F414830

General Info

Members Datasets Scaffolds Average Seq Length
341 188 682 188

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0620522|Ga0451791_0620522_2247_2936
Length 229
Sequence LAGLKALGSRLRGNDDLEIFLARNVAVNRIFCRPKSMYDPLPMISPLLSIHEAATALQTGGVIAYPTEAVWGLGCDPRDEDAVLRLLAIKQRAVDKGLILIASHLDQLRPFLNLAAVPAGKLAEVLASWPGPHTWVMPASAAAPRWVTGAHDGIAVRISAHPLVIELCNAYGGALVSTSANRAGQPAAVTPETLDPVVLDGVDGLVAGETGGLSAPTAIRDALTGAAIR

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
88 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
89 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
90 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
115 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
116 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
117 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
170 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
176 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
177 2643221573 Lysobacter sp. Root604 Isolate Unclassified
178 2643221586 Lysobacter sp. Root667 Isolate Unclassified
179 2643221612 Lysobacter sp. Root76 Isolate Unclassified
180 2643221720 Lysobacter sp. Root916 Isolate Unclassified
181 2643221727 Lysobacter sp. Root96 Isolate Unclassified
182 2643221728 Lysobacter sp. Root983 Isolate Unclassified
183 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
184 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
185 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
186 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
187 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
188 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.19
Metatranscriptomes 0
Isolates 3.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.26
Nodule 0
Rhizoplane 4.4
Rhizosphere 57.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_0620522 3300041451 Bacteria 4101
2 JGI25150J39212_1001238 3300002774 Bacteria 7429
3 JGI25151J46595_10001145 3300003187 Bacteria 19226
4 JGI25153J46596_10000801 3300003215 Bacteria 19226
5 Ga0055537_1000614 3300003773 Bacteria 19575
6 Ga0055534_1002224 3300003784 Bacteria 6876
7 Ga0055528_1000407 3300003790 Bacteria 34812
8 Ga0055530_10003832 3300003791 Bacteria 8252
9 Ga0055531_10016524 3300003794 Bacteria 3178
10 Ga0055531_10025887 3300003794 Bacteria 2113
11 Ga0055531_10045501 3300003794 Bacteria 1217
12 Ga0065715_10115368 3300005293 Bacteria 2417
13 Ga0070658_10476019 3300005327 Bacteria 1077
14 Ga0070676_10087082 3300005328 Bacteria 1906
15 Ga0070670_100336692 3300005331 Bacteria 1324
16 Ga0070668_100067443 3300005347 Bacteria 2779
17 Ga0070668_100133310 3300005347 Bacteria 1995
18 Ga0070669_100132545 3300005353 Bacteria 1914
19 Ga0070659_100664313 3300005366 Bacteria 899
20 Ga0070713_101295892 3300005436 Bacteria 706
21 Ga0070678_100186582 3300005456 Bacteria 1702
22 Ga0070678_100565673 3300005456 Bacteria 1011
23 Ga0070662_100791139 3300005457 Bacteria 806
24 Ga0070681_10253540 3300005458 Bacteria 1672
25 Ga0070681_11244420 3300005458 Bacteria 667
26 Ga0068867_100109666 3300005459 Bacteria 2119
27 Ga0070679_100557893 3300005530 Bacteria 1089
28 Ga0070679_100683642 3300005530 Bacteria 969
29 Ga0070672_100018344 3300005543 Bacteria 5057
30 Ga0070693_100626019 3300005547 Bacteria 780
31 Ga0070665_100248758 3300005548 Bacteria 1778
32 Ga0070665_100286351 3300005548 Bacteria 1650
