F414830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 341 | 188 | 682 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300041451|Ga0451791_0620522|Ga0451791_0620522_2247_2936 |
| Length | 229 |
| Sequence | LAGLKALGSRLRGNDDLEIFLARNVAVNRIFCRPKSMYDPLPMISPLLSIHEAATALQTGGVIAYPTEAVWGLGCDPRDEDAVLRLLAIKQRAVDKGLILIASHLDQLRPFLNLAAVPAGKLAEVLASWPGPHTWVMPASAAAPRWVTGAHDGIAVRISAHPLVIELCNAYGGALVSTSANRAGQPAAVTPETLDPVVLDGVDGLVAGETGGLSAPTAIRDALTGAAIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 89 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 90 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 91 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 92 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 104 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 105 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 107 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 108 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 110 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 111 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 112 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 113 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 114 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 115 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 116 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 117 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 118 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 138 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 139 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 143 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 144 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 145 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 146 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 147 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 148 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 149 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 150 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 151 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 152 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 170 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 171 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 176 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 177 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 178 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 179 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 180 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 181 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 182 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 183 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 184 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 185 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 186 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 187 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 188 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.19 |
| Metatranscriptomes | 0 |
| Isolates | 3.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.26 |
| Nodule | 0 |
| Rhizoplane | 4.4 |
| Rhizosphere | 57.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451791_0620522 | 3300041451 | Bacteria | 4101 |
| 2 | JGI25150J39212_1001238 | 3300002774 | Bacteria | 7429 |
| 3 | JGI25151J46595_10001145 | 3300003187 | Bacteria | 19226 |
| 4 | JGI25153J46596_10000801 | 3300003215 | Bacteria | 19226 |
| 5 | Ga0055537_1000614 | 3300003773 | Bacteria | 19575 |
| 6 | Ga0055534_1002224 | 3300003784 | Bacteria | 6876 |
| 7 | Ga0055528_1000407 | 3300003790 | Bacteria | 34812 |
| 8 | Ga0055530_10003832 | 3300003791 | Bacteria | 8252 |
| 9 | Ga0055531_10016524 | 3300003794 | Bacteria | 3178 |
| 10 | Ga0055531_10025887 | 3300003794 | Bacteria | 2113 |
| 11 | Ga0055531_10045501 | 3300003794 | Bacteria | 1217 |
| 12 | Ga0065715_10115368 | 3300005293 | Bacteria | 2417 |
| 13 | Ga0070658_10476019 | 3300005327 | Bacteria | 1077 |
| 14 | Ga0070676_10087082 | 3300005328 | Bacteria | 1906 |
| 15 | Ga0070670_100336692 | 3300005331 | Bacteria | 1324 |
| 16 | Ga0070668_100067443 | 3300005347 | Bacteria | 2779 |
| 17 | Ga0070668_100133310 | 3300005347 | Bacteria | 1995 |
| 18 | Ga0070669_100132545 | 3300005353 | Bacteria | 1914 |
| 19 | Ga0070659_100664313 | 3300005366 | Bacteria | 899 |
| 20 | Ga0070713_101295892 | 3300005436 | Bacteria | 706 |
| 21 | Ga0070678_100186582 | 3300005456 | Bacteria | 1702 |
