Ga0163163_11643200 Ga0163163_116432002 128
166 3300014326 Ga0157380_12511481 Ga0157380_125114812 128
167 3300014326 Ga0157380_13004610 Ga0157380_130046102 128
168 3300021377 Ga0213874_10232819 Ga0213874_102328191 128
169 3300021388 Ga0213875_10289273 Ga0213875_102892731 128
170 3300025899 Ga0207642_10499532 Ga0207642_104995322 128
171 3300025908 Ga0207643_10395113 Ga0207643_103951132 128
172 3300025933 Ga0207706_10924914 Ga0207706_109249142 128
173 3300025934 Ga0207686_10990844 Ga0207686_109908442 128
174 3300025934 Ga0207686_11759669 Ga0207686_117596691 128
175 3300025937 Ga0207669_10900587 Ga0207669_109005872 128
176 3300025940 Ga0207691_10810006 Ga0207691_108100062 128
177 3300025944 Ga0207661_11006482 Ga0207661_110064821 128
178 3300025972 Ga0207668_10749015 Ga0207668_107490152 128
179 3300025981 Ga0207640_10215257 Ga0207640_102152573 128
180 3300026075 Ga0207708_10240331 Ga0207708_102403312 128
181 3300026118 Ga0207675_100145222 Ga0207675_1001452223 128
182 3300026121 Ga0207683_10575237 Ga0207683_105752373 128
183 3300028379 Ga0268266_10479395 Ga0268266_104793952 128
184 3300031344 Ga0265316_10655882 Ga0265316_106558821 128
185 3300031824 Ga0307413_10259416 Ga0307413_102594162 128
186 3300031903 Ga0307407_11676704 Ga0307407_116767041 128
187 3300031995 Ga0307409_100333056 Ga0307409_1003330562 128
188 3300031995 Ga0307409_100400646 Ga0307409_1004006462 128
189 3300031995 Ga0307409_100974755 Ga0307409_1009747551 128
190 3300032004 Ga0307414_11165555 Ga0307414_111655551 128
191 3300032126 Ga0307415_101425296 Ga0307415_1014252962 128
192 3300037853 Ga0436364_0073896 Ga0436364_0073896_354_740 128
193 3300041503 Ga0451847_0960767 Ga0451847_0960767_29_415 128
194 3300041512 Ga0451853_2222635 Ga0451853_2222635_96_482 128
195 3300044901 Ga0466960_0160333 Ga0466960_0160333_174_560 128
196 3300045976 Ga0466967_0009633 Ga0466967_0009633_4390_4776 128
197 3300045976 Ga0466967_0047932 Ga0466967_0047932_1653_2051 128
198 3300045976 Ga0466967_0899329 Ga0466967_0899329_347_733 128
199 3300048903 Ga0496100_0044606 Ga0496100_0044606_2413_2799 128
200 3300048903 Ga0496100_1257259 Ga0496100_1257259_118_504 128
201 3300048904 Ga0496101_0037741 Ga0496101_0037741_2774_3160 128
202 3300048905 Ga0496102_0084887 Ga0496102_0084887_250_636 128
203 3300048909 Ga0496106_0303115 Ga0496106_0303115_181_567 128
204 3300048909 Ga0496106_1175518 Ga0496106_1175518_31_417 128
205 3300048910 Ga0496107_0418062 Ga0496107_0418062_573_959 128
206 3300048917 Ga0496114_1340455 Ga0496114_1340455_193_582 128
207 3300048918 Ga0496115_0489109 Ga0496115_0489109_415_801 128
208 3300049576 Ga0501040_0335196 Ga0501040_0335196_90_476 128
209 3300049586 Ga0501070_0310940 Ga0501070_0310940_744_1130 128
210 3300050513 nmdc:mga0rr50_842286_c1 nmdc:mga0rr50_842286_c1_86_472 128
211 3300005337 Ga0070682_101262250 Ga0070682_1012622502 129
212 3300005347 Ga0070668_100509622 Ga0070668_1005096222 129
213 3300005578 Ga0068854_100921510 Ga0068854_1009215102 129
214 3300005616 Ga0068852_101155151 Ga0068852_1011551511 129