33 Ga0070665_100497730 3300005548 Bacteria 1230
34 Ga0070664_100330129 3300005564 Bacteria 1383
35 Ga0068854_100328891 3300005578 Bacteria 1245
36 Ga0068852_100265882 3300005616 Bacteria 1649
37 Ga0075364_10094995 3300006051 Bacteria 1981
38 Ga0068865_100498053 3300006881 Bacteria 1015
39 Ga0105251_10045884 3300009011 Bacteria 2105
40 Ga0105244_10222420 3300009036 Bacteria 885
41 Ga0105243_10006142 3300009148 Bacteria 9288
42 Ga0105242_10091670 3300009176 Bacteria 2559
43 Ga0105248_10609204 3300009177 Bacteria 1232
44 Ga0105237_10114334 3300009545 Bacteria 2691
45 Ga0105249_10496318 3300009553 Bacteria 1265
46 Ga0105028_102637 3300009993 Bacteria 1879
47 Ga0157373_10029826 3300013100 Bacteria 3927
48 Ga0157373_10057501 3300013100 Bacteria 2758
49 Ga0157373_10310481 3300013100 Bacteria 1120
50 Ga0157371_10000509 3300013102 Bacteria 46826
51 Ga0157371_10015410 3300013102 Bacteria 5735
52 Ga0157371_10052021 3300013102 Bacteria 2909
53 Ga0157371_10244614 3300013102 Bacteria 1291
54 Ga0157370_10007416 3300013104 Bacteria 11942
55 Ga0157374_10037939 3300013296 Bacteria 4426
56 Ga0157375_10089880 3300013308 Bacteria 3128
57 Ga0157380_10291946 3300014326 Bacteria 1497
58 Ga0182008_10000278 3300014497 Bacteria 40186
59 Ga0182008_10111281 3300014497 Bacteria 1357
60 Ga0182006_1016598 3300015261 Bacteria 3139
61 Ga0182006_1054229 3300015261 Bacteria 1535
62 Ga0182006_1065502 3300015261 Bacteria 1360
63 Ga0182007_10000142 3300015262 Bacteria 47856
64 Ga0182005_1000949 3300015265 Bacteria 12655
65 Ga0182005_1004598 3300015265 Bacteria 4430
66 Ga0163161_10048283 3300017792 Bacteria 3074
67 Ga0163161_10490773 3300017792 Bacteria 999
68 Ga0207425_1000074 3300025245 Bacteria 108738
69 Ga0209129_1000150 3300025258 Bacteria 113886
70 Ga0209565_1000050 3300025263 Bacteria 213856
71 Ga0209673_1000199 3300025273 Bacteria 120904
72 Ga0209675_1000007 3300025291 Bacteria 683430
73 Ga0209676_1000018 3300025292 Bacteria 631385
74 Ga0209676_1000052 3300025292 Bacteria 371539
75 Ga0209676_1000168 3300025292 Bacteria 156042
76 Ga0209676_1002688 3300025292 Bacteria 12028
77 Ga0209676_1006860 3300025292 Bacteria 5513
78 Ga0209025_1000048 3300025294 Bacteria 335574
79 Ga0209564_1000061 3300025295 Bacteria 322795
80 Ga0209758_1000056 3300025297 Bacteria 335574
81 Ga0209050_1000424 3300025298 Bacteria 77803
82 Ga0209256_1012803 3300025299 Bacteria 3172
83 Ga0209051_1006684 3300025303 Bacteria 6450
84 Ga0209257_1000035 3300025304 Bacteria 631463
85 Ga0209257_1000147 3300025304 Bacteria 194105
86 Ga0209257_1001575 3300025304 Bacteria 26306
87 Ga0209257_1002550 3300025304 Bacteria 17783
88 Ga0209257_1028849 3300025304 Bacteria 1820
89 Ga0207713_1002835 3300025735 Bacteria 12196
90 Ga0207713_1009452 3300025735 Bacteria 5492
91 Ga0207705_10453697 3300025909 Bacteria 994
92 Ga0207660_10140914 3300025917 Bacteria 1843
93 Ga0207657_10094775 3300025919 Bacteria 2485
94 Ga0207649_10650602 3300025920 Bacteria 814
95 Ga0207652_10730048 3300025921 Bacteria 883
96 Ga0207652_11352533 3300025921 Bacteria 615
97 Ga0207681_10015545 3300025923 Bacteria 4749
98 Ga0207659_10412998 3300025926 Bacteria 1131
99 Ga0207690_11089295 3300025932 Bacteria 666
100 Ga0207686_10259667 3300025934 Bacteria 1273
101 Ga0207709_10000528 3300025935 Bacteria 33221
102 Ga0207709_10294210 3300025935 Bacteria 1205
103 Ga0207691_10001458 3300025940 Bacteria 23567