| 22 | Ga0070678_100565673 | 3300005456 | Bacteria | 1011 |
| 23 | Ga0070662_100791139 | 3300005457 | Bacteria | 806 |
| 24 | Ga0070681_10253540 | 3300005458 | Bacteria | 1672 |
| 25 | Ga0070681_11244420 | 3300005458 | Bacteria | 667 |
| 26 | Ga0068867_100109666 | 3300005459 | Bacteria | 2119 |
| 27 | Ga0070679_100557893 | 3300005530 | Bacteria | 1089 |
| 28 | Ga0070679_100683642 | 3300005530 | Bacteria | 969 |
| 29 | Ga0070672_100018344 | 3300005543 | Bacteria | 5057 |
| 30 | Ga0070693_100626019 | 3300005547 | Bacteria | 780 |
| 31 | Ga0070665_100248758 | 3300005548 | Bacteria | 1778 |
| 32 | Ga0070665_100286351 | 3300005548 | Bacteria | 1650 |
| 33 | Ga0070665_100497730 | 3300005548 | Bacteria | 1230 |
| 34 | Ga0070664_100330129 | 3300005564 | Bacteria | 1383 |
| 35 | Ga0068854_100328891 | 3300005578 | Bacteria | 1245 |
| 36 | Ga0068852_100265882 | 3300005616 | Bacteria | 1649 |
| 37 | Ga0075364_10094995 | 3300006051 | Bacteria | 1981 |
| 38 | Ga0068865_100498053 | 3300006881 | Bacteria | 1015 |
| 39 | Ga0105251_10045884 | 3300009011 | Bacteria | 2105 |
| 40 | Ga0105244_10222420 | 3300009036 | Bacteria | 885 |
| 41 | Ga0105243_10006142 | 3300009148 | Bacteria | 9288 |
| 42 | Ga0105242_10091670 | 3300009176 | Bacteria | 2559 |
| 43 | Ga0105248_10609204 | 3300009177 | Bacteria | 1232 |
| 44 | Ga0105237_10114334 | 3300009545 | Bacteria | 2691 |
| 45 | Ga0105249_10496318 | 3300009553 | Bacteria | 1265 |
| 46 | Ga0105028_102637 | 3300009993 | Bacteria | 1879 |
| 47 | Ga0157373_10029826 | 3300013100 | Bacteria | 3927 |
| 48 | Ga0157373_10057501 | 3300013100 | Bacteria | 2758 |
| 49 | Ga0157373_10310481 | 3300013100 | Bacteria | 1120 |
| 50 | Ga0157371_10000509 | 3300013102 | Bacteria | 46826 |
| 51 | Ga0157371_10015410 | 3300013102 | Bacteria | 5735 |
| 52 | Ga0157371_10052021 | 3300013102 | Bacteria | 2909 |
| 53 | Ga0157371_10244614 | 3300013102 | Bacteria | 1291 |
| 54 | Ga0157370_10007416 | 3300013104 | Bacteria | 11942 |
| 55 | Ga0157374_10037939 | 3300013296 | Bacteria | 4426 |
| 56 | Ga0157375_10089880 | 3300013308 | Bacteria | 3128 |
| 57 | Ga0157380_10291946 | 3300014326 | Bacteria | 1497 |
| 58 | Ga0182008_10000278 | 3300014497 | Bacteria | 40186 |
| 59 | Ga0182008_10111281 | 3300014497 | Bacteria | 1357 |
| 60 | Ga0182006_1016598 | 3300015261 | Bacteria | 3139 |
| 61 | Ga0182006_1054229 | 3300015261 | Bacteria | 1535 |
| 62 | Ga0182006_1065502 | 3300015261 | Bacteria | 1360 |
| 63 | Ga0182007_10000142 | 3300015262 | Bacteria | 47856 |
| 64 | Ga0182005_1000949 | 3300015265 | Bacteria | 12655 |
| 65 | Ga0182005_1004598 | 3300015265 | Bacteria | 4430 |
| 66 | Ga0163161_10048283 | 3300017792 | Bacteria | 3074 |
| 67 | Ga0163161_10490773 | 3300017792 | Bacteria | 999 |
| 68 | Ga0207425_1000074 | 3300025245 | Bacteria | 108738 |
| 69 | Ga0209129_1000150 | 3300025258 | Bacteria | 113886 |
| 70 | Ga0209565_1000050 | 3300025263 | Bacteria | 213856 |
| 71 | Ga0209673_1000199 | 3300025273 | Bacteria | 120904 |
| 72 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 73 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 74 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 75 | Ga0209676_1000168 | 3300025292 | Bacteria | 156042 |
| 76 | Ga0209676_1002688 | 3300025292 | Bacteria | 12028 |
| 77 | Ga0209676_1006860 | 3300025292 | Bacteria | 5513 |
| 78 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 79 | Ga0209564_1000061 | 3300025295 | Bacteria | 322795 |
| 80 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 81 | Ga0209050_1000424 | 3300025298 | Bacteria | 77803 |
| 82 | Ga0209256_1012803 | 3300025299 | Bacteria | 3172 |
| 83 | Ga0209051_1006684 | 3300025303 | Bacteria | 6450 |
| 84 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 85 | Ga0209257_1000147 | 3300025304 | Bacteria | 194105 |
| 86 | Ga0209257_1001575 | 3300025304 | Bacteria | 26306 |
| 87 | Ga0209257_1002550 | 3300025304 | Bacteria | 17783 |
| 88 | Ga0209257_1028849 | 3300025304 | Bacteria | 1820 |
| 89 | Ga0207713_1002835 | 3300025735 | Bacteria | 12196 |
| 90 | Ga0207713_1009452 | 3300025735 | Bacteria | 5492 |
| 91 | Ga0207705_10453697 | 3300025909 | Bacteria | 994 |
| 92 | Ga0207660_10140914 | 3300025917 | Bacteria | 1843 |
| 93 | Ga0207657_10094775 | 3300025919 | Bacteria | 2485 |
| 94 | Ga0207649_10650602 | 3300025920 | Bacteria | 814 |
| 95 | Ga0207652_10730048 | 3300025921 | Bacteria | 883 |
| 96 | Ga0207652_11352533 | 3300025921 | Bacteria | 615 |
| 97 | Ga0207681_10015545 | 3300025923 | Bacteria | 4749 |