215 3300005937 Ga0081455_10354559 Ga0081455_103545591 129
216 3300006051 Ga0075364_10590570 Ga0075364_105905702 129
217 3300006175 Ga0070712_101446843 Ga0070712_1014468431 129
218 3300006844 Ga0075428_100955082 Ga0075428_1009550822 129
219 3300006881 Ga0068865_100740844 Ga0068865_1007408442 129
220 3300009147 Ga0114129_11922588 Ga0114129_119225882 129
221 3300009176 Ga0105242_12196948 Ga0105242_121969482 129
222 3300009177 Ga0105248_11036634 Ga0105248_110366342 129
223 3300009545 Ga0105237_11800564 Ga0105237_118005642 129
224 3300009553 Ga0105249_10933908 Ga0105249_109339082 129
225 3300010375 Ga0105239_12627982 Ga0105239_126279821 129
226 3300014326 Ga0157380_10208572 Ga0157380_102085722 129
227 3300014326 Ga0157380_10259307 Ga0157380_102593072 129
228 3300014745 Ga0157377_10324006 Ga0157377_103240062 129
229 3300025937 Ga0207669_10294401 Ga0207669_102944012 129
230 3300025938 Ga0207704_11271743 Ga0207704_112717431 129
231 3300025942 Ga0207689_10336285 Ga0207689_103362852 129
232 3300025972 Ga0207668_10304870 Ga0207668_103048702 129
233 3300025981 Ga0207640_11355269 Ga0207640_113552691 129
234 3300026075 Ga0207708_10247071 Ga0207708_102470712 129
235 3300026089 Ga0207648_10323525 Ga0207648_103235252 129
236 3300031824 Ga0307413_12154321 Ga0307413_121543211 129
237 3300032002 Ga0307416_101566943 Ga0307416_1015669432 129
238 3300032126 Ga0307415_101200665 Ga0307415_1012006652 129
239 3300046615 Ga0495656_0115529 Ga0495656_0115529_544_933 129
240 3300046615 Ga0495656_0522805 Ga0495656_0522805_89_478 129
241 3300048905 Ga0496102_1325067 Ga0496102_1325067_112_501 129
242 3300048909 Ga0496106_1179718 Ga0496106_1179718_35_424 129
243 3300048910 Ga0496107_0908137 Ga0496107_0908137_131_520 129
244 3300049577 Ga0501041_0560487 Ga0501041_0560487_240_629 129
245 3300049578 Ga0501042_0042608 Ga0501042_0042608_986_1375 129
246 3300049582 Ga0501048_1130015 Ga0501048_1130015_122_511 129
247 3300049585 Ga0501069_0257787 Ga0501069_0257787_127_516 129
248 3300049587 Ga0501071_0627804 Ga0501071_0627804_248_637 129
249 3300049590 Ga0501074_1021184 Ga0501074_1021184_59_448 129
250 3300049591 Ga0501075_0819126 Ga0501075_0819126_133_522 129
251 3300049592 Ga0501076_0284086 Ga0501076_0284086_264_653 129
252 3300049741 Ga0501079_0464690 Ga0501079_0464690_458_847 129
253 3300049823 Ga0501044_1671988 Ga0501044_1671988_62_451 129
254 3300049824 Ga0501045_0095787 Ga0501045_0095787_110_499 129
255 3300005329 Ga0070683_100331596 Ga0070683_1003315962 130
256 3300005344 Ga0070661_100454944 Ga0070661_1004549441 130
257 3300005347 Ga0070668_100835138 Ga0070668_1008351382 130
258 3300005356 Ga0070674_100382868 Ga0070674_1003828682 130
259 3300005364 Ga0070673_100946738 Ga0070673_1009467381 130
260 3300005456 Ga0070678_100857511 Ga0070678_1008575112 130
261 3300005456 Ga0070678_100920435 Ga0070678_1009204352 130
262 3300005458 Ga0070681_11526210 Ga0070681_115262102 130
263 3300005577 Ga0068857_100892801 Ga0068857_1008928012 130
264 3300005614 Ga0068856_100951085 Ga0068856_1009510851 130