104 Ga0207689_10059172 3300025942 Bacteria 3152
105 Ga0207651_10019878 3300025960 Bacteria 4038
106 Ga0207651_10850638 3300025960 Bacteria 811
107 Ga0207668_10001893 3300025972 Bacteria 12254
108 Ga0207668_10048923 3300025972 Bacteria 2903
109 Ga0207640_10304230 3300025981 Bacteria 1263
110 Ga0207639_11118576 3300026041 Bacteria 739
111 Ga0207678_10427052 3300026067 Bacteria 1150
112 Ga0207648_10498161 3300026089 Bacteria 1114
113 Ga0207683_10226214 3300026121 Bacteria 1705
114 Ga0207698_10299234 3300026142 Bacteria 1497
115 Ga0209371_1000018 3300027312 Bacteria 614700
116 Ga0209371_1000025 3300027312 Bacteria 450640
117 Ga0268266_10070528 3300028379 Bacteria 3028
118 Ga0268266_10345610 3300028379 Bacteria 1397
119 Ga0268265_10233556 3300028380 Bacteria 1618
120 Ga0268256_1000016 3300030500 Bacteria 614700
121 Ga0268256_1000027 3300030500 Bacteria 450640
122 Ga0316177_1021239 3300030731 Bacteria 2638
123 Ga0316176_1187957 3300030732 Bacteria 5135
124 Ga0316183_1200043 3300030742 Bacteria 6242
125 Ga0316181_1182864 3300030744 Bacteria 1052
126 Ga0316181_1236527 3300030744 Bacteria 1845
127 Ga0307513_10000429 3300031456 Bacteria 60815
128 Ga0307513_10056679 3300031456 Bacteria 4181
129 Ga0307513_10202855 3300031456 Bacteria 1822
130 Ga0307408_101032481 3300031548 Bacteria 759
131 Ga0307405_10573896 3300031731 Bacteria 916
132 Ga0307413_10004572 3300031824 Bacteria 6044
133 Ga0307413_10307401 3300031824 Bacteria 1205
134 Ga0307410_10412496 3300031852 Bacteria 1094
135 Ga0307412_10006193 3300031911 Bacteria 6746
136 Ga0307412_10126036 3300031911 Bacteria 1852
137 Ga0307412_10285637 3300031911 Bacteria 1297
138 Ga0307412_10349593 3300031911 Bacteria 1186
139 Ga0307412_10436616 3300031911 Bacteria 1075
140 Ga0307412_10705147 3300031911 Bacteria 867
141 Ga0307409_100799276 3300031995 Bacteria 951
142 Ga0307416_100444640 3300032002 Bacteria 1347
143 Ga0307414_10001920 3300032004 Bacteria 10757
144 Ga0307414_10005966 3300032004 Bacteria 6747
145 Ga0307414_10027401 3300032004 Bacteria 3682
146 Ga0307414_10032052 3300032004 Bacteria 3456
147 Ga0307414_10052873 3300032004 Bacteria 2830
148 Ga0307414_10058974 3300032004 Bacteria 2707
149 Ga0307414_10107091 3300032004 Bacteria 2117
150 Ga0307414_10733052 3300032004 Bacteria 897
151 Ga0307414_10733277 3300032004 Bacteria 897
152 Ga0307414_11203492 3300032004 Bacteria 701
153 Ga0307411_10119503 3300032005 Bacteria 1904
154 Ga0307411_10607084 3300032005 Bacteria 941
155 Ga0395905_0215698 3300037471 Bacteria 1797
156 Ga0237819_00342 3300038705 Bacteria 16972
157 Ga0237819_08475 3300038705 Bacteria 1422
158 Ga0439436_0066004 3300041404 Bacteria 1010
159 Ga0451787_298182 3300041441 Bacteria 758
160 Ga0451791_0148027 3300041451 Bacteria 1807
161 Ga0451791_0875784 3300041451 Bacteria 2509
162 Ga0451793_1271182 3300041452 Bacteria 927
163 Ga0451797_0306184 3300041453 Bacteria 1056
164 Ga0451807_1225870 3300041486 Bacteria 1301
165 Ga0451807_1482133 3300041486 Bacteria 1863
166 Ga0451837_0098597 3300041494 Bacteria 718
167 Ga0439433_0023270 3300041999 Bacteria 1393
168 Ga0439432_004645 3300042006 Bacteria 5002
169 Ga0439432_011817 3300042006 Bacteria 3000
170 Ga0439432_027734 3300042006 Bacteria 1847
171 Ga0439432_070121 3300042006 Bacteria 1070
172 Ga0439432_134892 3300042006 Bacteria 727
173 Ga0439449_0007600 3300042007 Bacteria 4119
