F414715

General Info

Members Datasets Scaffolds Average Seq Length
341 249 682 313

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001805|Ga0111539_100018053
Length 351
Sequence VLRGVAIAGDATTRIARRKRPRGYVKMAVEESALTSAIGRREIEEVRDVIRSYVRVTPVVAVNGSDFGLAPSAITLKLELLQHSGSFKARGAFANLLTRKIPEAGVVAASGGNHGAAVAYAAMRLGVRAKIFVPTISSQAKIARIRAYGAELEVVGDLYADALAASVAWVKRSGALPVHAFDQRETLLGQGTLGLELSEQAPLDTVLVGVGGGGLIGGIAAWYATQTGAGRTRVIGVEPELAPTLTEALKAGRPADAPAGGIAADSLAPRRVGELMFPIARDHVAKVLLVSDDAIRRAQEALWSAVRIVAEPGGATAFAALLSGSYTPSAGERVGVVVSGGNSTAVDFGRA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2508501050 Microvirga lupini Lut6 Isolate Nodule
197 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
198 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
199 2512875024
200 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
201 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
202 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
203 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
204 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
205 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
206 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
207 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
208 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
209 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
210 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
211 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
212 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
213 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
214 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
215 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
216 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
217 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
218 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
219 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
220 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
221 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
222 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
223 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
224 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
225 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
226 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
227 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
228 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
229 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
230 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
231 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
232 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
233 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
234 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
235 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
236 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
237 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
238 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
239 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
240 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
241 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
242 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
243 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
244 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
245 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
246 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
247 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
248 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