| 98 | Ga0207659_10412998 | 3300025926 | Bacteria | 1131 |
| 99 | Ga0207690_11089295 | 3300025932 | Bacteria | 666 |
| 100 | Ga0207686_10259667 | 3300025934 | Bacteria | 1273 |
| 101 | Ga0207709_10000528 | 3300025935 | Bacteria | 33221 |
| 102 | Ga0207709_10294210 | 3300025935 | Bacteria | 1205 |
| 103 | Ga0207691_10001458 | 3300025940 | Bacteria | 23567 |
| 104 | Ga0207689_10059172 | 3300025942 | Bacteria | 3152 |
| 105 | Ga0207651_10019878 | 3300025960 | Bacteria | 4038 |
| 106 | Ga0207651_10850638 | 3300025960 | Bacteria | 811 |
| 107 | Ga0207668_10001893 | 3300025972 | Bacteria | 12254 |
| 108 | Ga0207668_10048923 | 3300025972 | Bacteria | 2903 |
| 109 | Ga0207640_10304230 | 3300025981 | Bacteria | 1263 |
| 110 | Ga0207639_11118576 | 3300026041 | Bacteria | 739 |
| 111 | Ga0207678_10427052 | 3300026067 | Bacteria | 1150 |
| 112 | Ga0207648_10498161 | 3300026089 | Bacteria | 1114 |
| 113 | Ga0207683_10226214 | 3300026121 | Bacteria | 1705 |
| 114 | Ga0207698_10299234 | 3300026142 | Bacteria | 1497 |
| 115 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 116 | Ga0209371_1000025 | 3300027312 | Bacteria | 450640 |
| 117 | Ga0268266_10070528 | 3300028379 | Bacteria | 3028 |
| 118 | Ga0268266_10345610 | 3300028379 | Bacteria | 1397 |
| 119 | Ga0268265_10233556 | 3300028380 | Bacteria | 1618 |
| 120 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 121 | Ga0268256_1000027 | 3300030500 | Bacteria | 450640 |
| 122 | Ga0316177_1021239 | 3300030731 | Bacteria | 2638 |
| 123 | Ga0316176_1187957 | 3300030732 | Bacteria | 5135 |
| 124 | Ga0316183_1200043 | 3300030742 | Bacteria | 6242 |
| 125 | Ga0316181_1182864 | 3300030744 | Bacteria | 1052 |
| 126 | Ga0316181_1236527 | 3300030744 | Bacteria | 1845 |
| 127 | Ga0307513_10000429 | 3300031456 | Bacteria | 60815 |
| 128 | Ga0307513_10056679 | 3300031456 | Bacteria | 4181 |
| 129 | Ga0307513_10202855 | 3300031456 | Bacteria | 1822 |
| 130 | Ga0307408_101032481 | 3300031548 | Bacteria | 759 |
| 131 | Ga0307405_10573896 | 3300031731 | Bacteria | 916 |
| 132 | Ga0307413_10004572 | 3300031824 | Bacteria | 6044 |
| 133 | Ga0307413_10307401 | 3300031824 | Bacteria | 1205 |
| 134 | Ga0307410_10412496 | 3300031852 | Bacteria | 1094 |
| 135 | Ga0307412_10006193 | 3300031911 | Bacteria | 6746 |
| 136 | Ga0307412_10126036 | 3300031911 | Bacteria | 1852 |
| 137 | Ga0307412_10285637 | 3300031911 | Bacteria | 1297 |
| 138 | Ga0307412_10349593 | 3300031911 | Bacteria | 1186 |
| 139 | Ga0307412_10436616 | 3300031911 | Bacteria | 1075 |
| 140 | Ga0307412_10705147 | 3300031911 | Bacteria | 867 |
| 141 | Ga0307409_100799276 | 3300031995 | Bacteria | 951 |
| 142 | Ga0307416_100444640 | 3300032002 | Bacteria | 1347 |
| 143 | Ga0307414_10001920 | 3300032004 | Bacteria | 10757 |
| 144 | Ga0307414_10005966 | 3300032004 | Bacteria | 6747 |
| 145 | Ga0307414_10027401 | 3300032004 | Bacteria | 3682 |
| 146 | Ga0307414_10032052 | 3300032004 | Bacteria | 3456 |
| 147 | Ga0307414_10052873 | 3300032004 | Bacteria | 2830 |
| 148 | Ga0307414_10058974 | 3300032004 | Bacteria | 2707 |
| 149 | Ga0307414_10107091 | 3300032004 | Bacteria | 2117 |
| 150 | Ga0307414_10733052 | 3300032004 | Bacteria | 897 |
| 151 | Ga0307414_10733277 | 3300032004 | Bacteria | 897 |
| 152 | Ga0307414_11203492 | 3300032004 | Bacteria | 701 |
| 153 | Ga0307411_10119503 | 3300032005 | Bacteria | 1904 |
| 154 | Ga0307411_10607084 | 3300032005 | Bacteria | 941 |
| 155 | Ga0395905_0215698 | 3300037471 | Bacteria | 1797 |
| 156 | Ga0237819_00342 | 3300038705 | Bacteria | 16972 |
| 157 | Ga0237819_08475 | 3300038705 | Bacteria | 1422 |
| 158 | Ga0439436_0066004 | 3300041404 | Bacteria | 1010 |
| 159 | Ga0451787_298182 | 3300041441 | Bacteria | 758 |
| 160 | Ga0451791_0148027 | 3300041451 | Bacteria | 1807 |
| 161 | Ga0451791_0875784 | 3300041451 | Bacteria | 2509 |
| 162 | Ga0451793_1271182 | 3300041452 | Bacteria | 927 |
| 163 | Ga0451797_0306184 | 3300041453 | Bacteria | 1056 |
| 164 | Ga0451807_1225870 | 3300041486 | Bacteria | 1301 |
| 165 | Ga0451807_1482133 | 3300041486 | Bacteria | 1863 |
| 166 | Ga0451837_0098597 | 3300041494 | Bacteria | 718 |
| 167 | Ga0439433_0023270 | 3300041999 | Bacteria | 1393 |
| 168 | Ga0439432_004645 | 3300042006 | Bacteria | 5002 |
| 169 | Ga0439432_011817 | 3300042006 | Bacteria | 3000 |
| 170 | Ga0439432_027734 | 3300042006 | Bacteria | 1847 |
| 171 | Ga0439432_070121 | 3300042006 | Bacteria | 1070 |
| 172 | Ga0439432_134892 | 3300042006 | Bacteria | 727 |