174 Ga0439449_0008011 3300042007 Bacteria 4012
175 Ga0439449_0013316 3300042007 Bacteria 3094
176 Ga0439449_0066421 3300042007 Bacteria 1330
177 Ga0439449_0094787 3300042007 Bacteria 1102
178 Ga0439462_0056851 3300042015 Bacteria 1056
179 Ga0450911_001224 3300042115 Bacteria 6227
180 Ga0450898_051003 3300042134 Bacteria 800
181 Ga0450918_054696 3300042531 Bacteria 731
182 Ga0450901_005562 3300042533 Bacteria 1293
183 Ga0495627_009559 3300046453 Bacteria 3563
184 Ga0495638_0014038 3300046460 Bacteria 5428
185 Ga0495638_0017139 3300046460 Bacteria 4836
186 Ga0495638_0186821 3300046460 Bacteria 1178
187 Ga0495606_0063498 3300046507 Bacteria 2354
188 Ga0495610_0259062 3300046512 Bacteria 686
189 Ga0495616_0045764 3300046513 Bacteria 2213
190 Ga0495616_0105448 3300046513 Bacteria 1316
191 Ga0495616_0161073 3300046513 Bacteria 1009
192 Ga0495632_0036273 3300046519 Bacteria 2509
193 Ga0495643_0010376 3300046522 Bacteria 5734
194 Ga0495643_0119756 3300046522 Bacteria 1331
195 Ga0495663_0003339 3300046525 Bacteria 4646
196 Ga0495663_0010539 3300046525 Bacteria 2572
197 Ga0495663_0031097 3300046525 Bacteria 1584
198 Ga0495663_0242678 3300046525 Bacteria 638
199 Ga0495598_0076785 3300046537 Bacteria 1064
200 Ga0495621_0115223 3300046539 Bacteria 1034
201 Ga0495633_0006335 3300046558 Bacteria 7038
202 Ga0495633_0012954 3300046558 Bacteria 4412
203 Ga0495625_0034860 3300046660 Bacteria 3711
204 Ga0495625_0039707 3300046660 Bacteria 3435
205 Ga0495625_0097775 3300046660 Bacteria 2020
206 Ga0495659_0068405 3300046664 Bacteria 1326
207 Ga0495671_0028925 3300046692 Bacteria 2851
208 Ga0495636_0019820 3300047318 Bacteria 2705
209 Ga0495636_0033365 3300047318 Bacteria 2114
210 Ga0495636_0043565 3300047318 Bacteria 1867
211 Ga0495636_0340820 3300047318 Bacteria 706
212 Ga0495672_0000355 3300047320 Bacteria 58647
213 Ga0495685_049659 3300047447 Bacteria 1424
214 Ga0495681_0084704 3300047470 Bacteria 1409
215 Ga0495681_0142075 3300047470 Bacteria 1013
216 Ga0495686_0004495 3300047472 Bacteria 11464
217 Ga0495686_0064011 3300047472 Bacteria 2277
218 Ga0496104_0742574 3300048907 Bacteria 889
219 Ga0496105_0037459 3300048908 Bacteria 3993
220 Ga0496105_0091462 3300048908 Bacteria 2512
221 Ga0496106_0492724 3300048909 Bacteria 984
222 Ga0496108_0097760 3300048911 Bacteria 2502
223 Ga0496110_0536687 3300048913 Bacteria 1064
224 Ga0496113_0459970 3300048916 Bacteria 1022
225 Ga0496116_0001148 3300048919 Bacteria 31389
226 Ga0496116_0024995 3300048919 Bacteria 4401
227 Ga0496116_0057492 3300048919 Bacteria 2542
228 Ga0496116_0081070 3300048919 Bacteria 2013
229 Ga0496117_0001057 3300048920 Bacteria 42009
230 Ga0496117_0001116 3300048920 Bacteria 40487
231 Ga0496117_0007671 3300048920 Bacteria 10454
232 Ga0496117_0021620 3300048920 Bacteria 5197
233 Ga0496117_0025838 3300048920 Bacteria 4605
234 Ga0496117_0056315 3300048920 Bacteria 2739
235 Ga0496117_0092831 3300048920 Bacteria 1937
236 Ga0496117_0409206 3300048920 Bacteria 682
237 Ga0496118_0000661 3300048921 Bacteria 56425
238 Ga0496118_0002647 3300048921 Bacteria 23718
239 Ga0496118_0026668 3300048921 Bacteria 4913
240 Ga0496118_0029136 3300048921 Bacteria 4636
241 Ga0496118_0030183 3300048921 Bacteria 4530
242 Ga0496118_0033662 3300048921 Bacteria 4199
243 Ga0496118_0049921 3300048921 Bacteria 3217
244 Ga0496118_0071499 3300048921 Bacteria 2497
