F414715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 341 | 249 | 682 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10001805|Ga0111539_100018053 |
| Length | 351 |
| Sequence | VLRGVAIAGDATTRIARRKRPRGYVKMAVEESALTSAIGRREIEEVRDVIRSYVRVTPVVAVNGSDFGLAPSAITLKLELLQHSGSFKARGAFANLLTRKIPEAGVVAASGGNHGAAVAYAAMRLGVRAKIFVPTISSQAKIARIRAYGAELEVVGDLYADALAASVAWVKRSGALPVHAFDQRETLLGQGTLGLELSEQAPLDTVLVGVGGGGLIGGIAAWYATQTGAGRTRVIGVEPELAPTLTEALKAGRPADAPAGGIAADSLAPRRVGELMFPIARDHVAKVLLVSDDAIRRAQEALWSAVRIVAEPGGATAFAALLSGSYTPSAGERVGVVVSGGNSTAVDFGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 66 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 92 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 93 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 96 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 106 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 157 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 158 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 182 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 184 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 185 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 187 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 188 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 189 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 190 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 197 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 198 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 199 | 2512875024 | |||
| 200 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 201 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 202 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 203 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 204 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 205 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 206 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 207 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 208 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 209 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 210 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 211 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 212 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 213 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 214 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 215 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 216 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 217 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 218 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 219 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 220 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 221 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 222 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 223 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 224 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 225 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 226 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 227 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 228 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 229 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 230 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 231 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 232 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 233 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 234 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 235 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 236 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 237 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 238 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 239 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 240 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 241 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 242 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 243 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 244 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 245 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 246 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 247 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 248 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 249 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.16 |
| Metatranscriptomes | 0 |
| Isolates | 15.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.92 |
| Nodule | 11.44 |
| Rhizoplane | 5.28 |
| Rhizosphere | 68.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10001805 | 3300009094 | Bacteria | 28493 |