| 173 | Ga0439449_0007600 | 3300042007 | Bacteria | 4119 |
| 174 | Ga0439449_0008011 | 3300042007 | Bacteria | 4012 |
| 175 | Ga0439449_0013316 | 3300042007 | Bacteria | 3094 |
| 176 | Ga0439449_0066421 | 3300042007 | Bacteria | 1330 |
| 177 | Ga0439449_0094787 | 3300042007 | Bacteria | 1102 |
| 178 | Ga0439462_0056851 | 3300042015 | Bacteria | 1056 |
| 179 | Ga0450911_001224 | 3300042115 | Bacteria | 6227 |
| 180 | Ga0450898_051003 | 3300042134 | Bacteria | 800 |
| 181 | Ga0450918_054696 | 3300042531 | Bacteria | 731 |
| 182 | Ga0450901_005562 | 3300042533 | Bacteria | 1293 |
| 183 | Ga0495627_009559 | 3300046453 | Bacteria | 3563 |
| 184 | Ga0495638_0014038 | 3300046460 | Bacteria | 5428 |
| 185 | Ga0495638_0017139 | 3300046460 | Bacteria | 4836 |
| 186 | Ga0495638_0186821 | 3300046460 | Bacteria | 1178 |
| 187 | Ga0495606_0063498 | 3300046507 | Bacteria | 2354 |
| 188 | Ga0495610_0259062 | 3300046512 | Bacteria | 686 |
| 189 | Ga0495616_0045764 | 3300046513 | Bacteria | 2213 |
| 190 | Ga0495616_0105448 | 3300046513 | Bacteria | 1316 |
| 191 | Ga0495616_0161073 | 3300046513 | Bacteria | 1009 |
| 192 | Ga0495632_0036273 | 3300046519 | Bacteria | 2509 |
| 193 | Ga0495643_0010376 | 3300046522 | Bacteria | 5734 |
| 194 | Ga0495643_0119756 | 3300046522 | Bacteria | 1331 |
| 195 | Ga0495663_0003339 | 3300046525 | Bacteria | 4646 |
| 196 | Ga0495663_0010539 | 3300046525 | Bacteria | 2572 |
| 197 | Ga0495663_0031097 | 3300046525 | Bacteria | 1584 |
| 198 | Ga0495663_0242678 | 3300046525 | Bacteria | 638 |
| 199 | Ga0495598_0076785 | 3300046537 | Bacteria | 1064 |
| 200 | Ga0495621_0115223 | 3300046539 | Bacteria | 1034 |
| 201 | Ga0495633_0006335 | 3300046558 | Bacteria | 7038 |
| 202 | Ga0495633_0012954 | 3300046558 | Bacteria | 4412 |
| 203 | Ga0495625_0034860 | 3300046660 | Bacteria | 3711 |
| 204 | Ga0495625_0039707 | 3300046660 | Bacteria | 3435 |
| 205 | Ga0495625_0097775 | 3300046660 | Bacteria | 2020 |
| 206 | Ga0495659_0068405 | 3300046664 | Bacteria | 1326 |
| 207 | Ga0495671_0028925 | 3300046692 | Bacteria | 2851 |
| 208 | Ga0495636_0019820 | 3300047318 | Bacteria | 2705 |
| 209 | Ga0495636_0033365 | 3300047318 | Bacteria | 2114 |
| 210 | Ga0495636_0043565 | 3300047318 | Bacteria | 1867 |
| 211 | Ga0495636_0340820 | 3300047318 | Bacteria | 706 |
| 212 | Ga0495672_0000355 | 3300047320 | Bacteria | 58647 |
| 213 | Ga0495685_049659 | 3300047447 | Bacteria | 1424 |
| 214 | Ga0495681_0084704 | 3300047470 | Bacteria | 1409 |
| 215 | Ga0495681_0142075 | 3300047470 | Bacteria | 1013 |
| 216 | Ga0495686_0004495 | 3300047472 | Bacteria | 11464 |
| 217 | Ga0495686_0064011 | 3300047472 | Bacteria | 2277 |
| 218 | Ga0496104_0742574 | 3300048907 | Bacteria | 889 |
| 219 | Ga0496105_0037459 | 3300048908 | Bacteria | 3993 |
| 220 | Ga0496105_0091462 | 3300048908 | Bacteria | 2512 |
| 221 | Ga0496106_0492724 | 3300048909 | Bacteria | 984 |
| 222 | Ga0496108_0097760 | 3300048911 | Bacteria | 2502 |
| 223 | Ga0496110_0536687 | 3300048913 | Bacteria | 1064 |
| 224 | Ga0496113_0459970 | 3300048916 | Bacteria | 1022 |
| 225 | Ga0496116_0001148 | 3300048919 | Bacteria | 31389 |
| 226 | Ga0496116_0024995 | 3300048919 | Bacteria | 4401 |
| 227 | Ga0496116_0057492 | 3300048919 | Bacteria | 2542 |
| 228 | Ga0496116_0081070 | 3300048919 | Bacteria | 2013 |
| 229 | Ga0496117_0001057 | 3300048920 | Bacteria | 42009 |
| 230 | Ga0496117_0001116 | 3300048920 | Bacteria | 40487 |
| 231 | Ga0496117_0007671 | 3300048920 | Bacteria | 10454 |
| 232 | Ga0496117_0021620 | 3300048920 | Bacteria | 5197 |
| 233 | Ga0496117_0025838 | 3300048920 | Bacteria | 4605 |
| 234 | Ga0496117_0056315 | 3300048920 | Bacteria | 2739 |
| 235 | Ga0496117_0092831 | 3300048920 | Bacteria | 1937 |
| 236 | Ga0496117_0409206 | 3300048920 | Bacteria | 682 |
| 237 | Ga0496118_0000661 | 3300048921 | Bacteria | 56425 |
| 238 | Ga0496118_0002647 | 3300048921 | Bacteria | 23718 |
| 239 | Ga0496118_0026668 | 3300048921 | Bacteria | 4913 |
| 240 | Ga0496118_0029136 | 3300048921 | Bacteria | 4636 |
| 241 | Ga0496118_0030183 | 3300048921 | Bacteria | 4530 |
| 242 | Ga0496118_0033662 | 3300048921 | Bacteria | 4199 |
| 243 | Ga0496118_0049921 | 3300048921 | Bacteria | 3217 |
| 244 | Ga0496118_0071499 | 3300048921 | Bacteria | 2497 |
| 245 | Ga0496118_0115008 | 3300048921 | Bacteria | 1772 |
| 246 | Ga0496118_0351328 | 3300048921 | Bacteria | 785 |
| 247 | Ga0496119_0001372 | 3300048922 | Bacteria | 29711 |
| 248 | Ga0496119_0011845 | 3300048922 | Bacteria | 7161 |