245 Ga0496118_0115008 3300048921 Bacteria 1772
246 Ga0496118_0351328 3300048921 Bacteria 785
247 Ga0496119_0001372 3300048922 Bacteria 29711
248 Ga0496119_0011845 3300048922 Bacteria 7161
249 Ga0496119_0022284 3300048922 Bacteria 4542
250 Ga0496119_0024230 3300048922 Bacteria 4272
251 Ga0496119_0081194 3300048922 Bacteria 1868
252 Ga0496120_0001351 3300048923 Bacteria 30172
253 Ga0496120_0005146 3300048923 Bacteria 10567
254 Ga0496120_0034525 3300048923 Bacteria 3029
255 Ga0496121_0003939 3300048924 Bacteria 20555
256 Ga0496121_0021726 3300048924 Bacteria 6270
257 Ga0496121_0038848 3300048924 Bacteria 4206
258 Ga0496121_0087225 3300048924 Bacteria 2450
259 Ga0496121_0233479 3300048924 Bacteria 1286
260 Ga0496122_0019452 3300048925 Bacteria 6201
261 Ga0496122_0030572 3300048925 Bacteria 4509
262 Ga0496122_0033055 3300048925 Bacteria 4262
263 Ga0496122_0043522 3300048925 Bacteria 3516
264 Ga0496122_0120078 3300048925 Bacteria 1697
265 Ga0496122_0212838 3300048925 Bacteria 1117
266 Ga0496123_0001263 3300048926 Bacteria 36324
267 Ga0496123_0028762 3300048926 Bacteria 4108
268 Ga0496123_0035638 3300048926 Bacteria 3542
269 Ga0496123_0067520 3300048926 Bacteria 2258
270 Ga0496123_0107612 3300048926 Bacteria 1603
271 Ga0496123_0144476 3300048926 Bacteria 1294
272 Ga0496123_0228033 3300048926 Bacteria 934
273 Ga0496124_0002117 3300048927 Bacteria 26727
274 Ga0496124_0007871 3300048927 Bacteria 11228
275 Ga0496124_0013515 3300048927 Bacteria 7964
276 Ga0496124_0031690 3300048927 Bacteria 4677
277 Ga0496124_0032137 3300048927 Bacteria 4639
278 Ga0496124_0035076 3300048927 Bacteria 4392
279 Ga0496124_0059436 3300048927 Bacteria 3211
280 Ga0496124_0089024 3300048927 Bacteria 2521
281 Ga0496124_0098813 3300048927 Bacteria 2367
282 Ga0496124_0185669 3300048927 Bacteria 1596
283 Ga0496124_0323241 3300048927 Bacteria 1103
284 Ga0496124_0481712 3300048927 Bacteria 837
285 Ga0496125_0004566 3300048928 Bacteria 15872
286 Ga0496125_0010464 3300048928 Bacteria 9381
287 Ga0496125_0019279 3300048928 Bacteria 6441
288 Ga0496125_0024282 3300048928 Bacteria 5577
289 Ga0496125_0064276 3300048928 Bacteria 2917
290 Ga0496125_0081611 3300048928 Bacteria 2469
291 Ga0496125_0120306 3300048928 Bacteria 1875
292 Ga0496125_0126533 3300048928 Bacteria 1809
293 Ga0496125_0257711 3300048928 Bacteria 1095
294 Ga0496126_0000615 3300048929 Bacteria 67155
295 Ga0496126_0079330 3300048929 Bacteria 2906
296 Ga0496126_0089463 3300048929 Bacteria 2710
297 Ga0496126_0147636 3300048929 Bacteria 2018
298 Ga0496126_0159175 3300048929 Bacteria 1930
299 Ga0496126_0283644 3300048929 Bacteria 1371
300 Ga0496126_0297303 3300048929 Bacteria 1333
301 Ga0496126_0466155 3300048929 Bacteria 1014
302 Ga0496126_0786224 3300048929 Bacteria 731
303 Ga0501031_0141676 3300049568 Bacteria 1571
304 Ga0501032_0058345 3300049569 Bacteria 2591
305 Ga0501033_0097700 3300049570 Bacteria 2145
306 Ga0501033_0577058 3300049570 Bacteria 773
307 Ga0501034_0009760 3300049571 Bacteria 10038
308 Ga0501034_0089748 3300049571 Bacteria 3071
309 Ga0501034_0248390 3300049571 Bacteria 1724
310 Ga0501036_0024339 3300049572 Bacteria 5104
311 Ga0501037_0002234 3300049573 Bacteria 13985
312 Ga0501038_0093134 3300049574 Bacteria 2521
313 Ga0501039_0027982 3300049575 Bacteria 4336
314 Ga0501043_0058541 3300049579 Bacteria 3024