| 2 | JGI25151J46595_10000578 | 3300003187 | Bacteria | 32673 |
| 3 | JGI25153J46596_10000047 | 3300003215 | Bacteria | 146400 |
| 4 | rootH1_10304332 | 3300003323 | Bacteria | 1781 |
| 5 | JGI25160J50197_1004854 | 3300003354 | Bacteria | 5727 |
| 6 | Ga0070676_10172334 | 3300005328 | Bacteria | 1401 |
| 7 | Ga0070676_10197743 | 3300005328 | Bacteria | 1316 |
| 8 | Ga0070660_100116125 | 3300005339 | Bacteria | 2134 |
| 9 | Ga0070668_100243668 | 3300005347 | Bacteria | 1490 |
| 10 | Ga0070669_100041274 | 3300005353 | Bacteria | 3356 |
| 11 | Ga0070669_100046968 | 3300005353 | Bacteria | 3149 |
| 12 | Ga0070709_10334383 | 3300005434 | Bacteria | 1115 |
| 13 | Ga0070714_100022869 | 3300005435 | Bacteria | 5130 |
| 14 | Ga0070710_10060241 | 3300005437 | Bacteria | 2159 |
| 15 | Ga0070711_100014670 | 3300005439 | Unclassified | 4940 |
| 16 | Ga0070705_100034877 | 3300005440 | Bacteria | 2816 |
| 17 | Ga0070694_100005939 | 3300005444 | Bacteria | 7400 |
| 18 | Ga0070708_100004995 | 3300005445 | Bacteria | 10487 |
| 19 | Ga0070708_100082554 | 3300005445 | Bacteria | 2911 |
| 20 | Ga0070708_100120723 | 3300005445 | Bacteria | 2418 |
| 21 | Ga0070708_100210388 | 3300005445 | Bacteria | 1822 |
| 22 | Ga0070678_100129507 | 3300005456 | Bacteria | 2003 |
| 23 | Ga0070662_100017091 | 3300005457 | Bacteria | 4883 |
| 24 | Ga0070662_100071031 | 3300005457 | Bacteria | 2566 |
| 25 | Ga0070681_10278143 | 3300005458 | Bacteria | 1585 |
| 26 | Ga0068867_100326921 | 3300005459 | Bacteria | 1272 |
| 27 | Ga0070706_100022875 | 3300005467 | Bacteria | 5756 |
| 28 | Ga0070706_100115654 | 3300005467 | Bacteria | 2498 |
| 29 | Ga0070706_100324924 | 3300005467 | Bacteria | 1435 |
| 30 | Ga0070707_100004351 | 3300005468 | Bacteria | 13272 |
| 31 | Ga0070707_100028819 | 3300005468 | Bacteria | 5284 |
| 32 | Ga0070707_100045549 | 3300005468 | Bacteria | 4198 |
| 33 | Ga0070698_100144240 | 3300005471 | Bacteria | 2331 |
| 34 | Ga0070699_100027935 | 3300005518 | Bacteria | 4867 |
| 35 | Ga0070699_100214345 | 3300005518 | Bacteria | 1715 |
| 36 | Ga0070697_100024824 | 3300005536 | Plasmid | 4773 |
| 37 | Ga0070697_100098914 | 3300005536 | Bacteria | 2421 |
| 38 | Ga0068853_100127616 | 3300005539 | Bacteria | 2274 |
| 39 | Ga0070672_100032643 | 3300005543 | Bacteria | 3932 |
| 40 | Ga0070696_100013334 | 3300005546 | Bacteria | 5514 |
| 41 | Ga0070696_100218093 | 3300005546 | Bacteria | 1430 |
| 42 | Ga0070665_100078373 | 3300005548 | Bacteria | 3311 |
| 43 | Ga0068857_100088960 | 3300005577 | Bacteria | 2763 |
| 44 | Ga0068859_100073704 | 3300005617 | Bacteria | 3452 |
| 45 | Ga0068859_100108149 | 3300005617 | Bacteria | 2842 |
| 46 | Ga0068859_100255566 | 3300005617 | Bacteria | 1843 |
| 47 | Ga0068859_100444885 | 3300005617 | Bacteria | 1392 |
| 48 | Ga0068864_100214000 | 3300005618 | Bacteria | 1776 |
| 49 | Ga0068864_100360538 | 3300005618 | Bacteria | 1374 |
| 50 | Ga0068861_100004680 | 3300005719 | Bacteria | 9193 |
| 51 | Ga0068861_100046293 | 3300005719 | Bacteria | 3279 |
| 52 | Ga0068863_100145281 | 3300005841 | Bacteria | 2268 |
| 53 | Ga0068860_100097865 | 3300005843 | Bacteria | 2798 |
| 54 | Ga0068860_100262257 | 3300005843 | Bacteria | 1684 |
| 55 | Ga0068862_100003378 | 3300005844 | Bacteria | 13767 |
| 56 | Ga0068862_100274117 | 3300005844 | Bacteria | 1544 |
| 57 | Ga0081539_10001727 | 3300005985 | Bacteria | 34927 |
| 58 | Ga0081539_10018900 | 3300005985 | Bacteria | 4748 |
| 59 | Ga0075427_10001531 | 3300006194 | Bacteria | 2982 |
| 60 | Ga0075428_100000231 | 3300006844 | Bacteria | 54453 |
| 61 | Ga0075428_100008622 | 3300006844 | Bacteria | 11312 |
| 62 | Ga0075428_100111520 | 3300006844 | Bacteria | 2980 |
| 63 | Ga0075428_100384167 | 3300006844 | Bacteria | 1505 |
| 64 | Ga0075430_100067524 | 3300006846 | Bacteria | 3001 |
| 65 | Ga0075431_100109461 | 3300006847 | Bacteria | 2852 |
| 66 | Ga0075433_10001881 | 3300006852 | Bacteria | 15779 |
| 67 | Ga0075433_10010409 | 3300006852 | Bacteria | 7464 |
| 68 | Ga0075433_10288695 | 3300006852 | Bacteria | 1453 |
| 69 | Ga0075434_100011240 | 3300006871 | Bacteria | 8431 |
| 70 | Ga0075434_100016821 | 3300006871 | Bacteria | 7037 |
| 71 | Ga0075434_100061648 | 3300006871 | Bacteria | 3732 |
| 72 | Ga0075434_100178175 | 3300006871 | Bacteria | 2145 |
| 73 | Ga0075429_100011935 | 3300006880 | Bacteria | 7532 |
| 74 | Ga0075429_100029639 | 3300006880 | Bacteria | 4753 |
| 75 | Ga0075436_100054468 | 3300006914 | Bacteria | 2761 |
| 76 | Ga0097620_100073705 | 3300006931 | Bacteria | 3452 |
| 77 | Ga0097620_100108146 | 3300006931 | Bacteria | 2842 |
| 78 | Ga0097620_100255572 | 3300006931 | Bacteria | 1843 |
| 79 | Ga0097620_100444816 | 3300006931 | Bacteria | 1392 |