265 3300005842 Ga0068858_101068040 Ga0068858_1010680402 130
266 3300005843 Ga0068860_100879202 Ga0068860_1008792022 130
267 3300005981 Ga0081538_10000701 Ga0081538_1000070124 130
268 3300006844 Ga0075428_100247724 Ga0075428_1002477243 130
269 3300006846 Ga0075430_100141613 Ga0075430_1001416133 130
270 3300006852 Ga0075433_11374058 Ga0075433_113740582 130
271 3300006871 Ga0075434_100583539 Ga0075434_1005835392 130
272 3300006880 Ga0075429_100574493 Ga0075429_1005744932 130
273 3300009094 Ga0111539_10028919 Ga0111539_100289197 130
274 3300009094 Ga0111539_10788491 Ga0111539_107884912 130
275 3300009098 Ga0105245_11080829 Ga0105245_110808291 130
276 3300009098 Ga0105245_11738459 Ga0105245_117384591 130
277 3300009147 Ga0114129_10054564 Ga0114129_100545643 130
278 3300009148 Ga0105243_11474263 Ga0105243_114742632 130
279 3300009176 Ga0105242_11631085 Ga0105242_116310852 130
280 3300010375 Ga0105239_13012708 Ga0105239_130127081 130
281 3300014326 Ga0157380_11880430 Ga0157380_118804302 130
282 3300020081 Ga0206354_11647580 Ga0206354_116475802 130
283 3300025912 Ga0207707_11595494 Ga0207707_115954941 130
284 3300025923 Ga0207681_11064738 Ga0207681_110647381 130
285 3300025935 Ga0207709_11342333 Ga0207709_113423331 130
286 3300026078 Ga0207702_10571816 Ga0207702_105718162 130
287 3300031548 Ga0307408_100977674 Ga0307408_1009776741 130
288 3300031824 Ga0307413_10629015 Ga0307413_106290152 130
289 3300031995 Ga0307409_100319229 Ga0307409_1003192292 130
290 3300032002 Ga0307416_100148280 Ga0307416_1001482802 130
291 3300035121 Ga0373960_0173918 Ga0373960_0173918_108_503 130
292 3300035242 Ga0373962_0098527 Ga0373962_0098527_31_426 130
293 3300041512 Ga0451853_0306076 Ga0451853_0306076_21_416 130
294 3300044842 Ga0466957_0796352 Ga0466957_0796352_262_657 130
295 3300045976 Ga0466967_0010256 Ga0466967_0010256_3973_4365 130
296 3300046691 Ga0495670_0242413 Ga0495670_0242413_48_506 130
297 3300048908 Ga0496105_0351882 Ga0496105_0351882_92_487 130
298 3300048911 Ga0496108_0196081 Ga0496108_0196081_415_810 130
299 3300048912 Ga0496109_0127016 Ga0496109_0127016_1459_1854 130
300 3300048912 Ga0496109_0232044 Ga0496109_0232044_923_1321 130
301 3300048913 Ga0496110_0201536 Ga0496110_0201536_189_584 130
302 3300048914 Ga0496111_0388695 Ga0496111_0388695_284_679 130
303 3300048915 Ga0496112_0948223 Ga0496112_0948223_224_619 130
304 3300048915 Ga0496112_1378737 Ga0496112_1378737_79_474 130
305 3300048916 Ga0496113_1112423 Ga0496113_1112423_99_494 130
306 3300049575 Ga0501039_1256188 Ga0501039_1256188_84_524 130
307 3300049583 Ga0501067_0435952 Ga0501067_0435952_246_641 130
308 3300049592 Ga0501076_0238692 Ga0501076_0238692_617_1009 130
309 3300050507 nmdc:mga05p37_446634_c1 nmdc:mga05p37_446634_c1_377_772 130
310 3300050508 nmdc:mga09592_807267_c1 nmdc:mga09592_807267_c1_341_733 130
311 3300050511 nmdc:mga08y16_1732684_c1 nmdc:mga08y16_1732684_c1_56_451 130
312 3300050511 nmdc:mga08y16_46948_c1 nmdc:mga08y16_46948_c1_3620_4015 130