315 Ga0501047_0118801 3300049581 Bacteria 2526
316 Ga0501047_0145940 3300049581 Bacteria 2243
317 Ga0501067_0086723 3300049583 Bacteria 1737
318 Ga0501068_0173068 3300049584 Bacteria 1363
319 Ga0501070_0159866 3300049586 Bacteria 1857
320 Ga0501073_0088183 3300049589 Bacteria 2157
321 Ga0501080_0041422 3300049742 Bacteria 4291
322 Ga0501266_012302 3300049763 Bacteria 1103
323 Ga0501268_058500 3300049765 Bacteria 760
324 Ga0501035_0007446 3300049822 Bacteria 10222
325 Ga0501044_0013420 3300049823 Bacteria 8859
326 nmdc:mga00v17_220_c1 3300050491 Bacteria 34333
327 nmdc:mga06z11_154193_c1 3300050494 Bacteria 1308
328 Ga0500565_023490 3300053734 Bacteria 761
329 2547503706 2547132130 Bacteria 4660562
330 2643880276 2643221573 Bacteria 4784121
331 2643937773 2643221586 Bacteria 4446529
332 2644078678 2643221612 Bacteria 4361984
333 2644660852 2643221720 Bacteria 4694283
334 2644693455 2643221727 Bacteria 4415595
335 2644698932 2643221728 Bacteria 4797149
336 2747951091 2747842428 Bacteria 4689383
337 2816518293 2816332141 Bacteria 4436036
338 2894416819 2894414249 Bacteria 4405451
339 2961064734 2961064222 Bacteria 4749990
340 8002870377 8002869464 Bacteria 3588529
341 8021652084 8021648035 Bacteria 4772378
342 Ga0451791_0620522
343 JGI25150J39212_1001238
344 JGI25151J46595_10001145
345 JGI25153J46596_10000801
346 Ga0055537_1000614
347 Ga0055534_1002224
348 Ga0055528_1000407
349 Ga0055530_10003832
350 Ga0055531_10016524
351 Ga0055531_10025887
352 Ga0055531_10045501
353 Ga0065715_10115368
354 Ga0070658_10476019
355 Ga0070676_10087082
356 Ga0070670_100336692
357 Ga0070668_100067443
358 Ga0070668_100133310
359 Ga0070669_100132545
360 Ga0070659_100664313
361 Ga0070713_101295892
362 Ga0070678_100186582
363 Ga0070678_100565673
364 Ga0070662_100791139
365 Ga0070681_10253540
366 Ga0070681_11244420
367 Ga0068867_100109666
368 Ga0070679_100557893
369 Ga0070679_100683642
370 Ga0070672_100018344
371 Ga0070693_100626019
372 Ga0070665_100248758
373 Ga0070665_100286351
374 Ga0070665_100497730
375 Ga0070664_100330129
376 Ga0068854_100328891
377 Ga0068852_100265882
378 Ga0075364_10094995
379 Ga0068865_100498053
380 Ga0105251_10045884
381 Ga0105244_10222420
382 Ga0105243_10006142
383 Ga0105242_10091670
384 Ga0105248_10609204
385 Ga0105237_10114334
386 Ga0105249_10496318
387 Ga0105028_102637
388 Ga0157373_10029826
389 Ga0157373_10057501
390 Ga0157373_10310481
391 Ga0157371_10000509
392 Ga0157371_10015410
393 Ga0157371_10052021
394 Ga0157371_10244614
395 Ga0157370_10007416
396 Ga0157374_10037939
397 Ga0157375_10089880
398 Ga0157380_10291946
399 Ga0182008_10000278
400 Ga0182008_10111281
401 Ga0182006_1016598
402 Ga0182006_1054229
403 Ga0182006_1065502
404 Ga0182007_10000142
405 Ga0182005_1000949
406 Ga0182005_1004598
407 Ga0163161_10048283
408 Ga0163161_10490773
409 Ga0207425_1000074
410 Ga0209129_1000150
411 Ga0209565_1000050
412 Ga0209673_1000199
413 Ga0209675_1000007
414 Ga0209676_1000018
415 Ga0209676_1000052
416 Ga0209676_1000168
417 Ga0209676_1002688
418 Ga0209676_1006860
419 Ga0209025_1000048
420 Ga0209564_1000061
421 Ga0209758_1000056
422 Ga0209050_1000424
423 Ga0209256_1012803
424 Ga0209051_1006684
425 Ga0209257_1000035
426 Ga0209257_1000147
427 Ga0209257_1001575
428 Ga0209257_1002550
429 Ga0209257_1028849
430 Ga0207713_1002835
431 Ga0207713_1009452
432 Ga0207705_10453697
433 Ga0207660_10140914