| 80 | Ga0075435_100004132 | 3300007076 | Bacteria | 9957 |
| 81 | Ga0075435_100045393 | 3300007076 | Bacteria | 3522 |
| 82 | Ga0075435_100175924 | 3300007076 | Bacteria | 1807 |
| 83 | Ga0099794_10002520 | 3300007265 | Bacteria | 6768 |
| 84 | Ga0111539_10032553 | 3300009094 | Bacteria | 6330 |
| 85 | Ga0111539_10187129 | 3300009094 | Unclassified | 2418 |
| 86 | Ga0105245_10109743 | 3300009098 | Bacteria | 2564 |
| 87 | Ga0114129_10004455 | 3300009147 | Bacteria | 19767 |
| 88 | Ga0114129_10007024 | 3300009147 | Bacteria | 16032 |
| 89 | Ga0114129_10015789 | 3300009147 | Bacteria | 10737 |
| 90 | Ga0114129_10047164 | 3300009147 | Bacteria | 6055 |
| 91 | Ga0114129_10051560 | 3300009147 | Bacteria | 5776 |
| 92 | Ga0114129_10485998 | 3300009147 | Bacteria | 1615 |
| 93 | Ga0105243_10241356 | 3300009148 | Bacteria | 1608 |
| 94 | Ga0105241_10088516 | 3300009174 | Bacteria | 2438 |
| 95 | Ga0105248_10005844 | 3300009177 | Bacteria | 13526 |
| 96 | Ga0105238_10088693 | 3300009551 | Bacteria | 3079 |
| 97 | Ga0105238_10308191 | 3300009551 | Bacteria | 1568 |
| 98 | Ga0105249_10037167 | 3300009553 | Bacteria | 4419 |
| 99 | Ga0105033_103420 | 3300009986 | Bacteria | 1332 |
| 100 | Ga0099796_10000369 | 3300010159 | Bacteria | 7334 |
| 101 | Ga0105246_10429854 | 3300011119 | Bacteria | 1104 |
| 102 | Ga0157378_10002274 | 3300013297 | Bacteria | 17054 |
| 103 | Ga0163162_10065430 | 3300013306 | Bacteria | 3682 |
| 104 | Ga0163162_10189206 | 3300013306 | Bacteria | 2186 |
| 105 | Ga0157375_10153294 | 3300013308 | Bacteria | 2441 |
| 106 | Ga0157375_10166352 | 3300013308 | Bacteria | 2350 |
| 107 | Ga0157376_10744340 | 3300014969 | Bacteria | 989 |
| 108 | Ga0163161_10049860 | 3300017792 | Bacteria | 3027 |
| 109 | Ga0163161_10138120 | 3300017792 | Bacteria | 1844 |
| 110 | Ga0213876_10038545 | 3300021384 | Bacteria | 2523 |
| 111 | Ga0213871_10001901 | 3300021441 | Bacteria | 3690 |
| 112 | Ga0209130_1000967 | 3300025284 | Bacteria | 22638 |
| 113 | Ga0209025_1000327 | 3300025294 | Bacteria | 106055 |
| 114 | Ga0209758_1000070 | 3300025297 | Bacteria | 284093 |
| 115 | Ga0209758_1012594 | 3300025297 | Bacteria | 4715 |
| 116 | Ga0209050_1006759 | 3300025298 | Bacteria | 6687 |
| 117 | Ga0207426_1000080 | 3300025302 | Bacteria | 304917 |
| 118 | Ga0209051_1019115 | 3300025303 | Bacteria | 3003 |
| 119 | Ga0209257_1000296 | 3300025304 | Bacteria | 109517 |
| 120 | Ga0207692_10026369 | 3300025898 | Bacteria | 2726 |
| 121 | Ga0207692_10105012 | 3300025898 | Bacteria | 1558 |
| 122 | Ga0207642_10074026 | 3300025899 | Bacteria | 1631 |
| 123 | Ga0207684_10012118 | 3300025910 | Bacteria | 7505 |
| 124 | Ga0207684_10022785 | 3300025910 | Bacteria | 5347 |
| 125 | Ga0207684_10027040 | 3300025910 | Bacteria | 4892 |
| 126 | Ga0207684_10166987 | 3300025910 | Bacteria | 1897 |
| 127 | Ga0207684_10174395 | 3300025910 | Bacteria | 1854 |
| 128 | Ga0207646_10074889 | 3300025922 | Bacteria | 3024 |
| 129 | Ga0207694_10053576 | 3300025924 | Bacteria | 3128 |
| 130 | Ga0207664_10009899 | 3300025929 | Bacteria | 6714 |
| 131 | Ga0207706_10011891 | 3300025933 | Bacteria | 7924 |
| 132 | Ga0207709_10065046 | 3300025935 | Bacteria | 2292 |
| 133 | Ga0207670_10020648 | 3300025936 | Bacteria | 4051 |
| 134 | Ga0207711_10104221 | 3300025941 | Bacteria | 2513 |
| 135 | Ga0207689_10247751 | 3300025942 | Bacteria | 1473 |
| 136 | Ga0207641_10103072 | 3300026088 | Bacteria | 2517 |
| 137 | Ga0207641_10401758 | 3300026088 | Bacteria | 1316 |
| 138 | Ga0207648_10107476 | 3300026089 | Bacteria | 2449 |
| 139 | Ga0207648_10148007 | 3300026089 | Bacteria | 2072 |
| 140 | Ga0207676_10241331 | 3300026095 | Bacteria | 1621 |
| 141 | Ga0207674_10115228 | 3300026116 | Bacteria | 2659 |
| 142 | Ga0207675_100061062 | 3300026118 | Bacteria | 3519 |
| 143 | Ga0207428_10000283 | 3300027907 | Bacteria | 68603 |
| 144 | Ga0207428_10045574 | 3300027907 | Bacteria | 3531 |
| 145 | Ga0268266_10043527 | 3300028379 | Bacteria | 3838 |
| 146 | Ga0307517_10104230 | 3300028786 | Bacteria | 2211 |
| 147 | Ga0307513_10225898 | 3300031456 | Bacteria | 1689 |
| 148 | Ga0307509_10000070 | 3300031507 | Bacteria | 141228 |
| 149 | Ga0307408_100108233 | 3300031548 | Bacteria | 2130 |
| 150 | Ga0307408_100246026 | 3300031548 | Bacteria | 1472 |
| 151 | Ga0307508_10027862 | 3300031616 | Bacteria | 5112 |
| 152 | Ga0307508_10053743 | 3300031616 | Bacteria | 3573 |
| 153 | Ga0307508_10219382 | 3300031616 | Bacteria | 1502 |
| 154 | Ga0307516_10267866 | 3300031730 | Bacteria | 1396 |
| 155 | Ga0307405_10003456 | 3300031731 | Bacteria | 7253 |
| 156 | Ga0307413_10006463 | 3300031824 | Bacteria | 5356 |
| 157 | Ga0307410_10054028 | 3300031852 | Bacteria | 2721 |