| 249 | Ga0496119_0022284 | 3300048922 | Bacteria | 4542 |
| 250 | Ga0496119_0024230 | 3300048922 | Bacteria | 4272 |
| 251 | Ga0496119_0081194 | 3300048922 | Bacteria | 1868 |
| 252 | Ga0496120_0001351 | 3300048923 | Bacteria | 30172 |
| 253 | Ga0496120_0005146 | 3300048923 | Bacteria | 10567 |
| 254 | Ga0496120_0034525 | 3300048923 | Bacteria | 3029 |
| 255 | Ga0496121_0003939 | 3300048924 | Bacteria | 20555 |
| 256 | Ga0496121_0021726 | 3300048924 | Bacteria | 6270 |
| 257 | Ga0496121_0038848 | 3300048924 | Bacteria | 4206 |
| 258 | Ga0496121_0087225 | 3300048924 | Bacteria | 2450 |
| 259 | Ga0496121_0233479 | 3300048924 | Bacteria | 1286 |
| 260 | Ga0496122_0019452 | 3300048925 | Bacteria | 6201 |
| 261 | Ga0496122_0030572 | 3300048925 | Bacteria | 4509 |
| 262 | Ga0496122_0033055 | 3300048925 | Bacteria | 4262 |
| 263 | Ga0496122_0043522 | 3300048925 | Bacteria | 3516 |
| 264 | Ga0496122_0120078 | 3300048925 | Bacteria | 1697 |
| 265 | Ga0496122_0212838 | 3300048925 | Bacteria | 1117 |
| 266 | Ga0496123_0001263 | 3300048926 | Bacteria | 36324 |
| 267 | Ga0496123_0028762 | 3300048926 | Bacteria | 4108 |
| 268 | Ga0496123_0035638 | 3300048926 | Bacteria | 3542 |
| 269 | Ga0496123_0067520 | 3300048926 | Bacteria | 2258 |
| 270 | Ga0496123_0107612 | 3300048926 | Bacteria | 1603 |
| 271 | Ga0496123_0144476 | 3300048926 | Bacteria | 1294 |
| 272 | Ga0496123_0228033 | 3300048926 | Bacteria | 934 |
| 273 | Ga0496124_0002117 | 3300048927 | Bacteria | 26727 |
| 274 | Ga0496124_0007871 | 3300048927 | Bacteria | 11228 |
| 275 | Ga0496124_0013515 | 3300048927 | Bacteria | 7964 |
| 276 | Ga0496124_0031690 | 3300048927 | Bacteria | 4677 |
| 277 | Ga0496124_0032137 | 3300048927 | Bacteria | 4639 |
| 278 | Ga0496124_0035076 | 3300048927 | Bacteria | 4392 |
| 279 | Ga0496124_0059436 | 3300048927 | Bacteria | 3211 |
| 280 | Ga0496124_0089024 | 3300048927 | Bacteria | 2521 |
| 281 | Ga0496124_0098813 | 3300048927 | Bacteria | 2367 |
| 282 | Ga0496124_0185669 | 3300048927 | Bacteria | 1596 |
| 283 | Ga0496124_0323241 | 3300048927 | Bacteria | 1103 |
| 284 | Ga0496124_0481712 | 3300048927 | Bacteria | 837 |
| 285 | Ga0496125_0004566 | 3300048928 | Bacteria | 15872 |
| 286 | Ga0496125_0010464 | 3300048928 | Bacteria | 9381 |
| 287 | Ga0496125_0019279 | 3300048928 | Bacteria | 6441 |
| 288 | Ga0496125_0024282 | 3300048928 | Bacteria | 5577 |
| 289 | Ga0496125_0064276 | 3300048928 | Bacteria | 2917 |
| 290 | Ga0496125_0081611 | 3300048928 | Bacteria | 2469 |
| 291 | Ga0496125_0120306 | 3300048928 | Bacteria | 1875 |
| 292 | Ga0496125_0126533 | 3300048928 | Bacteria | 1809 |
| 293 | Ga0496125_0257711 | 3300048928 | Bacteria | 1095 |
| 294 | Ga0496126_0000615 | 3300048929 | Bacteria | 67155 |
| 295 | Ga0496126_0079330 | 3300048929 | Bacteria | 2906 |
| 296 | Ga0496126_0089463 | 3300048929 | Bacteria | 2710 |
| 297 | Ga0496126_0147636 | 3300048929 | Bacteria | 2018 |
| 298 | Ga0496126_0159175 | 3300048929 | Bacteria | 1930 |
| 299 | Ga0496126_0283644 | 3300048929 | Bacteria | 1371 |
| 300 | Ga0496126_0297303 | 3300048929 | Bacteria | 1333 |
| 301 | Ga0496126_0466155 | 3300048929 | Bacteria | 1014 |
| 302 | Ga0496126_0786224 | 3300048929 | Bacteria | 731 |
| 303 | Ga0501031_0141676 | 3300049568 | Bacteria | 1571 |
| 304 | Ga0501032_0058345 | 3300049569 | Bacteria | 2591 |
| 305 | Ga0501033_0097700 | 3300049570 | Bacteria | 2145 |
| 306 | Ga0501033_0577058 | 3300049570 | Bacteria | 773 |
| 307 | Ga0501034_0009760 | 3300049571 | Bacteria | 10038 |
| 308 | Ga0501034_0089748 | 3300049571 | Bacteria | 3071 |
| 309 | Ga0501034_0248390 | 3300049571 | Bacteria | 1724 |
| 310 | Ga0501036_0024339 | 3300049572 | Bacteria | 5104 |
| 311 | Ga0501037_0002234 | 3300049573 | Bacteria | 13985 |
| 312 | Ga0501038_0093134 | 3300049574 | Bacteria | 2521 |
| 313 | Ga0501039_0027982 | 3300049575 | Bacteria | 4336 |
| 314 | Ga0501043_0058541 | 3300049579 | Bacteria | 3024 |
| 315 | Ga0501047_0118801 | 3300049581 | Bacteria | 2526 |
| 316 | Ga0501047_0145940 | 3300049581 | Bacteria | 2243 |
| 317 | Ga0501067_0086723 | 3300049583 | Bacteria | 1737 |
| 318 | Ga0501068_0173068 | 3300049584 | Bacteria | 1363 |
| 319 | Ga0501070_0159866 | 3300049586 | Bacteria | 1857 |
| 320 | Ga0501073_0088183 | 3300049589 | Bacteria | 2157 |
| 321 | Ga0501080_0041422 | 3300049742 | Bacteria | 4291 |
| 322 | Ga0501266_012302 | 3300049763 | Bacteria | 1103 |
| 323 | Ga0501268_058500 | 3300049765 | Bacteria | 760 |
| 324 | Ga0501035_0007446 | 3300049822 | Bacteria | 10222 |