313 3300050515 nmdc:mga0a205_1095774_c1 nmdc:mga0a205_1095774_c1_139_534 130
314 3300005327 Ga0070658_10457917 Ga0070658_104579172 131
315 3300005329 Ga0070683_100531662 Ga0070683_1005316621 131
316 3300005366 Ga0070659_100820445 Ga0070659_1008204451 131
317 3300005456 Ga0070678_100205085 Ga0070678_1002050853 131
318 3300005564 Ga0070664_100495549 Ga0070664_1004955492 131
319 3300005840 Ga0068870_10998967 Ga0068870_109989671 131
320 3300009094 Ga0111539_10470049 Ga0111539_104700493 131
321 3300009094 Ga0111539_11111438 Ga0111539_111114382 131
322 3300009098 Ga0105245_10401099 Ga0105245_104010992 131
323 3300009147 Ga0114129_11060773 Ga0114129_110607732 131
324 3300009177 Ga0105248_13283497 Ga0105248_132834971 131
325 3300013308 Ga0157375_11240142 Ga0157375_112401422 131
326 3300025914 Ga0207671_11089188 Ga0207671_110891882 131
327 3300025918 Ga0207662_10332983 Ga0207662_103329831 131
328 3300025920 Ga0207649_11253107 Ga0207649_112531071 131
329 3300025935 Ga0207709_11845490 Ga0207709_118454901 131
330 3300025945 Ga0207679_10331319 Ga0207679_103313192 131
331 3300026121 Ga0207683_10198068 Ga0207683_101980682 131
332 3300042008 Ga0439450_043885 Ga0439450_043885_623_1018 131
333 3300042011 Ga0439454_087941 Ga0439454_087941_64_534 131
334 3300042012 Ga0439455_0034804 Ga0439455_0034804_162_557 131
335 3300042118 Ga0450914_006913 Ga0450914_006913_346_741 131
336 3300042127 Ga0450890_016697 Ga0450890_016697_122_517 131
337 3300042437 Ga0439444_0017709 Ga0439444_0017709_180_575 131
338 3300042438 Ga0439459_0019936 Ga0439459_0019936_853_1248 131
339 3300042439 Ga0439464_0232550 Ga0439464_0232550_14_430 131
340 3300042993 Ga0439440_0077727 Ga0439440_0077727_146_541 131
341 3300050507 nmdc:mga05p37_974469_c1 nmdc:mga05p37_974469_c1_235_630 131

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.9216 34 110
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9061 36 112
2d40-assembly1.cif.gz_B crystal structure of z3393 from escherichia coli o157:h7 0.9024 35 111
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8973 20 113
2d40-assembly1.cif.gz_C crystal structure of z3393 from escherichia coli o157:h7 0.897 35 111
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9061 36 112 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8973 20 113 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8966 38 109 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8866 34 122 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8738 36 111 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6J4TPA1-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9528 1 125
AF-A0A538LL00-F1-model_v4 Cupin domain-containing protein 0.9451 2 127
AF-A0A2W5YQX8-F1-model_v4 Cupin type-2 domain-containing protein 0.9382 35 125 GO:0046872
AF-A0A7W1RVN1-F1-model_v4 Cupin domain-containing protein 0.9378 1 128
AF-A0A0D7X4A9-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9369 37 113 GO:0004475
GO:0005976
GO:0009298

Feature Viewer

pLDDT pTM Quality
94.75 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map