| 158 | Ga0307410_10077998 | 3300031852 | Bacteria | 2317 |
| 159 | Ga0307406_10027529 | 3300031901 | Bacteria | 3426 |
| 160 | Ga0307407_10026971 | 3300031903 | Bacteria | 3050 |
| 161 | Ga0307409_100264235 | 3300031995 | Bacteria | 1581 |
| 162 | Ga0307416_100093395 | 3300032002 | Bacteria | 2591 |
| 163 | Ga0307411_10121069 | 3300032005 | Bacteria | 1893 |
| 164 | Ga0307415_100049147 | 3300032126 | Bacteria | 2850 |
| 165 | Ga0373934_0002789 | 3300035086 | Bacteria | 6405 |
| 166 | Ga0373932_0002563 | 3300035112 | Bacteria | 4549 |
| 167 | Ga0373953_0002456 | 3300035117 | Bacteria | 5607 |
| 168 | Ga0373954_0000874 | 3300035118 | Bacteria | 11694 |
| 169 | Ga0373956_0004611 | 3300035119 | Bacteria | 5508 |
| 170 | Ga0373957_0032937 | 3300035120 | Unclassified | 1911 |
| 171 | Ga0373955_0013452 | 3300035172 | Unclassified | 3959 |
| 172 | Ga0373955_0157479 | 3300035172 | Bacteria | 1339 |
| 173 | Ga0373924_0053999 | 3300035410 | Unclassified | 1670 |
| 174 | Ga0373931_0008277 | 3300035691 | Bacteria | 4927 |
| 175 | Ga0373931_0008952 | 3300035691 | Bacteria | 4771 |
| 176 | Ga0373933_0000334 | 3300035724 | Bacteria | 30278 |
| 177 | Ga0373947_0172509 | 3300035725 | Bacteria | 1404 |
| 178 | Ga0373937_0002197 | 3300036401 | Bacteria | 16300 |
| 179 | Ga0373925_0179302 | 3300037068 | Bacteria | 1676 |
| 180 | Ga0395900_0230675 | 3300037418 | Bacteria | 1862 |
| 181 | Ga0395905_0347966 | 3300037471 | Bacteria | 1374 |
| 182 | Ga0436364_0502575 | 3300037853 | Bacteria | 2082 |
| 183 | Ga0436365_0972088 | 3300039437 | Bacteria | 3724 |
| 184 | Ga0436360_0640251 | 3300039438 | Bacteria | 19885 |
| 185 | Ga0436361_0270081 | 3300039447 | Bacteria | 13319 |
| 186 | Ga0451577_0084082 | 3300042876 | Bacteria | 2840 |
| 187 | Ga0451576_0024794 | 3300045051 | Bacteria | 6473 |
| 188 | Ga0451576_0176364 | 3300045051 | Bacteria | 2231 |
| 189 | Ga0451576_0796334 | 3300045051 | Bacteria | 992 |
| 190 | Ga0495629_0145587 | 3300046459 | Bacteria | 1648 |
| 191 | Ga0495638_0139091 | 3300046460 | Bacteria | 1419 |
| 192 | Ga0495641_0044986 | 3300046461 | Unclassified | 2034 |
| 193 | Ga0495580_0002492 | 3300046472 | Bacteria | 16063 |
| 194 | Ga0495580_0105796 | 3300046472 | Bacteria | 1955 |
| 195 | Ga0495584_0083659 | 3300046491 | Bacteria | 1607 |
| 196 | Ga0495594_0135439 | 3300046499 | Bacteria | 1396 |
| 197 | Ga0495608_0014591 | 3300046511 | Bacteria | 5452 |
| 198 | Ga0495610_0027122 | 3300046512 | Bacteria | 3050 |
| 199 | Ga0495618_0229589 | 3300046514 | Unclassified | 1169 |
| 200 | Ga0495587_0003027 | 3300046536 | Bacteria | 11226 |
| 201 | Ga0495622_0054876 | 3300046557 | Bacteria | 1848 |
| 202 | Ga0495667_0076959 | 3300046559 | Unclassified | 2170 |
| 203 | Ga0495656_0043960 | 3300046615 | Bacteria | 1878 |
| 204 | Ga0495649_0063061 | 3300046694 | Bacteria | 1992 |
| 205 | Ga0495604_0010317 | 3300047317 | Bacteria | 7399 |
| 206 | Ga0495674_0261268 | 3300047319 | Bacteria | 1423 |
| 207 | Ga0495680_0128956 | 3300047322 | Unclassified | 1860 |
| 208 | Ga0495602_0043852 | 3300048088 | Bacteria | 4061 |
| 209 | Ga0496102_0105781 | 3300048905 | Bacteria | 2618 |
| 210 | Ga0496103_0011819 | 3300048906 | Bacteria | 5180 |
| 211 | Ga0496104_0000667 | 3300048907 | Bacteria | 29417 |
| 212 | Ga0496105_0001012 | 3300048908 | Bacteria | 19448 |
| 213 | Ga0496106_0044875 | 3300048909 | Bacteria | 3319 |
| 214 | Ga0496107_0202026 | 3300048910 | Unclassified | 1477 |
| 215 | Ga0496108_0002491 | 3300048911 | Bacteria | 14736 |
| 216 | Ga0496109_0003028 | 3300048912 | Bacteria | 14026 |
| 217 | Ga0496110_0000149 | 3300048913 | Bacteria | 41626 |
| 218 | Ga0496111_0002871 | 3300048914 | Bacteria | 10516 |
| 219 | Ga0496112_0012018 | 3300048915 | Bacteria | 7940 |
| 220 | Ga0496112_0047778 | 3300048915 | Bacteria | 4199 |
| 221 | Ga0496112_0479540 | 3300048915 | Bacteria | 1180 |
| 222 | Ga0496113_0001060 | 3300048916 | Bacteria | 14848 |
| 223 | Ga0496114_0011177 | 3300048917 | Bacteria | 7168 |
| 224 | Ga0496114_0069544 | 3300048917 | Bacteria | 2956 |
| 225 | Ga0496115_0026432 | 3300048918 | Bacteria | 4530 |
| 226 | Ga0496115_0088053 | 3300048918 | Bacteria | 2534 |
| 227 | Ga0496126_0449777 | 3300048929 | Bacteria | 1037 |
| 228 | Ga0501036_0487782 | 3300049572 | Bacteria | 1026 |
| 229 | Ga0501038_0200411 | 3300049574 | Bacteria | 1602 |
| 230 | Ga0501043_0087088 | 3300049579 | Bacteria | 2454 |
| 231 | Ga0501047_0015903 | 3300049581 | Bacteria | 7172 |
| 232 | Ga0501047_0073990 | 3300049581 | Bacteria | 3280 |
| 233 | Ga0501067_0011777 | 3300049583 | Bacteria | 4845 |
| 234 | Ga0501068_0024727 | 3300049584 | Bacteria | 3528 |
| 235 | Ga0501072_0028660 | 3300049588 | Bacteria | 4347 |
| 236 | Ga0501076_0202634 | 3300049592 | Bacteria | 1620 |