| 325 | Ga0501044_0013420 | 3300049823 | Bacteria | 8859 |
| 326 | nmdc:mga00v17_220_c1 | 3300050491 | Bacteria | 34333 |
| 327 | nmdc:mga06z11_154193_c1 | 3300050494 | Bacteria | 1308 |
| 328 | Ga0500565_023490 | 3300053734 | Bacteria | 761 |
| 329 | 2547503706 | 2547132130 | Bacteria | 4660562 |
| 330 | 2643880276 | 2643221573 | Bacteria | 4784121 |
| 331 | 2643937773 | 2643221586 | Bacteria | 4446529 |
| 332 | 2644078678 | 2643221612 | Bacteria | 4361984 |
| 333 | 2644660852 | 2643221720 | Bacteria | 4694283 |
| 334 | 2644693455 | 2643221727 | Bacteria | 4415595 |
| 335 | 2644698932 | 2643221728 | Bacteria | 4797149 |
| 336 | 2747951091 | 2747842428 | Bacteria | 4689383 |
| 337 | 2816518293 | 2816332141 | Bacteria | 4436036 |
| 338 | 2894416819 | 2894414249 | Bacteria | 4405451 |
| 339 | 2961064734 | 2961064222 | Bacteria | 4749990 |
| 340 | 8002870377 | 8002869464 | Bacteria | 3588529 |
| 341 | 8021652084 | 8021648035 | Bacteria | 4772378 |
| 342 | Ga0451791_0620522 | |||
| 343 | JGI25150J39212_1001238 | |||
| 344 | JGI25151J46595_10001145 | |||
| 345 | JGI25153J46596_10000801 | |||
| 346 | Ga0055537_1000614 | |||
| 347 | Ga0055534_1002224 | |||
| 348 | Ga0055528_1000407 | |||
| 349 | Ga0055530_10003832 | |||
| 350 | Ga0055531_10016524 | |||
| 351 | Ga0055531_10025887 | |||
| 352 | Ga0055531_10045501 | |||
| 353 | Ga0065715_10115368 | |||
| 354 | Ga0070658_10476019 | |||
| 355 | Ga0070676_10087082 | |||
| 356 | Ga0070670_100336692 | |||
| 357 | Ga0070668_100067443 | |||
| 358 | Ga0070668_100133310 | |||
| 359 | Ga0070669_100132545 | |||
| 360 | Ga0070659_100664313 | |||
| 361 | Ga0070713_101295892 | |||
| 362 | Ga0070678_100186582 | |||
| 363 | Ga0070678_100565673 | |||
| 364 | Ga0070662_100791139 | |||
| 365 | Ga0070681_10253540 | |||
| 366 | Ga0070681_11244420 | |||
| 367 | Ga0068867_100109666 | |||
| 368 | Ga0070679_100557893 | |||
| 369 | Ga0070679_100683642 | |||
| 370 | Ga0070672_100018344 | |||
| 371 | Ga0070693_100626019 | |||
| 372 | Ga0070665_100248758 | |||
| 373 | Ga0070665_100286351 | |||
| 374 | Ga0070665_100497730 | |||
| 375 | Ga0070664_100330129 | |||
| 376 | Ga0068854_100328891 | |||
| 377 | Ga0068852_100265882 | |||
| 378 | Ga0075364_10094995 | |||
| 379 | Ga0068865_100498053 | |||
| 380 | Ga0105251_10045884 | |||
| 381 | Ga0105244_10222420 | |||
| 382 | Ga0105243_10006142 | |||
| 383 | Ga0105242_10091670 | |||
| 384 | Ga0105248_10609204 | |||
| 385 | Ga0105237_10114334 | |||
| 386 | Ga0105249_10496318 | |||
| 387 | Ga0105028_102637 | |||
| 388 | Ga0157373_10029826 | |||
| 389 | Ga0157373_10057501 | |||
| 390 | Ga0157373_10310481 | |||
| 391 | Ga0157371_10000509 | |||
| 392 | Ga0157371_10015410 | |||
| 393 | Ga0157371_10052021 | |||
| 394 | Ga0157371_10244614 | |||
| 395 | Ga0157370_10007416 | |||
| 396 | Ga0157374_10037939 | |||
| 397 | Ga0157375_10089880 | |||
| 398 | Ga0157380_10291946 | |||
| 399 | Ga0182008_10000278 | |||
| 400 | Ga0182008_10111281 | |||
| 401 | Ga0182006_1016598 | |||
| 402 | Ga0182006_1054229 | |||
| 403 | Ga0182006_1065502 | |||
| 404 | Ga0182007_10000142 | |||
| 405 | Ga0182005_1000949 | |||
| 406 | Ga0182005_1004598 | |||
| 407 | Ga0163161_10048283 | |||
| 408 | Ga0163161_10490773 | |||
| 409 | Ga0207425_1000074 | |||
| 410 | Ga0209129_1000150 | |||
| 411 | Ga0209565_1000050 | |||
| 412 | Ga0209673_1000199 | |||
| 413 | Ga0209675_1000007 | |||
| 414 | Ga0209676_1000018 | |||
| 415 | Ga0209676_1000052 | |||
| 416 | Ga0209676_1000168 | |||
| 417 | Ga0209676_1002688 | |||
| 418 | Ga0209676_1006860 | |||
| 419 | Ga0209025_1000048 | |||
| 420 | Ga0209564_1000061 | |||
| 421 | Ga0209758_1000056 | |||
| 422 | Ga0209050_1000424 | |||
| 423 | Ga0209256_1012803 | |||
| 424 | Ga0209051_1006684 | |||
| 425 | Ga0209257_1000035 | |||
| 426 | Ga0209257_1000147 | |||
| 427 | Ga0209257_1001575 | |||
| 428 | Ga0209257_1002550 | |||
| 429 | Ga0209257_1028849 | |||
| 430 | Ga0207713_1002835 | |||
| 431 | Ga0207713_1009452 | |||
| 432 | Ga0207705_10453697 | |||
| 433 | Ga0207660_10140914 | |||
| 434 | Ga0207657_10094775 | |||
| 435 | Ga0207649_10650602 | |||
| 436 | Ga0207652_10730048 | |||
| 437 | Ga0207652_11352533 | |||
| 438 | Ga0207681_10015545 | |||
| 439 | Ga0207659_10412998 | |||
| 440 | Ga0207690_11089295 | |||
| 441 | Ga0207686_10259667 | |||
| 442 | Ga0207709_10000528 | |||
| 443 | Ga0207709_10294210 | |||
| 444 | Ga0207691_10001458 | |||
| 445 | Ga0207689_10059172 | |||
| 446 | Ga0207651_10019878 | |||
| 447 | Ga0207651_10850638 | |||
| 448 | Ga0207668_10001893 | |||