249 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.16
Metatranscriptomes 0
Isolates 15.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 11.44
Rhizoplane 5.28
Rhizosphere 68.33
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10001805 3300009094 Bacteria 28493
2 JGI25151J46595_10000578 3300003187 Bacteria 32673
3 JGI25153J46596_10000047 3300003215 Bacteria 146400
4 rootH1_10304332 3300003323 Bacteria 1781
5 JGI25160J50197_1004854 3300003354 Bacteria 5727
6 Ga0070676_10172334 3300005328 Bacteria 1401
7 Ga0070676_10197743 3300005328 Bacteria 1316
8 Ga0070660_100116125 3300005339 Bacteria 2134
9 Ga0070668_100243668 3300005347 Bacteria 1490
10 Ga0070669_100041274 3300005353 Bacteria 3356
11 Ga0070669_100046968 3300005353 Bacteria 3149
12 Ga0070709_10334383 3300005434 Bacteria 1115
13 Ga0070714_100022869 3300005435 Bacteria 5130
14 Ga0070710_10060241 3300005437 Bacteria 2159
15 Ga0070711_100014670 3300005439 Unclassified 4940
16 Ga0070705_100034877 3300005440 Bacteria 2816
17 Ga0070694_100005939 3300005444 Bacteria 7400
18 Ga0070708_100004995 3300005445 Bacteria 10487
19 Ga0070708_100082554 3300005445 Bacteria 2911
20 Ga0070708_100120723 3300005445 Bacteria 2418
21 Ga0070708_100210388 3300005445 Bacteria 1822
22 Ga0070678_100129507 3300005456 Bacteria 2003
23 Ga0070662_100017091 3300005457 Bacteria 4883
24 Ga0070662_100071031 3300005457 Bacteria 2566
25 Ga0070681_10278143 3300005458 Bacteria 1585
26 Ga0068867_100326921 3300005459 Bacteria 1272
27 Ga0070706_100022875 3300005467 Bacteria 5756
28 Ga0070706_100115654 3300005467 Bacteria 2498
29 Ga0070706_100324924 3300005467 Bacteria 1435
30 Ga0070707_100004351 3300005468 Bacteria 13272
31 Ga0070707_100028819 3300005468 Bacteria 5284
32 Ga0070707_100045549 3300005468 Bacteria 4198
33 Ga0070698_100144240 3300005471 Bacteria 2331
34 Ga0070699_100027935 3300005518 Bacteria 4867
35 Ga0070699_100214345 3300005518 Bacteria 1715
36 Ga0070697_100024824 3300005536 Plasmid 4773
37 Ga0070697_100098914 3300005536 Bacteria 2421
38 Ga0068853_100127616 3300005539 Bacteria 2274
39 Ga0070672_100032643 3300005543 Bacteria 3932
40 Ga0070696_100013334 3300005546 Bacteria 5514
41 Ga0070696_100218093 3300005546 Bacteria 1430
42 Ga0070665_100078373 3300005548 Bacteria 3311
43 Ga0068857_100088960 3300005577 Bacteria 2763
44 Ga0068859_100073704 3300005617 Bacteria 3452
45 Ga0068859_100108149 3300005617 Bacteria 2842
46 Ga0068859_100255566 3300005617 Bacteria 1843
47 Ga0068859_100444885 3300005617 Bacteria 1392
48 Ga0068864_100214000 3300005618 Bacteria 1776
49 Ga0068864_100360538 3300005618 Bacteria 1374
50 Ga0068861_100004680 3300005719 Bacteria 9193
51 Ga0068861_100046293 3300005719 Bacteria 3279
52 Ga0068863_100145281 3300005841 Bacteria 2268
53 Ga0068860_100097865 3300005843 Bacteria 2798
54 Ga0068860_100262257 3300005843 Bacteria 1684
55 Ga0068862_100003378 3300005844 Bacteria 13767
56 Ga0068862_100274117 3300005844 Bacteria 1544
57 Ga0081539_10001727 3300005985 Bacteria 34927
58 Ga0081539_10018900 3300005985 Bacteria 4748
59 Ga0075427_10001531 3300006194 Bacteria 2982
60 Ga0075428_100000231 3300006844 Bacteria 54453
61 Ga0075428_100008622 3300006844 Bacteria 11312
62 Ga0075428_100111520 3300006844 Bacteria 2980
63 Ga0075428_100384167 3300006844 Bacteria 1505
64 Ga0075430_100067524 3300006846 Bacteria 3001
65 Ga0075431_100109461 3300006847 Bacteria 2852
66 Ga0075433_10001881 3300006852 Bacteria 15779
67 Ga0075433_10010409 3300006852 Bacteria 7464
68 Ga0075433_10288695 3300006852 Bacteria 1453
69 Ga0075434_100011240 3300006871 Bacteria 8431
70 Ga0075434_100016821 3300006871 Bacteria 7037
71 Ga0075434_100061648 3300006871 Bacteria 3732