| 237 | Ga0501079_0239015 | 3300049741 | Bacteria | 1419 |
| 238 | Ga0501080_0020414 | 3300049742 | Bacteria | 6131 |
| 239 | Ga0501080_0113907 | 3300049742 | Bacteria | 2507 |
| 240 | Ga0501080_0124869 | 3300049742 | Bacteria | 2384 |
| 241 | Ga0501080_0332669 | 3300049742 | Bacteria | 1373 |
| 242 | Ga0501035_0200586 | 3300049822 | Bacteria | 1711 |
| 243 | Ga0501044_0066156 | 3300049823 | Bacteria | 3686 |
| 244 | nmdc:mga06z11_25212_c1 | 3300050494 | Bacteria | 2815 |
| 245 | nmdc:mga05p37_22305_c1 | 3300050507 | Bacteria | 7678 |
| 246 | nmdc:mga05p37_225360_c1 | 3300050507 | Bacteria | 2261 |
| 247 | nmdc:mga05p37_32448_c1 | 3300050507 | Bacteria | 6386 |
| 248 | nmdc:mga05p37_672242_c1 | 3300050507 | Bacteria | 1156 |
| 249 | nmdc:mga05p37_81960_c1 | 3300050507 | Bacteria | 3974 |
| 250 | nmdc:mga09592_16631_c1 | 3300050508 | Bacteria | 6020 |
| 251 | nmdc:mga09592_242311_c1 | 3300050508 | Bacteria | 1562 |
| 252 | nmdc:mga09592_243841_c1 | 3300050508 | Bacteria | 1557 |
| 253 | nmdc:mga06r32_232845_c1 | 3300050510 | Bacteria | 1830 |
| 254 | nmdc:mga06r32_39228_c1 | 3300050510 | Bacteria | 4493 |
| 255 | nmdc:mga08y16_24788_c1 | 3300050511 | Bacteria | 6330 |
| 256 | nmdc:mga08y16_269505_c1 | 3300050511 | Unclassified | 1758 |
| 257 | nmdc:mga0n895_19033_c1 | 3300050512 | Bacteria | 6373 |
| 258 | nmdc:mga0n895_210596_c1 | 3300050512 | Bacteria | 1974 |
| 259 | nmdc:mga0n895_26768_c1 | 3300050512 | Bacteria | 5468 |
| 260 | nmdc:mga0n895_65904_c1 | 3300050512 | Bacteria | 3586 |
| 261 | nmdc:mga0rr50_154933_c1 | 3300050513 | Bacteria | 1855 |
| 262 | nmdc:mga0rr50_22797_c1 | 3300050513 | Bacteria | 4304 |
| 263 | nmdc:mga0rr50_8885_c1 | 3300050513 | Bacteria | 6275 |
| 264 | nmdc:mga08x19_132004_c1 | 3300050514 | Bacteria | 1680 |
| 265 | nmdc:mga08x19_27989_c1 | 3300050514 | Bacteria | 3527 |
| 266 | nmdc:mga0a205_10523_c1 | 3300050515 | Bacteria | 8499 |
| 267 | nmdc:mga0a205_24578_c1 | 3300050515 | Bacteria | 5731 |
| 268 | nmdc:mga0a205_5820_c1 | 3300050515 | Bacteria | 11113 |
| 269 | nmdc:mga0a205_8702_c2 | 3300050515 | Bacteria | 4816 |
| 270 | Ga0500635_0025055 | 3300053080 | Bacteria | 1877 |
| 271 | Ga0495619_0244992 | 3300053085 | Unclassified | 1242 |
| 272 | Ga0500578_0026108 | 3300053086 | Bacteria | 3749 |
| 273 | Ga0500651_0016307 | 3300053093 | Bacteria | 4569 |
| 274 | Ga0500566_0026598 | 3300053094 | Bacteria | 3387 |
| 275 | Ga0500554_007932 | 3300053102 | Bacteria | 2469 |
| 276 | Ga0500555_001224 | 3300053103 | Bacteria | 8290 |
| 277 | Ga0500595_001833 | 3300053119 | Bacteria | 10997 |
| 278 | Ga0500597_031566 | 3300053120 | Bacteria | 2184 |
| 279 | Ga0500642_0001280 | 3300053130 | Bacteria | 7188 |
| 280 | Ga0500642_0077330 | 3300053130 | Bacteria | 1523 |
| 281 | Ga0500658_0003437 | 3300053134 | Bacteria | 5976 |
| 282 | Ga0500568_0013499 | 3300053139 | Bacteria | 3722 |
| 283 | Ga0500568_0017314 | 3300053139 | Bacteria | 3183 |
| 284 | Ga0500616_0000666 | 3300053153 | Bacteria | 40719 |
| 285 | Ga0500609_004577 | 3300053731 | Bacteria | 1908 |
| 286 | Ga0501082_0000503 | 3300060353 | Bacteria | 34645 |
| 287 | Ga0501082_0350299 | 3300060353 | Bacteria | 1287 |
| 288 | 2508734701 | 2508501050 | Bacteria | 9633614 |
| 289 | 2509115191 | 2508501123 | Bacteria | 6283661 |
| 290 | 2512932980 | 2512875016 | Bacteria | 6529530 |
| 291 | 2512961000 | 2512875024 | Bacteria | 7195110 |
| 292 | 2588519033 | 2588253730 | Bacteria | 6881675 |
| 293 | 2821444819 | 2821443989 | Bacteria | 7658172 |
| 294 | 2844535208 | 2844533157 | Bacteria | 7517899 |
| 295 | 2856322696 | 2856320880 | Bacteria | 7263508 |
| 296 | 2857356585 | 2857349434 | Bacteria | 7926032 |
| 297 | 2869285786 | 2869278585 | Bacteria | 7077053 |
| 298 | 2874141900 | 2874139085 | Bacteria | 7021506 |
| 299 | 2876364773 | 2876363079 | Bacteria | 6544991 |
| 300 | 2878739361 | 2878738818 | Bacteria | 7136951 |
| 301 | 2883291926 | 2883291878 | Bacteria | 5894118 |
| 302 | 2883354906 | 2883354860 | Bacteria | 5865246 |
| 303 | 2888337986 | 2888337043 | Bacteria | 6629336 |
| 304 | 2889016179 | 2889010040 | Bacteria | 6749192 |
| 305 | 2889018781 | 2889016732 | Bacteria | 6700763 |
| 306 | 2903449240 | 2903448605 | Bacteria | 7357801 |
| 307 | 2903522491 | 2903521522 | Bacteria | 6525694 |
| 308 | 2903528870 | 2903528002 | Bacteria | 6586099 |
| 309 | 2922131866 | 2922130491 | Bacteria | 7173936 |
| 310 | 2924776882 | 2924776078 | Bacteria | 7492003 |
| 311 | 2937855420 | 2937848649 | Bacteria | 6983481 |
| 312 | 2937883517 | 2937877337 | Bacteria | 7246526 |
| 313 | 2937973504 | 2937972304 | Bacteria | 7532020 |
| 314 | 2958041802 | 2958034702 | Bacteria | 6989922 |
| 315 | 2958050333 | 2958041894 | Bacteria | 13082850 |