434 Ga0207657_10094775
435 Ga0207649_10650602
436 Ga0207652_10730048
437 Ga0207652_11352533
438 Ga0207681_10015545
439 Ga0207659_10412998
440 Ga0207690_11089295
441 Ga0207686_10259667
442 Ga0207709_10000528
443 Ga0207709_10294210
444 Ga0207691_10001458
445 Ga0207689_10059172
446 Ga0207651_10019878
447 Ga0207651_10850638
448 Ga0207668_10001893
449 Ga0207668_10048923
450 Ga0207640_10304230
451 Ga0207639_11118576
452 Ga0207678_10427052
453 Ga0207648_10498161
454 Ga0207683_10226214
455 Ga0207698_10299234
456 Ga0209371_1000018
457 Ga0209371_1000025
458 Ga0268266_10070528
459 Ga0268266_10345610
460 Ga0268265_10233556
461 Ga0268256_1000016
462 Ga0268256_1000027
463 Ga0316177_1021239
464 Ga0316176_1187957
465 Ga0316183_1200043
466 Ga0316181_1182864
467 Ga0316181_1236527
468 Ga0307513_10000429
469 Ga0307513_10056679
470 Ga0307513_10202855
471 Ga0307408_101032481
472 Ga0307405_10573896
473 Ga0307413_10004572
474 Ga0307413_10307401
475 Ga0307410_10412496
476 Ga0307412_10006193
477 Ga0307412_10126036
478 Ga0307412_10285637
479 Ga0307412_10349593
480 Ga0307412_10436616
481 Ga0307412_10705147
482 Ga0307409_100799276
483 Ga0307416_100444640
484 Ga0307414_10001920
485 Ga0307414_10005966
486 Ga0307414_10027401
487 Ga0307414_10032052
488 Ga0307414_10052873
489 Ga0307414_10058974
490 Ga0307414_10107091
491 Ga0307414_10733052
492 Ga0307414_10733277
493 Ga0307414_11203492
494 Ga0307411_10119503
495 Ga0307411_10607084
496 Ga0395905_0215698
497 Ga0237819_00342
498 Ga0237819_08475
499 Ga0439436_0066004
500 Ga0451787_298182
501 Ga0451791_0148027
502 Ga0451791_0875784
503 Ga0451793_1271182
504 Ga0451797_0306184
505 Ga0451807_1225870
506 Ga0451807_1482133
507 Ga0451837_0098597
508 Ga0439433_0023270
509 Ga0439432_004645
510 Ga0439432_011817
511 Ga0439432_027734
512 Ga0439432_070121
513 Ga0439432_134892
514 Ga0439449_0007600
515 Ga0439449_0008011
516 Ga0439449_0013316
517 Ga0439449_0066421
518 Ga0439449_0094787
519 Ga0439462_0056851
520 Ga0450911_001224
521 Ga0450898_051003
522 Ga0450918_054696
523 Ga0450901_005562
524 Ga0495627_009559
525 Ga0495638_0014038
526 Ga0495638_0017139
527 Ga0495638_0186821
528 Ga0495606_0063498
529 Ga0495610_0259062
530 Ga0495616_0045764
531 Ga0495616_0105448
532 Ga0495616_0161073
533 Ga0495632_0036273
534 Ga0495643_0010376
535 Ga0495643_0119756
536 Ga0495663_0003339
537 Ga0495663_0010539
538 Ga0495663_0031097
539 Ga0495663_0242678
540 Ga0495598_0076785
541 Ga0495621_0115223
542 Ga0495633_0006335
543 Ga0495633_0012954
544 Ga0495625_0034860
545 Ga0495625_0039707
546 Ga0495625_0097775
547 Ga0495659_0068405
548 Ga0495671_0028925
549 Ga0495636_0019820
550 Ga0495636_0033365
551 Ga0495636_0043565
552 Ga0495636_0340820
553 Ga0495672_0000355
554 Ga0495685_049659
555 Ga0495681_0084704
556 Ga0495681_0142075
557 Ga0495686_0004495
558 Ga0495686_0064011
559 Ga0496104_0742574
560 Ga0496105_0037459
561 Ga0496105_0091462
562 Ga0496106_0492724
563 Ga0496108_0097760
564 Ga0496110_0536687
565 Ga0496113_0459970
566 Ga0496116_0001148
567 Ga0496116_0024995
568 Ga0496116_0057492
569 Ga0496116_0081070
570 Ga0496117_0001057
571 Ga0496117_0001116
572 Ga0496117_0007671
573 Ga0496117_0021620
574 Ga0496117_0025838
575 Ga0496117_0056315
576 Ga0496117_0092831
577 Ga0496117_0409206
578 Ga0496118_0000661
579 Ga0496118_0002647
580 Ga0496118_0026668
581 Ga0496118_0029136
582 Ga0496118_0030183