| 449 | Ga0207668_10048923 | |||
| 450 | Ga0207640_10304230 | |||
| 451 | Ga0207639_11118576 | |||
| 452 | Ga0207678_10427052 | |||
| 453 | Ga0207648_10498161 | |||
| 454 | Ga0207683_10226214 | |||
| 455 | Ga0207698_10299234 | |||
| 456 | Ga0209371_1000018 | |||
| 457 | Ga0209371_1000025 | |||
| 458 | Ga0268266_10070528 | |||
| 459 | Ga0268266_10345610 | |||
| 460 | Ga0268265_10233556 | |||
| 461 | Ga0268256_1000016 | |||
| 462 | Ga0268256_1000027 | |||
| 463 | Ga0316177_1021239 | |||
| 464 | Ga0316176_1187957 | |||
| 465 | Ga0316183_1200043 | |||
| 466 | Ga0316181_1182864 | |||
| 467 | Ga0316181_1236527 | |||
| 468 | Ga0307513_10000429 | |||
| 469 | Ga0307513_10056679 | |||
| 470 | Ga0307513_10202855 | |||
| 471 | Ga0307408_101032481 | |||
| 472 | Ga0307405_10573896 | |||
| 473 | Ga0307413_10004572 | |||
| 474 | Ga0307413_10307401 | |||
| 475 | Ga0307410_10412496 | |||
| 476 | Ga0307412_10006193 | |||
| 477 | Ga0307412_10126036 | |||
| 478 | Ga0307412_10285637 | |||
| 479 | Ga0307412_10349593 | |||
| 480 | Ga0307412_10436616 | |||
| 481 | Ga0307412_10705147 | |||
| 482 | Ga0307409_100799276 | |||
| 483 | Ga0307416_100444640 | |||
| 484 | Ga0307414_10001920 | |||
| 485 | Ga0307414_10005966 | |||
| 486 | Ga0307414_10027401 | |||
| 487 | Ga0307414_10032052 | |||
| 488 | Ga0307414_10052873 | |||
| 489 | Ga0307414_10058974 | |||
| 490 | Ga0307414_10107091 | |||
| 491 | Ga0307414_10733052 | |||
| 492 | Ga0307414_10733277 | |||
| 493 | Ga0307414_11203492 | |||
| 494 | Ga0307411_10119503 | |||
| 495 | Ga0307411_10607084 | |||
| 496 | Ga0395905_0215698 | |||
| 497 | Ga0237819_00342 | |||
| 498 | Ga0237819_08475 | |||
| 499 | Ga0439436_0066004 | |||
| 500 | Ga0451787_298182 | |||
| 501 | Ga0451791_0148027 | |||
| 502 | Ga0451791_0875784 | |||
| 503 | Ga0451793_1271182 | |||
| 504 | Ga0451797_0306184 | |||
| 505 | Ga0451807_1225870 | |||
| 506 | Ga0451807_1482133 | |||
| 507 | Ga0451837_0098597 | |||
| 508 | Ga0439433_0023270 | |||
| 509 | Ga0439432_004645 | |||
| 510 | Ga0439432_011817 | |||
| 511 | Ga0439432_027734 | |||
| 512 | Ga0439432_070121 | |||
| 513 | Ga0439432_134892 | |||
| 514 | Ga0439449_0007600 | |||
| 515 | Ga0439449_0008011 | |||
| 516 | Ga0439449_0013316 | |||
| 517 | Ga0439449_0066421 | |||
| 518 | Ga0439449_0094787 | |||
| 519 | Ga0439462_0056851 | |||
| 520 | Ga0450911_001224 | |||
| 521 | Ga0450898_051003 | |||
| 522 | Ga0450918_054696 | |||
| 523 | Ga0450901_005562 | |||
| 524 | Ga0495627_009559 | |||
| 525 | Ga0495638_0014038 | |||
| 526 | Ga0495638_0017139 | |||
| 527 | Ga0495638_0186821 | |||
| 528 | Ga0495606_0063498 | |||
| 529 | Ga0495610_0259062 | |||
| 530 | Ga0495616_0045764 | |||
| 531 | Ga0495616_0105448 | |||
| 532 | Ga0495616_0161073 | |||
| 533 | Ga0495632_0036273 | |||
| 534 | Ga0495643_0010376 | |||
| 535 | Ga0495643_0119756 | |||
| 536 | Ga0495663_0003339 | |||
| 537 | Ga0495663_0010539 | |||
| 538 | Ga0495663_0031097 | |||
| 539 | Ga0495663_0242678 | |||
| 540 | Ga0495598_0076785 | |||
| 541 | Ga0495621_0115223 | |||
| 542 | Ga0495633_0006335 | |||
| 543 | Ga0495633_0012954 | |||
| 544 | Ga0495625_0034860 | |||
| 545 | Ga0495625_0039707 | |||
| 546 | Ga0495625_0097775 | |||
| 547 | Ga0495659_0068405 | |||
| 548 | Ga0495671_0028925 | |||
| 549 | Ga0495636_0019820 | |||
| 550 | Ga0495636_0033365 | |||
| 551 | Ga0495636_0043565 | |||
| 552 | Ga0495636_0340820 | |||
| 553 | Ga0495672_0000355 | |||
| 554 | Ga0495685_049659 | |||
| 555 | Ga0495681_0084704 | |||
| 556 | Ga0495681_0142075 | |||
| 557 | Ga0495686_0004495 | |||
| 558 | Ga0495686_0064011 | |||
| 559 | Ga0496104_0742574 | |||
| 560 | Ga0496105_0037459 | |||
| 561 | Ga0496105_0091462 | |||
| 562 | Ga0496106_0492724 | |||
| 563 | Ga0496108_0097760 | |||
| 564 | Ga0496110_0536687 | |||
| 565 | Ga0496113_0459970 | |||
| 566 | Ga0496116_0001148 | |||
| 567 | Ga0496116_0024995 | |||
| 568 | Ga0496116_0057492 | |||
| 569 | Ga0496116_0081070 | |||
| 570 | Ga0496117_0001057 | |||
| 571 | Ga0496117_0001116 | |||
| 572 | Ga0496117_0007671 | |||
| 573 | Ga0496117_0021620 | |||
| 574 | Ga0496117_0025838 | |||
| 575 | Ga0496117_0056315 | |||
| 576 | Ga0496117_0092831 | |||
| 577 | Ga0496117_0409206 | |||
| 578 | Ga0496118_0000661 | |||
| 579 | Ga0496118_0002647 | |||
| 580 | Ga0496118_0026668 | |||
| 581 | Ga0496118_0029136 | |||
| 582 | Ga0496118_0030183 | |||
| 583 | Ga0496118_0033662 | |||
| 584 | Ga0496118_0049921 | |||
| 585 | Ga0496118_0071499 | |||
| 586 | Ga0496118_0115008 | |||
| 587 | Ga0496118_0351328 | |||
| 588 | Ga0496119_0001372 | |||