| 316 | 2958065908 | 2958064165 | Bacteria | 7158582 |
| 317 | 2958090685 | 2958084443 | Bacteria | 7312792 |
| 318 | 2958100603 | 2958092219 | Bacteria | 6861151 |
| 319 | 2958103536 | 2958100919 | Bacteria | 6800575 |
| 320 | 2958148489 | 2958144490 | Bacteria | 6677056 |
| 321 | 2958175655 | 2958172287 | Bacteria | 6716688 |
| 322 | 2963646229 | 2963644680 | Bacteria | 6530403 |
| 323 | 2968016701 | 2968016561 | Bacteria | 7022047 |
| 324 | 2968085303 | 2968083720 | Bacteria | 7351627 |
| 325 | 2968123225 | 2968117919 | Bacteria | 6536078 |
| 326 | 2970470043 | 2970469710 | Bacteria | 6969209 |
| 327 | 2970600403 | 2970593180 | Bacteria | 7073582 |
| 328 | 2977928874 | 2977922695 | Bacteria | 6956781 |
| 329 | 2977943085 | 2977942078 | Bacteria | 7570577 |
| 330 | 2977988878 | 2977986579 | Bacteria | 6581278 |
| 331 | 2979712327 | 2979710463 | Bacteria | 6785254 |
| 332 | 2987643865 | 2987636660 | Bacteria | 8088555 |
| 333 | 2987652733 | 2987652177 | Bacteria | 6969023 |
| 334 | 2996353028 | 2996348954 | Bacteria | 7239054 |
| 335 | 3004208014 | 3004203850 | Bacteria | 7307914 |
| 336 | 3004211518 | 3004211236 | Bacteria | 7417683 |
| 337 | 3004224933 | 3004218560 | Bacteria | 7421728 |
| 338 | 3004279710 | 3004275668 | Bacteria | 7114440 |
| 339 | 3004290557 | 3004289098 | Bacteria | 6135450 |
| 340 | 3004336189 | 3004334049 | Bacteria | 8449246 |
| 341 | 637076060 | 637000159 | Bacteria | 7596297 |
| 342 | Ga0111539_10001805 | |||
| 343 | JGI25151J46595_10000578 | |||
| 344 | JGI25153J46596_10000047 | |||
| 345 | rootH1_10304332 | |||
| 346 | JGI25160J50197_1004854 | |||
| 347 | Ga0070676_10172334 | |||
| 348 | Ga0070676_10197743 | |||
| 349 | Ga0070660_100116125 | |||
| 350 | Ga0070668_100243668 | |||
| 351 | Ga0070669_100041274 | |||
| 352 | Ga0070669_100046968 | |||
| 353 | Ga0070709_10334383 | |||
| 354 | Ga0070714_100022869 | |||
| 355 | Ga0070710_10060241 | |||
| 356 | Ga0070711_100014670 | |||
| 357 | Ga0070705_100034877 | |||
| 358 | Ga0070694_100005939 | |||
| 359 | Ga0070708_100004995 | |||
| 360 | Ga0070708_100082554 | |||
| 361 | Ga0070708_100120723 | |||
| 362 | Ga0070708_100210388 | |||
| 363 | Ga0070678_100129507 | |||
| 364 | Ga0070662_100017091 | |||
| 365 | Ga0070662_100071031 | |||
| 366 | Ga0070681_10278143 | |||
| 367 | Ga0068867_100326921 | |||
| 368 | Ga0070706_100022875 | |||
| 369 | Ga0070706_100115654 | |||
| 370 | Ga0070706_100324924 | |||
| 371 | Ga0070707_100004351 | |||
| 372 | Ga0070707_100028819 | |||
| 373 | Ga0070707_100045549 | |||
| 374 | Ga0070698_100144240 | |||
| 375 | Ga0070699_100027935 | |||
| 376 | Ga0070699_100214345 | |||
| 377 | Ga0070697_100024824 | |||
| 378 | Ga0070697_100098914 | |||
| 379 | Ga0068853_100127616 | |||
| 380 | Ga0070672_100032643 | |||
| 381 | Ga0070696_100013334 | |||
| 382 | Ga0070696_100218093 | |||
| 383 | Ga0070665_100078373 | |||
| 384 | Ga0068857_100088960 | |||
| 385 | Ga0068859_100073704 | |||
| 386 | Ga0068859_100108149 | |||
| 387 | Ga0068859_100255566 | |||
| 388 | Ga0068859_100444885 | |||
| 389 | Ga0068864_100214000 | |||
| 390 | Ga0068864_100360538 | |||
| 391 | Ga0068861_100004680 | |||
| 392 | Ga0068861_100046293 | |||
| 393 | Ga0068863_100145281 | |||
| 394 | Ga0068860_100097865 | |||
| 395 | Ga0068860_100262257 | |||
| 396 | Ga0068862_100003378 | |||
| 397 | Ga0068862_100274117 | |||
| 398 | Ga0081539_10001727 | |||
| 399 | Ga0081539_10018900 | |||
| 400 | Ga0075427_10001531 | |||
| 401 | Ga0075428_100000231 | |||
| 402 | Ga0075428_100008622 | |||
| 403 | Ga0075428_100111520 | |||
| 404 | Ga0075428_100384167 | |||
| 405 | Ga0075430_100067524 | |||
| 406 | Ga0075431_100109461 | |||
| 407 | Ga0075433_10001881 | |||
| 408 | Ga0075433_10010409 | |||
| 409 | Ga0075433_10288695 | |||
| 410 | Ga0075434_100011240 | |||
| 411 | Ga0075434_100016821 | |||
| 412 | Ga0075434_100061648 | |||
| 413 | Ga0075434_100178175 | |||
| 414 | Ga0075429_100011935 | |||
| 415 | Ga0075429_100029639 | |||
| 416 | Ga0075436_100054468 | |||
| 417 | Ga0097620_100073705 | |||
| 418 | Ga0097620_100108146 | |||
| 419 | Ga0097620_100255572 | |||
| 420 | Ga0097620_100444816 | |||
| 421 | Ga0075435_100004132 | |||
| 422 | Ga0075435_100045393 | |||
| 423 | Ga0075435_100175924 | |||
| 424 | Ga0099794_10002520 | |||
| 425 | Ga0111539_10032553 | |||
| 426 | Ga0111539_10187129 | |||
| 427 | Ga0105245_10109743 | |||
| 428 | Ga0114129_10004455 | |||
| 429 | Ga0114129_10007024 | |||
| 430 | Ga0114129_10015789 | |||
| 431 | Ga0114129_10047164 | |||
| 432 | Ga0114129_10051560 | |||
| 433 | Ga0114129_10485998 | |||
| 434 | Ga0105243_10241356 | |||
| 435 | Ga0105241_10088516 | |||
| 436 | Ga0105248_10005844 | |||
| 437 | Ga0105238_10088693 | |||
| 438 | Ga0105238_10308191 | |||