72 Ga0075434_100178175 3300006871 Bacteria 2145
73 Ga0075429_100011935 3300006880 Bacteria 7532
74 Ga0075429_100029639 3300006880 Bacteria 4753
75 Ga0075436_100054468 3300006914 Bacteria 2761
76 Ga0097620_100073705 3300006931 Bacteria 3452
77 Ga0097620_100108146 3300006931 Bacteria 2842
78 Ga0097620_100255572 3300006931 Bacteria 1843
79 Ga0097620_100444816 3300006931 Bacteria 1392
80 Ga0075435_100004132 3300007076 Bacteria 9957
81 Ga0075435_100045393 3300007076 Bacteria 3522
82 Ga0075435_100175924 3300007076 Bacteria 1807
83 Ga0099794_10002520 3300007265 Bacteria 6768
84 Ga0111539_10032553 3300009094 Bacteria 6330
85 Ga0111539_10187129 3300009094 Unclassified 2418
86 Ga0105245_10109743 3300009098 Bacteria 2564
87 Ga0114129_10004455 3300009147 Bacteria 19767
88 Ga0114129_10007024 3300009147 Bacteria 16032
89 Ga0114129_10015789 3300009147 Bacteria 10737
90 Ga0114129_10047164 3300009147 Bacteria 6055
91 Ga0114129_10051560 3300009147 Bacteria 5776
92 Ga0114129_10485998 3300009147 Bacteria 1615
93 Ga0105243_10241356 3300009148 Bacteria 1608
94 Ga0105241_10088516 3300009174 Bacteria 2438
95 Ga0105248_10005844 3300009177 Bacteria 13526
96 Ga0105238_10088693 3300009551 Bacteria 3079
97 Ga0105238_10308191 3300009551 Bacteria 1568
98 Ga0105249_10037167 3300009553 Bacteria 4419
99 Ga0105033_103420 3300009986 Bacteria 1332
100 Ga0099796_10000369 3300010159 Bacteria 7334
101 Ga0105246_10429854 3300011119 Bacteria 1104
102 Ga0157378_10002274 3300013297 Bacteria 17054
103 Ga0163162_10065430 3300013306 Bacteria 3682
104 Ga0163162_10189206 3300013306 Bacteria 2186
105 Ga0157375_10153294 3300013308 Bacteria 2441
106 Ga0157375_10166352 3300013308 Bacteria 2350
107 Ga0157376_10744340 3300014969 Bacteria 989
108 Ga0163161_10049860 3300017792 Bacteria 3027
109 Ga0163161_10138120 3300017792 Bacteria 1844
110 Ga0213876_10038545 3300021384 Bacteria 2523
111 Ga0213871_10001901 3300021441 Bacteria 3690
112 Ga0209130_1000967 3300025284 Bacteria 22638
113 Ga0209025_1000327 3300025294 Bacteria 106055
114 Ga0209758_1000070 3300025297 Bacteria 284093
115 Ga0209758_1012594 3300025297 Bacteria 4715
116 Ga0209050_1006759 3300025298 Bacteria 6687
117 Ga0207426_1000080 3300025302 Bacteria 304917
118 Ga0209051_1019115 3300025303 Bacteria 3003
119 Ga0209257_1000296 3300025304 Bacteria 109517
120 Ga0207692_10026369 3300025898 Bacteria 2726
121 Ga0207692_10105012 3300025898 Bacteria 1558
122 Ga0207642_10074026 3300025899 Bacteria 1631
123 Ga0207684_10012118 3300025910 Bacteria 7505
124 Ga0207684_10022785 3300025910 Bacteria 5347
125 Ga0207684_10027040 3300025910 Bacteria 4892
126 Ga0207684_10166987 3300025910 Bacteria 1897
127 Ga0207684_10174395 3300025910 Bacteria 1854
128 Ga0207646_10074889 3300025922 Bacteria 3024
129 Ga0207694_10053576 3300025924 Bacteria 3128
130 Ga0207664_10009899 3300025929 Bacteria 6714
131 Ga0207706_10011891 3300025933 Bacteria 7924
132 Ga0207709_10065046 3300025935 Bacteria 2292
133 Ga0207670_10020648 3300025936 Bacteria 4051
134 Ga0207711_10104221 3300025941 Bacteria 2513
135 Ga0207689_10247751 3300025942 Bacteria 1473
136 Ga0207641_10103072 3300026088 Bacteria 2517
137 Ga0207641_10401758 3300026088 Bacteria 1316
138 Ga0207648_10107476 3300026089 Bacteria 2449
139 Ga0207648_10148007 3300026089 Bacteria 2072
140 Ga0207676_10241331 3300026095 Bacteria 1621
141 Ga0207674_10115228 3300026116 Bacteria 2659
142 Ga0207675_100061062 3300026118 Bacteria 3519
143 Ga0207428_10000283 3300027907 Bacteria 68603
144 Ga0207428_10045574 3300027907 Bacteria 3531
145 Ga0268266_10043527 3300028379 Bacteria 3838
146 Ga0307517_10104230 3300028786 Bacteria 2211
147 Ga0307513_10225898 3300031456 Bacteria 1689