583 Ga0496118_0033662
584 Ga0496118_0049921
585 Ga0496118_0071499
586 Ga0496118_0115008
587 Ga0496118_0351328
588 Ga0496119_0001372
589 Ga0496119_0011845
590 Ga0496119_0022284
591 Ga0496119_0024230
592 Ga0496119_0081194
593 Ga0496120_0001351
594 Ga0496120_0005146
595 Ga0496120_0034525
596 Ga0496121_0003939
597 Ga0496121_0021726
598 Ga0496121_0038848
599 Ga0496121_0087225
600 Ga0496121_0233479
601 Ga0496122_0019452
602 Ga0496122_0030572
603 Ga0496122_0033055
604 Ga0496122_0043522
605 Ga0496122_0120078
606 Ga0496122_0212838
607 Ga0496123_0001263
608 Ga0496123_0028762
609 Ga0496123_0035638
610 Ga0496123_0067520
611 Ga0496123_0107612
612 Ga0496123_0144476
613 Ga0496123_0228033
614 Ga0496124_0002117
615 Ga0496124_0007871
616 Ga0496124_0013515
617 Ga0496124_0031690
618 Ga0496124_0032137
619 Ga0496124_0035076
620 Ga0496124_0059436
621 Ga0496124_0089024
622 Ga0496124_0098813
623 Ga0496124_0185669
624 Ga0496124_0323241
625 Ga0496124_0481712
626 Ga0496125_0004566
627 Ga0496125_0010464
628 Ga0496125_0019279
629 Ga0496125_0024282
630 Ga0496125_0064276
631 Ga0496125_0081611
632 Ga0496125_0120306
633 Ga0496125_0126533
634 Ga0496125_0257711
635 Ga0496126_0000615
636 Ga0496126_0079330
637 Ga0496126_0089463
638 Ga0496126_0147636
639 Ga0496126_0159175
640 Ga0496126_0283644
641 Ga0496126_0297303
642 Ga0496126_0466155
643 Ga0496126_0786224
644 Ga0501031_0141676
645 Ga0501032_0058345
646 Ga0501033_0097700
647 Ga0501033_0577058
648 Ga0501034_0009760
649 Ga0501034_0089748
650 Ga0501034_0248390
651 Ga0501036_0024339
652 Ga0501037_0002234
653 Ga0501038_0093134
654 Ga0501039_0027982
655 Ga0501043_0058541
656 Ga0501047_0118801
657 Ga0501047_0145940
658 Ga0501067_0086723
659 Ga0501068_0173068
660 Ga0501070_0159866
661 Ga0501073_0088183
662 Ga0501080_0041422
663 Ga0501266_012302
664 Ga0501268_058500
665 Ga0501035_0007446
666 Ga0501044_0013420
667 nmdc:mga00v17_220_c1
668 nmdc:mga06z11_154193_c1
669 Ga0500565_023490
670 2547503706
671 2643880276
672 2643937773
673 2644078678
674 2644660852
675 2644693455
676 2644698932
677 2747951091
678 2816518293
679 2894416819
680 2961064734
681 8002870377
682 8021652084

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

55

229

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.9255 6 184
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.9136 6 180
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.9078 6 183
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.9073 6 177
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.906 6 177
ID Description Score Start End Superfamily
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9215 6 184 3.90.870.10
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9197 6 177 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9123 6 184 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9016 6 186 3.90.870.10
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8873 6 184 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A0R0B037-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9963 1 186 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A6P1SFY5-F1-model_v4 deleted 0.9901 1 186
AF-Q3RCP1-F1-model_v4 deleted 0.99 2 185
AF-A0A840K0I6-F1-model_v4 deleted 0.9886 4 186
AF-A0A522XQB0-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9881 1 186 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710

Map