| 439 | Ga0105249_10037167 | |||
| 440 | Ga0105033_103420 | |||
| 441 | Ga0099796_10000369 | |||
| 442 | Ga0105246_10429854 | |||
| 443 | Ga0157378_10002274 | |||
| 444 | Ga0163162_10065430 | |||
| 445 | Ga0163162_10189206 | |||
| 446 | Ga0157375_10153294 | |||
| 447 | Ga0157375_10166352 | |||
| 448 | Ga0157376_10744340 | |||
| 449 | Ga0163161_10049860 | |||
| 450 | Ga0163161_10138120 | |||
| 451 | Ga0213876_10038545 | |||
| 452 | Ga0213871_10001901 | |||
| 453 | Ga0209130_1000967 | |||
| 454 | Ga0209025_1000327 | |||
| 455 | Ga0209758_1000070 | |||
| 456 | Ga0209758_1012594 | |||
| 457 | Ga0209050_1006759 | |||
| 458 | Ga0207426_1000080 | |||
| 459 | Ga0209051_1019115 | |||
| 460 | Ga0209257_1000296 | |||
| 461 | Ga0207692_10026369 | |||
| 462 | Ga0207692_10105012 | |||
| 463 | Ga0207642_10074026 | |||
| 464 | Ga0207684_10012118 | |||
| 465 | Ga0207684_10022785 | |||
| 466 | Ga0207684_10027040 | |||
| 467 | Ga0207684_10166987 | |||
| 468 | Ga0207684_10174395 | |||
| 469 | Ga0207646_10074889 | |||
| 470 | Ga0207694_10053576 | |||
| 471 | Ga0207664_10009899 | |||
| 472 | Ga0207706_10011891 | |||
| 473 | Ga0207709_10065046 | |||
| 474 | Ga0207670_10020648 | |||
| 475 | Ga0207711_10104221 | |||
| 476 | Ga0207689_10247751 | |||
| 477 | Ga0207641_10103072 | |||
| 478 | Ga0207641_10401758 | |||
| 479 | Ga0207648_10107476 | |||
| 480 | Ga0207648_10148007 | |||
| 481 | Ga0207676_10241331 | |||
| 482 | Ga0207674_10115228 | |||
| 483 | Ga0207675_100061062 | |||
| 484 | Ga0207428_10000283 | |||
| 485 | Ga0207428_10045574 | |||
| 486 | Ga0268266_10043527 | |||
| 487 | Ga0307517_10104230 | |||
| 488 | Ga0307513_10225898 | |||
| 489 | Ga0307509_10000070 | |||
| 490 | Ga0307408_100108233 | |||
| 491 | Ga0307408_100246026 | |||
| 492 | Ga0307508_10027862 | |||
| 493 | Ga0307508_10053743 | |||
| 494 | Ga0307508_10219382 | |||
| 495 | Ga0307516_10267866 | |||
| 496 | Ga0307405_10003456 | |||
| 497 | Ga0307413_10006463 | |||
| 498 | Ga0307410_10054028 | |||
| 499 | Ga0307410_10077998 | |||
| 500 | Ga0307406_10027529 | |||
| 501 | Ga0307407_10026971 | |||
| 502 | Ga0307409_100264235 | |||
| 503 | Ga0307416_100093395 | |||
| 504 | Ga0307411_10121069 | |||
| 505 | Ga0307415_100049147 | |||
| 506 | Ga0373934_0002789 | |||
| 507 | Ga0373932_0002563 | |||
| 508 | Ga0373953_0002456 | |||
| 509 | Ga0373954_0000874 | |||
| 510 | Ga0373956_0004611 | |||
| 511 | Ga0373957_0032937 | |||
| 512 | Ga0373955_0013452 | |||
| 513 | Ga0373955_0157479 | |||
| 514 | Ga0373924_0053999 | |||
| 515 | Ga0373931_0008277 | |||
| 516 | Ga0373931_0008952 | |||
| 517 | Ga0373933_0000334 | |||
| 518 | Ga0373947_0172509 | |||
| 519 | Ga0373937_0002197 | |||
| 520 | Ga0373925_0179302 | |||
| 521 | Ga0395900_0230675 | |||
| 522 | Ga0395905_0347966 | |||
| 523 | Ga0436364_0502575 | |||
| 524 | Ga0436365_0972088 | |||
| 525 | Ga0436360_0640251 | |||
| 526 | Ga0436361_0270081 | |||
| 527 | Ga0451577_0084082 | |||
| 528 | Ga0451576_0024794 | |||
| 529 | Ga0451576_0176364 | |||
| 530 | Ga0451576_0796334 | |||
| 531 | Ga0495629_0145587 | |||
| 532 | Ga0495638_0139091 | |||
| 533 | Ga0495641_0044986 | |||
| 534 | Ga0495580_0002492 | |||
| 535 | Ga0495580_0105796 | |||
| 536 | Ga0495584_0083659 | |||
| 537 | Ga0495594_0135439 | |||
| 538 | Ga0495608_0014591 | |||
| 539 | Ga0495610_0027122 | |||
| 540 | Ga0495618_0229589 | |||
| 541 | Ga0495587_0003027 | |||
| 542 | Ga0495622_0054876 | |||
| 543 | Ga0495667_0076959 | |||
| 544 | Ga0495656_0043960 | |||
| 545 | Ga0495649_0063061 | |||
| 546 | Ga0495604_0010317 | |||
| 547 | Ga0495674_0261268 | |||
| 548 | Ga0495680_0128956 | |||
| 549 | Ga0495602_0043852 | |||
| 550 | Ga0496102_0105781 | |||
| 551 | Ga0496103_0011819 | |||
| 552 | Ga0496104_0000667 | |||
| 553 | Ga0496105_0001012 | |||
| 554 | Ga0496106_0044875 | |||
| 555 | Ga0496107_0202026 | |||
| 556 | Ga0496108_0002491 | |||
| 557 | Ga0496109_0003028 | |||
| 558 | Ga0496110_0000149 | |||
| 559 | Ga0496111_0002871 | |||
| 560 | Ga0496112_0012018 | |||
| 561 | Ga0496112_0047778 | |||
| 562 | Ga0496112_0479540 | |||
| 563 | Ga0496113_0001060 | |||
| 564 | Ga0496114_0011177 | |||
| 565 | Ga0496114_0069544 | |||
| 566 | Ga0496115_0026432 | |||
| 567 | Ga0496115_0088053 | |||
| 568 | Ga0496126_0449777 | |||
| 569 | Ga0501036_0487782 | |||
| 570 | Ga0501038_0200411 | |||
| 571 | Ga0501043_0087088 | |||
| 572 | Ga0501047_0015903 | |||
| 573 | Ga0501047_0073990 | |||
| 574 | Ga0501067_0011777 | |||
| 575 | Ga0501068_0024727 | |||
| 576 | Ga0501072_0028660 | |||
| 577 | Ga0501076_0202634 | |||
| 578 | Ga0501079_0239015 | |||
| 579 | Ga0501080_0020414 | |||
| 580 | Ga0501080_0113907 | |||
| 581 | Ga0501080_0124869 | |||
| 582 | Ga0501080_0332669 | |||