148 Ga0307509_10000070 3300031507 Bacteria 141228
149 Ga0307408_100108233 3300031548 Bacteria 2130
150 Ga0307408_100246026 3300031548 Bacteria 1472
151 Ga0307508_10027862 3300031616 Bacteria 5112
152 Ga0307508_10053743 3300031616 Bacteria 3573
153 Ga0307508_10219382 3300031616 Bacteria 1502
154 Ga0307516_10267866 3300031730 Bacteria 1396
155 Ga0307405_10003456 3300031731 Bacteria 7253
156 Ga0307413_10006463 3300031824 Bacteria 5356
157 Ga0307410_10054028 3300031852 Bacteria 2721
158 Ga0307410_10077998 3300031852 Bacteria 2317
159 Ga0307406_10027529 3300031901 Bacteria 3426
160 Ga0307407_10026971 3300031903 Bacteria 3050
161 Ga0307409_100264235 3300031995 Bacteria 1581
162 Ga0307416_100093395 3300032002 Bacteria 2591
163 Ga0307411_10121069 3300032005 Bacteria 1893
164 Ga0307415_100049147 3300032126 Bacteria 2850
165 Ga0373934_0002789 3300035086 Bacteria 6405
166 Ga0373932_0002563 3300035112 Bacteria 4549
167 Ga0373953_0002456 3300035117 Bacteria 5607
168 Ga0373954_0000874 3300035118 Bacteria 11694
169 Ga0373956_0004611 3300035119 Bacteria 5508
170 Ga0373957_0032937 3300035120 Unclassified 1911
171 Ga0373955_0013452 3300035172 Unclassified 3959
172 Ga0373955_0157479 3300035172 Bacteria 1339
173 Ga0373924_0053999 3300035410 Unclassified 1670
174 Ga0373931_0008277 3300035691 Bacteria 4927
175 Ga0373931_0008952 3300035691 Bacteria 4771
176 Ga0373933_0000334 3300035724 Bacteria 30278
177 Ga0373947_0172509 3300035725 Bacteria 1404
178 Ga0373937_0002197 3300036401 Bacteria 16300
179 Ga0373925_0179302 3300037068 Bacteria 1676
180 Ga0395900_0230675 3300037418 Bacteria 1862
181 Ga0395905_0347966 3300037471 Bacteria 1374
182 Ga0436364_0502575 3300037853 Bacteria 2082
183 Ga0436365_0972088 3300039437 Bacteria 3724
184 Ga0436360_0640251 3300039438 Bacteria 19885
185 Ga0436361_0270081 3300039447 Bacteria 13319
186 Ga0451577_0084082 3300042876 Bacteria 2840
187 Ga0451576_0024794 3300045051 Bacteria 6473
188 Ga0451576_0176364 3300045051 Bacteria 2231
189 Ga0451576_0796334 3300045051 Bacteria 992
190 Ga0495629_0145587 3300046459 Bacteria 1648
191 Ga0495638_0139091 3300046460 Bacteria 1419
192 Ga0495641_0044986 3300046461 Unclassified 2034
193 Ga0495580_0002492 3300046472 Bacteria 16063
194 Ga0495580_0105796 3300046472 Bacteria 1955
195 Ga0495584_0083659 3300046491 Bacteria 1607
196 Ga0495594_0135439 3300046499 Bacteria 1396
197 Ga0495608_0014591 3300046511 Bacteria 5452
198 Ga0495610_0027122 3300046512 Bacteria 3050
199 Ga0495618_0229589 3300046514 Unclassified 1169
200 Ga0495587_0003027 3300046536 Bacteria 11226
201 Ga0495622_0054876 3300046557 Bacteria 1848
202 Ga0495667_0076959 3300046559 Unclassified 2170
203 Ga0495656_0043960 3300046615 Bacteria 1878
204 Ga0495649_0063061 3300046694 Bacteria 1992
205 Ga0495604_0010317 3300047317 Bacteria 7399
206 Ga0495674_0261268 3300047319 Bacteria 1423
207 Ga0495680_0128956 3300047322 Unclassified 1860
208 Ga0495602_0043852 3300048088 Bacteria 4061
209 Ga0496102_0105781 3300048905 Bacteria 2618
210 Ga0496103_0011819 3300048906 Bacteria 5180
211 Ga0496104_0000667 3300048907 Bacteria 29417
212 Ga0496105_0001012 3300048908 Bacteria 19448
213 Ga0496106_0044875 3300048909 Bacteria 3319
214 Ga0496107_0202026 3300048910 Unclassified 1477
215 Ga0496108_0002491 3300048911 Bacteria 14736
216 Ga0496109_0003028 3300048912 Bacteria 14026
217 Ga0496110_0000149 3300048913 Bacteria 41626
218 Ga0496111_0002871 3300048914 Bacteria 10516
219 Ga0496112_0012018 3300048915 Bacteria 7940
220 Ga0496112_0047778 3300048915 Bacteria 4199
221 Ga0496112_0479540 3300048915 Bacteria 1180
222 Ga0496113_0001060 3300048916 Bacteria 14848
223 Ga0496114_0011177 3300048917 Bacteria 7168
224 Ga0496114_0069544 3300048917 Bacteria 2956
225 Ga0496115_0026432 3300048918 Bacteria 4530
226 Ga0496115_0088053 3300048918 Bacteria 2534
227 Ga0496126_0449777 3300048929 Bacteria 1037
228 Ga0501036_0487782 3300049572 Bacteria 1026
229 Ga0501038_0200411 3300049574 Bacteria 1602
230 Ga0501043_0087088 3300049579 Bacteria 2454
231 Ga0501047_0015903 3300049581 Bacteria 7172
232 Ga0501047_0073990 3300049581 Bacteria 3280
233 Ga0501067_0011777 3300049583 Bacteria 4845
234 Ga0501068_0024727 3300049584 Bacteria 3528
235 Ga0501072_0028660 3300049588 Bacteria 4347
236 Ga0501076_0202634 3300049592 Bacteria 1620
237 Ga0501079_0239015 3300049741 Bacteria 1419
238 Ga0501080_0020414 3300049742 Bacteria 6131
239 Ga0501080_0113907 3300049742 Bacteria 2507
240 Ga0501080_0124869 3300049742 Bacteria 2384
241 Ga0501080_0332669 3300049742 Bacteria 1373
242 Ga0501035_0200586 3300049822 Bacteria 1711
243 Ga0501044_0066156 3300049823 Bacteria 3686
244 nmdc:mga06z11_25212_c1 3300050494 Bacteria 2815
245 nmdc:mga05p37_22305_c1 3300050507 Bacteria 7678
246 nmdc:mga05p37_225360_c1 3300050507 Bacteria 2261
247 nmdc:mga05p37_32448_c1 3300050507 Bacteria 6386
248 nmdc:mga05p37_672242_c1 3300050507 Bacteria 1156
249 nmdc:mga05p37_81960_c1 3300050507 Bacteria 3974
250 nmdc:mga09592_16631_c1 3300050508 Bacteria 6020
251 nmdc:mga09592_242311_c1 3300050508 Bacteria 1562
252 nmdc:mga09592_243841_c1 3300050508 Bacteria 1557
253 nmdc:mga06r32_232845_c1 3300050510 Bacteria 1830
254 nmdc:mga06r32_39228_c1 3300050510 Bacteria 4493
255 nmdc:mga08y16_24788_c1 3300050511 Bacteria 6330
256 nmdc:mga08y16_269505_c1 3300050511 Unclassified 1758
257 nmdc:mga0n895_19033_c1 3300050512 Bacteria 6373
258 nmdc:mga0n895_210596_c1 3300050512 Bacteria 1974
259 nmdc:mga0n895_26768_c1 3300050512 Bacteria 5468
260 nmdc:mga0n895_65904_c1 3300050512 Bacteria 3586
261 nmdc:mga0rr50_154933_c1 3300050513 Bacteria 1855
262 nmdc:mga0rr50_22797_c1 3300050513 Bacteria 4304
263 nmdc:mga0rr50_8885_c1 3300050513 Bacteria 6275
264 nmdc:mga08x19_132004_c1 3300050514 Bacteria 1680
265 nmdc:mga08x19_27989_c1 3300050514 Bacteria 3527
266 nmdc:mga0a205_10523_c1 3300050515 Bacteria 8499
267 nmdc:mga0a205_24578_c1 3300050515 Bacteria 5731
268 nmdc:mga0a205_5820_c1 3300050515 Bacteria 11113
269 nmdc:mga0a205_8702_c2 3300050515 Bacteria 4816
270 Ga0500635_0025055 3300053080 Bacteria 1877
271 Ga0495619_0244992 3300053085 Unclassified 1242
272 Ga0500578_0026108 3300053086 Bacteria 3749
273 Ga0500651_0016307 3300053093 Bacteria 4569
274 Ga0500566_0026598 3300053094 Bacteria 3387
275 Ga0500554_007932 3300053102 Bacteria 2469
276 Ga0500555_001224 3300053103 Bacteria 8290
277 Ga0500595_001833 3300053119 Bacteria 10997
278 Ga0500597_031566 3300053120 Bacteria 2184
279 Ga0500642_0001280 3300053130 Bacteria 7188
280 Ga0500642_0077330 3300053130 Bacteria 1523
281 Ga0500658_0003437 3300053134 Bacteria 5976
282 Ga0500568_0013499 3300053139 Bacteria 3722
283 Ga0500568_0017314 3300053139 Bacteria 3183
284 Ga0500616_0000666 3300053153 Bacteria 40719
285 Ga0500609_004577 3300053731 Bacteria 1908
286 Ga0501082_0000503 3300060353 Bacteria 34645
287 Ga0501082_0350299 3300060353 Bacteria 1287
288 2508734701 2508501050 Bacteria 9633614
289 2509115191 2508501123 Bacteria 6283661
290 2512932980 2512875016 Bacteria 6529530
291 2512961000 2512875024 Bacteria 7195110
292 2588519033 2588253730 Bacteria 6881675
293 2821444819 2821443989 Bacteria 7658172
294 2844535208 2844533157 Bacteria 7517899
295 2856322696 2856320880 Bacteria 7263508
296 2857356585 2857349434 Bacteria 7926032
297 2869285786 2869278585 Bacteria 7077053
298 2874141900 2874139085 Bacteria 7021506
299 2876364773 2876363079 Bacteria 6544991
300 2878739361 2878738818 Bacteria 7136951
301 2883291926 2883291878 Bacteria 5894118
302 2883354906 2883354860 Bacteria 5865246
303 2888337986 2888337043 Bacteria 6629336
304 2889016179 2889010040 Bacteria 6749192
305 2889018781 2889016732 Bacteria 6700763
306 2903449240 2903448605 Bacteria 7357801
307 2903522491 2903521522 Bacteria 6525694
308 2903528870 2903528002 Bacteria 6586099
309 2922131866 2922130491 Bacteria 7173936
310 2924776882 2924776078 Bacteria 7492003
311 2937855420 2937848649 Bacteria 6983481
312 2937883517 2937877337 Bacteria 7246526
313 2937973504 2937972304 Bacteria 7532020
314 2958041802 2958034702 Bacteria 6989922
315 2958050333 2958041894 Bacteria 13082850
316 2958065908 2958064165 Bacteria 7158582
317 2958090685 2958084443 Bacteria 7312792
318 2958100603 2958092219 Bacteria 6861151
319 2958103536 2958100919 Bacteria 6800575
320 2958148489 2958144490 Bacteria 6677056
321 2958175655 2958172287 Bacteria 6716688
322 2963646229 2963644680 Bacteria 6530403
323 2968016701 2968016561 Bacteria 7022047
324 2968085303 2968083720 Bacteria 7351627
325 2968123225 2968117919 Bacteria 6536078
326 2970470043 2970469710 Bacteria 6969209
327 2970600403 2970593180 Bacteria 7073582
328 2977928874 2977922695 Bacteria 6956781
329 2977943085 2977942078 Bacteria 7570577
330 2977988878 2977986579 Bacteria 6581278
331 2979712327 2979710463 Bacteria 6785254
332 2987643865 2987636660 Bacteria 8088555
333 2987652733 2987652177 Bacteria 6969023
334 2996353028 2996348954 Bacteria 7239054
335 3004208014 3004203850 Bacteria 7307914
336 3004211518 3004211236 Bacteria 7417683
337 3004224933 3004218560 Bacteria 7421728
338 3004279710 3004275668 Bacteria 7114440
339 3004290557 3004289098 Bacteria 6135450
340 3004336189 3004334049 Bacteria 8449246
341 637076060 637000159 Bacteria 7596297
342 Ga0111539_10001805
343 JGI25151J46595_10000578
344 JGI25153J46596_10000047
345 rootH1_10304332
346 JGI25160J50197_1004854
347 Ga0070676_10172334
348 Ga0070676_10197743
349 Ga0070660_100116125
350 Ga0070668_100243668
351 Ga0070669_100041274
352 Ga0070669_100046968
353 Ga0070709_10334383
354 Ga0070714_100022869
355 Ga0070710_10060241
356 Ga0070711_100014670
357 Ga0070705_100034877
358 Ga0070694_100005939
359 Ga0070708_100004995
360 Ga0070708_100082554
361 Ga0070708_100120723
362 Ga0070708_100210388
363 Ga0070678_100129507
364 Ga0070662_100017091
365 Ga0070662_100071031
366 Ga0070681_10278143
367 Ga0068867_100326921
368 Ga0070706_100022875
369 Ga0070706_100115654
370 Ga0070706_100324924
371 Ga0070707_100004351
372 Ga0070707_100028819
373 Ga0070707_100045549
374 Ga0070698_100144240
375 Ga0070699_100027935
376 Ga0070699_100214345
377 Ga0070697_100024824
378 Ga0070697_100098914
379 Ga0068853_100127616
380 Ga0070672_100032643
381 Ga0070696_100013334
382 Ga0070696_100218093
383 Ga0070665_100078373
384 Ga0068857_100088960
385 Ga0068859_100073704
386 Ga0068859_100108149
387 Ga0068859_100255566
388 Ga0068859_100444885
389 Ga0068864_100214000
390 Ga0068864_100360538
391 Ga0068861_100004680
392 Ga0068861_100046293
393 Ga0068863_100145281
394 Ga0068860_100097865
395 Ga0068860_100262257
396 Ga0068862_100003378
397 Ga0068862_100274117
398 Ga0081539_10001727
399 Ga0081539_10018900
400 Ga0075427_10001531
401 Ga0075428_100000231
402 Ga0075428_100008622
403 Ga0075428_100111520
404 Ga0075428_100384167
405 Ga0075430_100067524
406 Ga0075431_100109461
407 Ga0075433_10001881
408 Ga0075433_10010409
409 Ga0075433_10288695
410 Ga0075434_100011240
411 Ga0075434_100016821
412 Ga0075434_100061648
413 Ga0075434_100178175
414 Ga0075429_100011935
415 Ga0075429_100029639
416 Ga0075436_100054468
417 Ga0097620_100073705
418 Ga0097620_100108146
419 Ga0097620_100255572
420 Ga0097620_100444816
421 Ga0075435_100004132
422 Ga0075435_100045393
423 Ga0075435_100175924
424 Ga0099794_10002520
425 Ga0111539_10032553
426 Ga0111539_10187129
427 Ga0105245_10109743
428 Ga0114129_10004455
429 Ga0114129_10007024
430 Ga0114129_10015789
431 Ga0114129_10047164
432 Ga0114129_10051560
433 Ga0114129_10485998
434 Ga0105243_10241356
435 Ga0105241_10088516
436 Ga0105248_10005844
437 Ga0105238_10088693
438 Ga0105238_10308191
439 Ga0105249_10037167
440 Ga0105033_103420
441 Ga0099796_10000369
442 Ga0105246_10429854
443 Ga0157378_10002274
444 Ga0163162_10065430
445 Ga0163162_10189206
446 Ga0157375_10153294
447 Ga0157375_10166352
448 Ga0157376_10744340
449 Ga0163161_10049860
450 Ga0163161_10138120
451 Ga0213876_10038545
452 Ga0213871_10001901
453 Ga0209130_1000967
454 Ga0209025_1000327
455 Ga0209758_1000070
456 Ga0209758_1012594
457 Ga0209050_1006759
458 Ga0207426_1000080
459 Ga0209051_1019115
460 Ga0209257_1000296
461 Ga0207692_10026369
462 Ga0207692_10105012
463 Ga0207642_10074026
464 Ga0207684_10012118
465 Ga0207684_10022785
466 Ga0207684_10027040
467 Ga0207684_10166987
468 Ga0207684_10174395
469 Ga0207646_10074889
470 Ga0207694_10053576
471 Ga0207664_10009899
472 Ga0207706_10011891
473 Ga0207709_10065046
474 Ga0207670_10020648
475 Ga0207711_10104221
476 Ga0207689_10247751
477 Ga0207641_10103072
478 Ga0207641_10401758
479 Ga0207648_10107476
480 Ga0207648_10148007
481 Ga0207676_10241331
482 Ga0207674_10115228
483 Ga0207675_100061062
484 Ga0207428_10000283
485 Ga0207428_10045574
486 Ga0268266_10043527
487 Ga0307517_10104230
488 Ga0307513_10225898
489 Ga0307509_10000070
490 Ga0307408_100108233
491 Ga0307408_100246026
492 Ga0307508_10027862
493 Ga0307508_10053743
494 Ga0307508_10219382
495 Ga0307516_10267866
496 Ga0307405_10003456
497 Ga0307413_10006463
498 Ga0307410_10054028
499 Ga0307410_10077998
500 Ga0307406_10027529
501 Ga0307407_10026971
502 Ga0307409_100264235
503 Ga0307416_100093395
504 Ga0307411_10121069
505 Ga0307415_100049147
506 Ga0373934_0002789
507 Ga0373932_0002563
508 Ga0373953_0002456
509 Ga0373954_0000874
510 Ga0373956_0004611
511 Ga0373957_0032937
512 Ga0373955_0013452
513 Ga0373955_0157479
514 Ga0373924_0053999
515 Ga0373931_0008277
516 Ga0373931_0008952
517 Ga0373933_0000334
518 Ga0373947_0172509
519 Ga0373937_0002197
520 Ga0373925_0179302
521 Ga0395900_0230675
522 Ga0395905_0347966
523 Ga0436364_0502575
524 Ga0436365_0972088
525 Ga0436360_0640251
526 Ga0436361_0270081
527 Ga0451577_0084082
528 Ga0451576_0024794
529 Ga0451576_0176364
530 Ga0451576_0796334
531 Ga0495629_0145587
532 Ga0495638_0139091
533 Ga0495641_0044986
534 Ga0495580_0002492
535 Ga0495580_0105796
536 Ga0495584_0083659
537 Ga0495594_0135439
538 Ga0495608_0014591
539 Ga0495610_0027122
540 Ga0495618_0229589
541 Ga0495587_0003027
542 Ga0495622_0054876
543 Ga0495667_0076959
544 Ga0495656_0043960
545 Ga0495649_0063061
546 Ga0495604_0010317
547 Ga0495674_0261268
548 Ga0495680_0128956
549 Ga0495602_0043852
550 Ga0496102_0105781
551 Ga0496103_0011819
552 Ga0496104_0000667
553 Ga0496105_0001012
554 Ga0496106_0044875
555 Ga0496107_0202026
556 Ga0496108_0002491
557 Ga0496109_0003028
558 Ga0496110_0000149
559 Ga0496111_0002871
560 Ga0496112_0012018
561 Ga0496112_0047778
562 Ga0496112_0479540
563 Ga0496113_0001060
564 Ga0496114_0011177
565 Ga0496114_0069544
566 Ga0496115_0026432
567 Ga0496115_0088053
568 Ga0496126_0449777
569 Ga0501036_0487782
570 Ga0501038_0200411
571 Ga0501043_0087088
572 Ga0501047_0015903
573 Ga0501047_0073990
574 Ga0501067_0011777
575 Ga0501068_0024727
576 Ga0501072_0028660
577 Ga0501076_0202634
578 Ga0501079_0239015
579 Ga0501080_0020414
580 Ga0501080_0113907
581 Ga0501080_0124869
582 Ga0501080_0332669
583 Ga0501035_0200586
584 Ga0501044_0066156
585 nmdc:mga06z11_25212_c1
586 nmdc:mga05p37_22305_c1
587 nmdc:mga05p37_225360_c1
588 nmdc:mga05p37_32448_c1
589 nmdc:mga05p37_672242_c1
590 nmdc:mga05p37_81960_c1
591 nmdc:mga09592_16631_c1
592 nmdc:mga09592_242311_c1
593 nmdc:mga09592_243841_c1
594 nmdc:mga06r32_232845_c1
595 nmdc:mga06r32_39228_c1
596 nmdc:mga08y16_24788_c1
597 nmdc:mga08y16_269505_c1
598 nmdc:mga0n895_19033_c1
599 nmdc:mga0n895_210596_c1
600 nmdc:mga0n895_26768_c1
601 nmdc:mga0n895_65904_c1
602 nmdc:mga0rr50_154933_c1
603 nmdc:mga0rr50_22797_c1
604 nmdc:mga0rr50_8885_c1
605 nmdc:mga08x19_132004_c1
606 nmdc:mga08x19_27989_c1
607 nmdc:mga0a205_10523_c1
608 nmdc:mga0a205_24578_c1
609 nmdc:mga0a205_5820_c1
610 nmdc:mga0a205_8702_c2
611 Ga0500635_0025055
612 Ga0495619_0244992
613 Ga0500578_0026108
614 Ga0500651_0016307
615 Ga0500566_0026598
616 Ga0500554_007932
617 Ga0500555_001224
618 Ga0500595_001833
619 Ga0500597_031566
620 Ga0500642_0001280
621 Ga0500642_0077330
622 Ga0500658_0003437
623 Ga0500568_0013499
624 Ga0500568_0017314
625 Ga0500616_0000666
626 Ga0500609_004577
627 Ga0501082_0000503
628 Ga0501082_0350299
629 2508734701
630 2509115191
631 2512932980
632 2512961000
633 2588519033
634 2821444819
635 2844535208
636 2856322696
637 2857356585
638 2869285786
639 2874141900
640 2876364773
641 2878739361
642 2883291926
643 2883354906
644 2888337986
645 2889016179
646 2889018781
647 2903449240
648 2903522491
649 2903528870
650 2922131866
651 2924776882
652 2937855420
653 2937883517
654 2937973504
655 2958041802
656 2958050333
657 2958065908
658 2958090685
659 2958100603
660 2958103536
661 2958148489
662 2958175655
663 2963646229
664 2968016701
665 2968085303
666 2968123225
667 2970470043
668 2970600403
669 2977928874
670 2977943085
671 2977988878
672 2979712327
673 2987643865
674 2987652733
675 2996353028
676 3004208014
677 3004211518
678 3004224933
679 3004279710
680 3004290557
681 3004336189
682 637076060

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

50

340

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9389 1 306
5cvc-assembly2.cif.gz_B-2 structure of maize serine racemase 0.9247 7 313
5cvc-assembly1.cif.gz_A structure of maize serine racemase 0.9215 7 312
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.9192 7 306
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9128 1 306
ID Description Score Start End Superfamily
af_X1WC99_42_136_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9669 73 149 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 74 147 3.40.50.1100
af_P09367_100_172_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9549 83 149 3.40.50.1100
af_Q9VHF0_106_202_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9547 56 149 3.40.50.1100
2gn1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9518 57 147 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A528ARW6-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9912 162 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0016020
AF-A0A529C3W7-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9864 131 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A520GST4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.981 64 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A1G5DT08-F1-model_v4 Threonine dehydratase 0.9807 2 306 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A1I5U030-F1-model_v4 Threonine dehydratase 0.98 7 314 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097

Map