| 589 | Ga0496119_0011845 | |||
| 590 | Ga0496119_0022284 | |||
| 591 | Ga0496119_0024230 | |||
| 592 | Ga0496119_0081194 | |||
| 593 | Ga0496120_0001351 | |||
| 594 | Ga0496120_0005146 | |||
| 595 | Ga0496120_0034525 | |||
| 596 | Ga0496121_0003939 | |||
| 597 | Ga0496121_0021726 | |||
| 598 | Ga0496121_0038848 | |||
| 599 | Ga0496121_0087225 | |||
| 600 | Ga0496121_0233479 | |||
| 601 | Ga0496122_0019452 | |||
| 602 | Ga0496122_0030572 | |||
| 603 | Ga0496122_0033055 | |||
| 604 | Ga0496122_0043522 | |||
| 605 | Ga0496122_0120078 | |||
| 606 | Ga0496122_0212838 | |||
| 607 | Ga0496123_0001263 | |||
| 608 | Ga0496123_0028762 | |||
| 609 | Ga0496123_0035638 | |||
| 610 | Ga0496123_0067520 | |||
| 611 | Ga0496123_0107612 | |||
| 612 | Ga0496123_0144476 | |||
| 613 | Ga0496123_0228033 | |||
| 614 | Ga0496124_0002117 | |||
| 615 | Ga0496124_0007871 | |||
| 616 | Ga0496124_0013515 | |||
| 617 | Ga0496124_0031690 | |||
| 618 | Ga0496124_0032137 | |||
| 619 | Ga0496124_0035076 | |||
| 620 | Ga0496124_0059436 | |||
| 621 | Ga0496124_0089024 | |||
| 622 | Ga0496124_0098813 | |||
| 623 | Ga0496124_0185669 | |||
| 624 | Ga0496124_0323241 | |||
| 625 | Ga0496124_0481712 | |||
| 626 | Ga0496125_0004566 | |||
| 627 | Ga0496125_0010464 | |||
| 628 | Ga0496125_0019279 | |||
| 629 | Ga0496125_0024282 | |||
| 630 | Ga0496125_0064276 | |||
| 631 | Ga0496125_0081611 | |||
| 632 | Ga0496125_0120306 | |||
| 633 | Ga0496125_0126533 | |||
| 634 | Ga0496125_0257711 | |||
| 635 | Ga0496126_0000615 | |||
| 636 | Ga0496126_0079330 | |||
| 637 | Ga0496126_0089463 | |||
| 638 | Ga0496126_0147636 | |||
| 639 | Ga0496126_0159175 | |||
| 640 | Ga0496126_0283644 | |||
| 641 | Ga0496126_0297303 | |||
| 642 | Ga0496126_0466155 | |||
| 643 | Ga0496126_0786224 | |||
| 644 | Ga0501031_0141676 | |||
| 645 | Ga0501032_0058345 | |||
| 646 | Ga0501033_0097700 | |||
| 647 | Ga0501033_0577058 | |||
| 648 | Ga0501034_0009760 | |||
| 649 | Ga0501034_0089748 | |||
| 650 | Ga0501034_0248390 | |||
| 651 | Ga0501036_0024339 | |||
| 652 | Ga0501037_0002234 | |||
| 653 | Ga0501038_0093134 | |||
| 654 | Ga0501039_0027982 | |||
| 655 | Ga0501043_0058541 | |||
| 656 | Ga0501047_0118801 | |||
| 657 | Ga0501047_0145940 | |||
| 658 | Ga0501067_0086723 | |||
| 659 | Ga0501068_0173068 | |||
| 660 | Ga0501070_0159866 | |||
| 661 | Ga0501073_0088183 | |||
| 662 | Ga0501080_0041422 | |||
| 663 | Ga0501266_012302 | |||
| 664 | Ga0501268_058500 | |||
| 665 | Ga0501035_0007446 | |||
| 666 | Ga0501044_0013420 | |||
| 667 | nmdc:mga00v17_220_c1 | |||
| 668 | nmdc:mga06z11_154193_c1 | |||
| 669 | Ga0500565_023490 | |||
| 670 | 2547503706 | |||
| 671 | 2643880276 | |||
| 672 | 2643937773 | |||
| 673 | 2644078678 | |||
| 674 | 2644660852 | |||
| 675 | 2644693455 | |||
| 676 | 2644698932 | |||
| 677 | 2747951091 | |||
| 678 | 2816518293 | |||
| 679 | 2894416819 | |||
| 680 | 2961064734 | |||
| 681 | 8002870377 | |||
| 682 | 8021652084 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hru-assembly1.cif.gz_B | the structure of the yrdc gene product from e.coli | 0.9255 | 6 | 184 |
| 2eqa-assembly1.cif.gz_A | crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii | 0.9136 | 6 | 180 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.9078 | 6 | 183 |
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.9073 | 6 | 177 |
| 6f89-assembly1.cif.gz_A | structure of h234a/y235a p.abyssi sua5 | 0.906 | 6 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1hruB00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9215 | 6 | 184 | 3.90.870.10 |
| af_Q2FWE2_20_236_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9197 | 6 | 177 | 3.90.870.10 |
| af_Q60369_7_206_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9123 | 6 | 184 | 3.90.870.10 |
| af_A0A1D8PQL4_32_243_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9016 | 6 | 186 | 3.90.870.10 |
| 1hruB00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.8873 | 6 | 184 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R0B037-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9963 | 1 | 186 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |
| AF-A0A6P1SFY5-F1-model_v4 | deleted | 0.9901 | 1 | 186 |
|
| AF-Q3RCP1-F1-model_v4 | deleted | 0.99 | 2 | 185 |
|
| AF-A0A840K0I6-F1-model_v4 | deleted | 0.9886 | 4 | 186 |
|
| AF-A0A522XQB0-F1-model_v4 | Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) | 0.9881 | 1 | 186 |
GO:0000049
GO:0002949 GO:0003725 GO:0005524 GO:0005737 GO:0006450 GO:0061710 |