| 583 | Ga0501035_0200586 | |||
| 584 | Ga0501044_0066156 | |||
| 585 | nmdc:mga06z11_25212_c1 | |||
| 586 | nmdc:mga05p37_22305_c1 | |||
| 587 | nmdc:mga05p37_225360_c1 | |||
| 588 | nmdc:mga05p37_32448_c1 | |||
| 589 | nmdc:mga05p37_672242_c1 | |||
| 590 | nmdc:mga05p37_81960_c1 | |||
| 591 | nmdc:mga09592_16631_c1 | |||
| 592 | nmdc:mga09592_242311_c1 | |||
| 593 | nmdc:mga09592_243841_c1 | |||
| 594 | nmdc:mga06r32_232845_c1 | |||
| 595 | nmdc:mga06r32_39228_c1 | |||
| 596 | nmdc:mga08y16_24788_c1 | |||
| 597 | nmdc:mga08y16_269505_c1 | |||
| 598 | nmdc:mga0n895_19033_c1 | |||
| 599 | nmdc:mga0n895_210596_c1 | |||
| 600 | nmdc:mga0n895_26768_c1 | |||
| 601 | nmdc:mga0n895_65904_c1 | |||
| 602 | nmdc:mga0rr50_154933_c1 | |||
| 603 | nmdc:mga0rr50_22797_c1 | |||
| 604 | nmdc:mga0rr50_8885_c1 | |||
| 605 | nmdc:mga08x19_132004_c1 | |||
| 606 | nmdc:mga08x19_27989_c1 | |||
| 607 | nmdc:mga0a205_10523_c1 | |||
| 608 | nmdc:mga0a205_24578_c1 | |||
| 609 | nmdc:mga0a205_5820_c1 | |||
| 610 | nmdc:mga0a205_8702_c2 | |||
| 611 | Ga0500635_0025055 | |||
| 612 | Ga0495619_0244992 | |||
| 613 | Ga0500578_0026108 | |||
| 614 | Ga0500651_0016307 | |||
| 615 | Ga0500566_0026598 | |||
| 616 | Ga0500554_007932 | |||
| 617 | Ga0500555_001224 | |||
| 618 | Ga0500595_001833 | |||
| 619 | Ga0500597_031566 | |||
| 620 | Ga0500642_0001280 | |||
| 621 | Ga0500642_0077330 | |||
| 622 | Ga0500658_0003437 | |||
| 623 | Ga0500568_0013499 | |||
| 624 | Ga0500568_0017314 | |||
| 625 | Ga0500616_0000666 | |||
| 626 | Ga0500609_004577 | |||
| 627 | Ga0501082_0000503 | |||
| 628 | Ga0501082_0350299 | |||
| 629 | 2508734701 | |||
| 630 | 2509115191 | |||
| 631 | 2512932980 | |||
| 632 | 2512961000 | |||
| 633 | 2588519033 | |||
| 634 | 2821444819 | |||
| 635 | 2844535208 | |||
| 636 | 2856322696 | |||
| 637 | 2857356585 | |||
| 638 | 2869285786 | |||
| 639 | 2874141900 | |||
| 640 | 2876364773 | |||
| 641 | 2878739361 | |||
| 642 | 2883291926 | |||
| 643 | 2883354906 | |||
| 644 | 2888337986 | |||
| 645 | 2889016179 | |||
| 646 | 2889018781 | |||
| 647 | 2903449240 | |||
| 648 | 2903522491 | |||
| 649 | 2903528870 | |||
| 650 | 2922131866 | |||
| 651 | 2924776882 | |||
| 652 | 2937855420 | |||
| 653 | 2937883517 | |||
| 654 | 2937973504 | |||
| 655 | 2958041802 | |||
| 656 | 2958050333 | |||
| 657 | 2958065908 | |||
| 658 | 2958090685 | |||
| 659 | 2958100603 | |||
| 660 | 2958103536 | |||
| 661 | 2958148489 | |||
| 662 | 2958175655 | |||
| 663 | 2963646229 | |||
| 664 | 2968016701 | |||
| 665 | 2968085303 | |||
| 666 | 2968123225 | |||
| 667 | 2970470043 | |||
| 668 | 2970600403 | |||
| 669 | 2977928874 | |||
| 670 | 2977943085 | |||
| 671 | 2977988878 | |||
| 672 | 2979712327 | |||
| 673 | 2987643865 | |||
| 674 | 2987652733 | |||
| 675 | 2996353028 | |||
| 676 | 3004208014 | |||
| 677 | 3004211518 | |||
| 678 | 3004224933 | |||
| 679 | 3004279710 | |||
| 680 | 3004290557 | |||
| 681 | 3004336189 | |||
| 682 | 637076060 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gn2-assembly1.cif.gz_A | crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) | 0.9389 | 1 | 306 |
| 5cvc-assembly2.cif.gz_B-2 | structure of maize serine racemase | 0.9247 | 7 | 313 |
| 5cvc-assembly1.cif.gz_A | structure of maize serine racemase | 0.9215 | 7 | 312 |
| 2zpu-assembly1.cif.gz_A | crystal structure of modified serine racemase from s.pombe. | 0.9192 | 7 | 306 |
| 2gn2-assembly1.cif.gz_A | crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) | 0.9128 | 1 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WC99_42_136_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9669 | 73 | 149 | 3.40.50.1100 |
| af_Q2G0V4_40_140_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9566 | 74 | 147 | 3.40.50.1100 |
| af_P09367_100_172_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9549 | 83 | 149 | 3.40.50.1100 |
| af_Q9VHF0_106_202_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9547 | 56 | 149 | 3.40.50.1100 |
| 2gn1B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9518 | 57 | 147 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528ARW6-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9912 | 162 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 GO:0016020 |
| AF-A0A529C3W7-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9864 | 131 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A520GST4-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.981 | 64 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A1G5DT08-F1-model_v4 | Threonine dehydratase | 0.9807 | 2 | 306 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A1I5U030-F1-model_v4 | Threonine dehydratase | 0.98 | 7 | 314 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |