F414679

General Info

Members Datasets Scaffolds Average Seq Length
341 232 682 118

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10968704|Ga0081455_109687041
Length 141
Sequence MNFWETITGSDLTREWKVFEARAQALPADYQAAWQEVKGGLFPYGGFTGRNLMPILDASLGLLEEGSADGLSIDEVLGDDIPGFCRALAGGEGARTYRDRWREQLNRNVARKLGRPAPVSKGSASDATADPRFGSPRSDPS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
66 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
67 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
192 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
196 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
197 2643221647 Streptomyces sp. Root369 Isolate Unclassified
198 2643221670 Streptomyces sp. Root431 Isolate Unclassified
199 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
200 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
201 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
202 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
203 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
204 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
205 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
206 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
207 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
208 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
209 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
210 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
211 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
212 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
213 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
214 2891562705 Microbispora tritici MT50 Isolate Unclassified
215 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
216 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
217 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
218 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
219 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
220 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
221 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
222 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
223 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
224 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
225 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
226 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
227 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
228 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
229 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
230 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
231 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
232 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.27
Metatranscriptomes 0.59
Isolates 11.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 2.93
Rhizosphere 74.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10968704 3300005937 Bacteria 527
2 JGI24739J22299_10097580 3300001989 Bacteria 889
3 JGI25406J46586_10005485 3300003203 Bacteria 5881
4 rootH2_10106357 3300003320 Bacteria 3833
5 Ga0070658_11302082 3300005327 Bacteria 631
6 Ga0070682_101651259 3300005337 Bacteria 555
7 Ga0070661_100767804 3300005344 Bacteria 789
8 Ga0070661_100814390 3300005344 Bacteria 767
9 Ga0070668_100000254 3300005347 Bacteria 35369
10 Ga0070668_100005351 3300005347 Bacteria 9528
11 Ga0070668_100046282 3300005347 Bacteria 3340
12 Ga0070674_101661709 3300005356 Bacteria 577
13 Ga0070667_100454189 3300005367 Bacteria 1171
14 Ga0070667_100574831 3300005367 Bacteria 1037
15 Ga0070709_11135503 3300005434 Bacteria 626
16 Ga0070714_100014226 3300005435 Bacteria 6389
17 Ga0070714_100259475 3300005435 Bacteria 1609
18 Ga0070714_101273042 3300005435 Bacteria 718
19 Ga0070713_100030524 3300005436 Bacteria 4281
20 Ga0070713_100683854 3300005436 Bacteria 979
21 Ga0070663_100000060 3300005455 Bacteria 47085
22 Ga0070684_100719711 3300005535 Bacteria 931
23 Ga0068853_100138308 3300005539 Bacteria 2185
24 Ga0070686_100289939 3300005544 Bacteria 1210
25 Ga0070665_100114460 3300005548 Bacteria 2700
26 Ga0070664_101103960 3300005564 Bacteria 747
27 Ga0068857_101257319 3300005577 Bacteria 718
28 Ga0068852_101170155 3300005616 Bacteria 790
29 Ga0068859_100023200 3300005617 Bacteria 6226
30 Ga0068861_100819739 3300005719 Bacteria 875
31 Ga0068861_100844405 3300005719 Bacteria 863
32 Ga0068863_101421385 3300005841 Bacteria 702
33 Ga0081455_10152732 3300005937 Bacteria 1778
34 Ga0081538_10046343 3300005981 Bacteria 2682
35 Ga0081539_10000186 3300005985 Bacteria 147547
36 Ga0070712_100023938 3300006175 Bacteria 4040
37 Ga0097620_100023200 3300006931 Bacteria 6226
38 Ga0105251_10044616 3300009011 Bacteria 2141
39 Ga0105247_10002378 3300009101 Bacteria 12814
40 Ga0105243_12844529 3300009148 Bacteria 524
41 Ga0105248_10006818 3300009177 Bacteria 12518
42 Ga0105237_10634794 3300009545 Bacteria 1075
43 Ga0105238_11152343 3300009551 Bacteria 799
44 Ga0105249_10901445 3300009553 Bacteria 951
45 Ga0105246_10236119 3300011119 Bacteria 1443
46 Ga0157371_10245131 3300013102 Bacteria 1290
47 Ga0157370_10283864 3300013104 Bacteria 1529
48 Ga0157369_10231706 3300013105 Bacteria 1931
49 Ga0157372_10128288 3300013307 Bacteria 2917
50 Ga0157372_10522872 3300013307 Bacteria 1383
51 Ga0163163_13113461 3300014325 Bacteria 517
52 Ga0157379_10204614 3300014968 Bacteria 1786
53 Ga0207692_10228715 3300025898 Bacteria 1106
54 Ga0207710_10001151 3300025900 Bacteria 13478
55 Ga0207699_10034311 3300025906 Bacteria 2877
56 Ga0207699_10668771 3300025906 Bacteria 759
57 Ga0207693_10259888 3300025915 Bacteria 1362
58 Ga0207663_10401668 3300025916 Bacteria 1048
59 Ga0207681_11378243 3300025923 Bacteria 592
60 Ga0207700_10293374 3300025928 Bacteria 1402
61 Ga0207700_10496455 3300025928 Bacteria 1080
62 Ga0207664_10526136 3300025929 Bacteria 1060
63 Ga0207711_10043845 3300025941 Bacteria 3817
64 Ga0207679_10932847 3300025945 Bacteria 795
65 Ga0207668_10001159 3300025972 Bacteria 15663
66 Ga0207668_10019713 3300025972 Bacteria 4269
67 Ga0207668_10059702 3300025972 Bacteria 2673
68 Ga0207703_10763747 3300026035 Bacteria 921
69 Ga0207639_10056483 3300026041 Bacteria 3009
70 Ga0207678_10000040 3300026067 Bacteria 100102
71 Ga0207678_11161665 3300026067 Bacteria 684
72 Ga0207641_10390518 3300026088 Bacteria 1335
73 Ga0207675_101041539 3300026118 Bacteria 837
74 Ga0207675_101414563 3300026118 Bacteria 716
75 Ga0268266_10075197 3300028379 Bacteria 2934
76 Ga0268265_10029111 3300028380 Bacteria 3962
77 Ga0268264_11345694 3300028381 Bacteria 724
78 Ga0307517_10382959 3300028786 Bacteria 751
79 Ga0307517_10384677 3300028786 Bacteria 748
80 Ga0307515_10000476 3300028794 Bacteria 95453
81 Ga0307515_10034706 3300028794 Bacteria 8241
82 Ga0307515_10055553 3300028794 Bacteria 5782
83 Ga0307515_10178379 3300028794 Bacteria 2085
84 Ga0307515_10216647 3300028794 Bacteria 1743
85 Ga0265338_10078599 3300028800 Bacteria 2782
86 Ga0307511_10047504 3300030521 Bacteria 3510
87 Ga0307511_10174689 3300030521 Bacteria 1172
88 Ga0307512_10002606 3300030522 Bacteria 22354
89 Ga0307512_10282697 3300030522 Bacteria 791
90 Ga0265760_10224927 3300031090 Bacteria 641
91 Ga0265325_10309932 3300031241 Bacteria 703
92 Ga0307513_10300205 3300031456 Bacteria 1373
93 Ga0307509_10007003 3300031507 Bacteria 14931
94 Ga0307509_10017663 3300031507 Bacteria 8201
95 Ga0307509_10212076 3300031507 Bacteria 1760
96 Ga0307508_10072147 3300031616 Bacteria 3027
97 Ga0307508_10112496 3300031616 Bacteria 2322
98 Ga0307508_10126998 3300031616 Bacteria 2153
99 Ga0307508_10492773 3300031616 Bacteria 820
100 Ga0307514_10336582 3300031649 Bacteria 816
101 Ga0307514_10365162 3300031649 Bacteria 760
102 Ga0307516_10001584 3300031730 Bacteria 31288
103 Ga0307516_10020000 3300031730 Bacteria 6922
104 Ga0307516_10072679 3300031730 Bacteria 3297
105 Ga0307516_10113476 3300031730 Bacteria 2508
106 Ga0307405_10114772 3300031731 Bacteria 1831
107 Ga0307413_11108343 3300031824 Bacteria 684
108 Ga0307518_10006079 3300031838 Bacteria 8646
109 Ga0307518_10117650 3300031838 Bacteria 1885
110 Ga0307518_10210908 3300031838 Bacteria 1279
111 Ga0307518_10471397 3300031838 Bacteria 661
112 Ga0307410_11239365 3300031852 Bacteria 651
113 Ga0307410_11424129 3300031852 Bacteria 609
114 Ga0307409_100361743 3300031995 Bacteria 1373
115 Ga0307416_100197995 3300032002 Bacteria 1903
116 Ga0307416_100898244 3300032002 Bacteria 986
117 Ga0307415_101457783 3300032126 Bacteria 653
118 Ga0307507_10003351 3300033179 Bacteria 31361
119 Ga0307507_10280597 3300033179 Bacteria 1042
120 Ga0307507_10673035 3300033179 Bacteria 521
121 Ga0373938_0066561 3300034957 Bacteria 853
122 Ga0373956_0172205 3300035119 Bacteria 1022
123 Ga0373957_0300970 3300035120 Bacteria 680
124 Ga0373955_0047940 3300035172 Bacteria 2315
125 Ga0373962_0027015 3300035242 Bacteria 1550
126 Ga0373935_0060921 3300035692 Bacteria 2415
127 Ga0373935_0490221 3300035692 Bacteria 891
128 Ga0373933_0070469 3300035724 Bacteria 2127
129 Ga0373937_0095874 3300036401 Bacteria 2751
130 Ga0373937_0366873 3300036401 Bacteria 1365
131 Ga0372808_048657 3300036459 Bacteria 607
132 Ga0373925_0044785 3300037068 Bacteria 3286
133 Ga0373925_0045829 3300037068 Bacteria 3249
134 Ga0451791_0812950 3300041451 Bacteria 2198
135 Ga0451800_1558109 3300041459 Bacteria 624
136 Ga0451802_1277495 3300041460 Bacteria 616
137 Ga0451837_0424499 3300041494 Bacteria 697
138 Ga0451851_0479081 3300041507 Bacteria 566
139 Ga0451853_2227904 3300041512 Bacteria 1615
140 Ga0451853_3177871 3300041512 Bacteria 583
141 Ga0466969_0034007 3300044656 Bacteria 2584
142 Ga0466969_0163545 3300044656 Bacteria 1022
143 Ga0466969_0189704 3300044656 Bacteria 939
144 Ga0466966_0359587 3300044684 Bacteria 875
145 Ga0466961_0024564 3300044693 Bacteria 3877
146 Ga0453684_1258767 3300044712 Bacteria 774
147 Ga0466970_0029650 3300044765 Bacteria 2882
148 Ga0466960_0685794 3300044901 Bacteria 614
149 Ga0466959_0980849 3300045049 Bacteria 563
150 Ga0466967_0133318 3300045976 Bacteria 2308
151 Ga0495592_0002986 3300046454 Bacteria 12038
152 Ga0495592_0056539 3300046454 Bacteria 2899
153 Ga0495592_0609573 3300046454 Bacteria 665
154 Ga0495592_0671438 3300046454 Bacteria 626
155 Ga0495603_0002716 3300046455 Bacteria 10431
156 Ga0495603_0004746 3300046455 Bacteria 8117
157 Ga0495603_0765617 3300046455 Bacteria 551
158 Ga0495629_0000792 3300046459 Bacteria 25521
159 Ga0495629_0006812 3300046459 Bacteria 8446
160 Ga0495638_0355510 3300046460 Bacteria 772
161 Ga0495651_0003849 3300046462 Bacteria 11471
162 Ga0495651_0005025 3300046462 Bacteria 10107
163 Ga0495651_0022102 3300046462 Bacteria 4945
164 Ga0495651_0293582 3300046462 Bacteria 1093
165 Ga0495653_0115196 3300046463 Bacteria 1924
166 Ga0495664_0050453 3300046477 Bacteria 2471
167 Ga0495664_0200590 3300046477 Bacteria 1209
168 Ga0495585_0058041 3300046492 Bacteria 2135
169 Ga0495594_0000294 3300046499 Bacteria 24440
170 Ga0495594_0132670 3300046499 Bacteria 1411
171 Ga0495606_0000332 3300046507 Bacteria 81774
172 Ga0495608_0253605 3300046511 Bacteria 1096
173 Ga0495618_0004828 3300046514 Bacteria 8235
174 Ga0495618_0291897 3300046514 Bacteria 1015
175 Ga0495620_0149798 3300046515 Bacteria 910
176 Ga0495628_0004055 3300046516 Bacteria 13033
177 Ga0495628_0077050 3300046516 Bacteria 2594
178 Ga0495630_0402623 3300046517 Bacteria 1048
179 Ga0495632_0099051 3300046519 Bacteria 1375
180 Ga0495648_0091376 3300046524 Bacteria 1703
181 Ga0495666_0079998 3300046526 Bacteria 1547
182 Ga0495652_0001107 3300046529 Bacteria 30520
183 Ga0495652_0003990 3300046529 Bacteria 14289
184 Ga0495652_0007052 3300046529 Bacteria 10384
185 Ga0495640_0270509 3300046533 Bacteria 1060
186 Ga0495640_0476836 3300046533 Bacteria 760
187 Ga0495587_0106140 3300046536 Bacteria 1615
188 Ga0495645_0053320 3300046543 Bacteria 2940
189 Ga0495645_0218786 3300046543 Bacteria 1282
190 Ga0495645_0894509 3300046543 Bacteria 527
191 Ga0495667_0000620 3300046559 Bacteria 22660
192 Ga0495667_0417185 3300046559 Bacteria 845
193 Ga0495667_0419380 3300046559 Bacteria 842
194 Ga0495667_0483011 3300046559 Bacteria 777
195 Ga0495668_0000721 3300046616 Bacteria 39752
196 Ga0495634_0035631 3300046642 Bacteria 3406
197 Ga0495625_0001207 3300046660 Bacteria 32820
198 Ga0495635_0034489 3300046663 Bacteria 3509
199 Ga0495635_0054811 3300046663 Bacteria 2746
200 Ga0495635_0071358 3300046663 Bacteria 2380
201 Ga0495635_0226525 3300046663 Bacteria 1263
202 Ga0495588_0110629 3300046674 Bacteria 1447
203 Ga0495657_0008035 3300046675 Bacteria 8089
204 Ga0495657_0009205 3300046675 Bacteria 7496
205 Ga0495657_0012799 3300046675 Bacteria 6219
206 Ga0495657_0477466 3300046675 Bacteria 728
207 Ga0495599_0023447 3300046678 Bacteria 3859
208 Ga0495623_0013348 3300046679 Bacteria 5328
209 Ga0495623_0035327 3300046679 Bacteria 3204
210 Ga0495646_0056324 3300046680 Bacteria 2357
211 Ga0495646_0299987 3300046680 Bacteria 850
212 Ga0495613_0010042 3300046689 Bacteria 7031
213 Ga0495613_0015383 3300046689 Bacteria 5689
214 Ga0495613_0017929 3300046689 Bacteria 5276
215 Ga0495624_0081101 3300046690 Bacteria 2010
216 Ga0495671_0461688 3300046692 Bacteria 607
217 Ga0495600_0010754 3300046809 Bacteria 5690
218 Ga0495600_0013790 3300046809 Bacteria 5090
219 Ga0495600_0033249 3300046809 Bacteria 3348
220 Ga0495600_0033959 3300046809 Bacteria 3313
221 Ga0495581_0205196 3300047315 Bacteria 1153
222 Ga0495604_0013747 3300047317 Bacteria 6454
223 Ga0495604_0025794 3300047317 Bacteria 4681
224 Ga0495604_0260095 3300047317 Bacteria 1180
225 Ga0495674_0117968 3300047319 Bacteria 2244
226 Ga0495676_0017158 3300047321 Bacteria 6406
227 Ga0495676_0323016 3300047321 Bacteria 1036
228 Ga0495676_1103888 3300047321 Bacteria 504
229 Ga0495680_0001288 3300047322 Bacteria 27343
230 Ga0495680_0004095 3300047322 Bacteria 14038
231 Ga0495683_0009732 3300047323 Bacteria 5111
232 Ga0495675_0067156 3300047444 Bacteria 2266
233 Ga0495675_0102133 3300047444 Bacteria 1794
234 Ga0495675_0326928 3300047444 Bacteria 906
235 Ga0495684_0084819 3300047471 Bacteria 2402
236 Ga0495602_0031670 3300048088 Bacteria 4995
237 Ga0495602_0343341 3300048088 Bacteria 1079
238 Ga0495614_0000687 3300048089 Bacteria 14241
239 Ga0495614_0200569 3300048089 Bacteria 902
240 Ga0495626_0000385 3300048091 Bacteria 45738
241 Ga0496104_0176499 3300048907 Bacteria 2047
242 Ga0496105_0402470 3300048908 Bacteria 1086
243 Ga0496108_0398737 3300048911 Bacteria 1201
244 Ga0496109_0972902 3300048912 Bacteria 786
245 Ga0496110_0174385 3300048913 Bacteria 1951
246 Ga0496110_0688042 3300048913 Bacteria 924
247 Ga0496114_0072298 3300048917 Bacteria 2900
248 Ga0496119_0024875 3300048922 Bacteria 4197
249 Ga0496120_0001870 3300048923 Bacteria 23432
250 Ga0496126_0012313 3300048929 Bacteria 8776
251 Ga0496126_0091315 3300048929 Bacteria 2678
252 Ga0501031_0963341 3300049568 Bacteria 546
253 Ga0501032_0119698 3300049569 Bacteria 1741
254 Ga0501033_0192281 3300049570 Bacteria 1460
255 Ga0501034_0006960 3300049571 Bacteria 12080
256 Ga0501034_0015658 3300049571 Bacteria 7788
257 Ga0501036_0055356 3300049572 Bacteria 3360
258 Ga0501036_0427989 3300049572 Bacteria 1103
259 Ga0501037_0002883 3300049573 Bacteria 12471
260 Ga0501037_0038681 3300049573 Bacteria 3514
261 Ga0501039_0077282 3300049575 Bacteria 2589
262 Ga0501039_0294408 3300049575 Bacteria 1276
263 Ga0501042_0001564 3300049578 Bacteria 13544
264 Ga0501043_0003748 3300049579 Bacteria 12496
265 Ga0501043_0367546 3300049579 Bacteria 1091
266 Ga0501046_0033236 3300049580 Bacteria 4170
267 Ga0501046_0735516 3300049580 Bacteria 694
268 Ga0501047_0135466 3300049581 Bacteria 2343
269 Ga0501047_0577156 3300049581 Bacteria 947
270 Ga0501047_0832375 3300049581 Bacteria 737
271 Ga0501047_1363442 3300049581 Bacteria 524
272 Ga0501048_0001955 3300049582 Bacteria 15666
273 Ga0501048_0185395 3300049582 Bacteria 1475
274 Ga0501069_0528661 3300049585 Bacteria 705
275 Ga0501070_0928916 3300049586 Bacteria 678
276 Ga0501080_1007276 3300049742 Bacteria 722
277 Ga0501044_0347543 3300049823 Bacteria 1403
278 Ga0501044_0392522 3300049823 Bacteria 1301
279 Ga0501044_0455371 3300049823 Bacteria 1185
280 Ga0501044_0717848 3300049823 Bacteria 884
281 Ga0501045_0355867 3300049824 Bacteria 1090
282 Ga0501045_0682004 3300049824 Bacteria 759
283 Ga0495601_0021033 3300053077 Bacteria 3990
284 Ga0495601_0239650 3300053077 Bacteria 1184
285 Ga0495595_0171527 3300053084 Bacteria 1074
286 Ga0495619_0078743 3300053085 Bacteria 2216
287 Ga0495619_0239129 3300053085 Bacteria 1258
288 Ga0500644_0021333 3300053088 Bacteria 1939
289 Ga0500644_0024366 3300053088 Bacteria 1849
290 Ga0500644_0104389 3300053088 Bacteria 1082
291 Ga0500646_0169983 3300053090 Bacteria 733
292 Ga0500646_0179345 3300053090 Bacteria 717
293 Ga0500651_0046510 3300053093 Bacteria 2730
294 Ga0500641_0018709 3300053096 Bacteria 2610
295 Ga0500556_0296820 3300053104 Bacteria 632
296 Ga0500594_0023270 3300053118 Bacteria 1569
297 Ga0500652_024402 3300053131 Bacteria 2308
298 Ga0500658_0250938 3300053134 Bacteria 813
299 Ga0500573_0055414 3300053140 Bacteria 2275
300 Ga0500577_0398935 3300053142 Bacteria 602
301 Ga0500633_0028077 3300053160 Bacteria 1787
302 Ga0500645_082962 3300053730 Bacteria 914
303 Ga0501084_0280489 3300054114 Bacteria 1407
304 2515857633 2515154155 Bacteria 7985436
305 2547410714 2547132111 Bacteria 8013147
306 2644267530 2643221647 Bacteria 10741251
307 2644387822 2643221670 Bacteria 6497041
308 2676484486 2675903059 Bacteria 8644972
309 2768644681 2767802112 Bacteria 6465194
310 2785346718 2784746763 Bacteria 9783172
311 2791914167 2791354901 Bacteria 8322202
312 2819744321 2818991472 Bacteria 10089953
313 2856746290 2856741275 Bacteria 8096094
314 2861524422 2861520306 Bacteria 8348283
315 2862183614 2862178590 Bacteria 8583590
316 2866615512 2866612099 Bacteria 7543886
317 2867317559 2867312974 Bacteria 7058875
318 2867325625 2867319477 Bacteria 7069771
319 2873158716 2873151551 Bacteria 8625867
320 2873319846 2873314349 Bacteria 8512634
321 2884700091 2884693830 Bacteria 11273186
322 2887478863 2887478801 Bacteria 8972725
323 2891563772 2891562705 Bacteria 8039471
324 2895434798 2895427314 Bacteria 13147766
325 2895450686 2895442618 Bacteria 11027144
326 2899360681 2899359706 Bacteria 10940472
327 2915770769 2915768154 Bacteria 8424322
328 2918501902 2918501144 Bacteria 8668083
329 2929223236 2929219909 Bacteria 6984360
330 2935391275 2935390628 Bacteria 7043367
331 2954691769 2954691527 Bacteria 10720516
332 2995466886 2995463766 Bacteria 8577691
333 2997607511 2997600082 Bacteria 9896405
334 8001787460 8001781756 Bacteria 9586736
335 8003319013 8003314358 Bacteria 10575343
336 8008576281 8008574985 Bacteria 7815457
337 8053951141 8053945823 Bacteria 8962862
338 8055067672 8055066027 Bacteria 9479577
339 8056209605 8056207758 Bacteria 8639239
340 8056448684 8056447290 Bacteria 7680491
341 8057571696 8057568493 Bacteria 7221719
342 Ga0081455_10968704
343 JGI24739J22299_10097580
344 JGI25406J46586_10005485
345 rootH2_10106357
346 Ga0070658_11302082
347 Ga0070682_101651259
348 Ga0070661_100767804
349 Ga0070661_100814390
350 Ga0070668_100000254
351 Ga0070668_100005351
352 Ga0070668_100046282
353 Ga0070674_101661709
354 Ga0070667_100454189
355 Ga0070667_100574831
356 Ga0070709_11135503
357 Ga0070714_100014226
358 Ga0070714_100259475
359 Ga0070714_101273042
360 Ga0070713_100030524
361 Ga0070713_100683854
362 Ga0070663_100000060
363 Ga0070684_100719711
364 Ga0068853_100138308
365 Ga0070686_100289939
366 Ga0070665_100114460
367 Ga0070664_101103960
368 Ga0068857_101257319
369 Ga0068852_101170155
370 Ga0068859_100023200
371 Ga0068861_100819739
372 Ga0068861_100844405
373 Ga0068863_101421385
374 Ga0081455_10152732
375 Ga0081538_10046343
376 Ga0081539_10000186
377 Ga0070712_100023938
378 Ga0097620_100023200
379 Ga0105251_10044616
380 Ga0105247_10002378
381 Ga0105243_12844529
382 Ga0105248_10006818
383 Ga0105237_10634794
384 Ga0105238_11152343
385 Ga0105249_10901445
386 Ga0105246_10236119
387 Ga0157371_10245131
388 Ga0157370_10283864
389 Ga0157369_10231706
390 Ga0157372_10128288
391 Ga0157372_10522872
392 Ga0163163_13113461
393 Ga0157379_10204614
394 Ga0207692_10228715
395 Ga0207710_10001151
396 Ga0207699_10034311
397 Ga0207699_10668771
398 Ga0207693_10259888
399 Ga0207663_10401668
400 Ga0207681_11378243
401 Ga0207700_10293374
402 Ga0207700_10496455
403 Ga0207664_10526136
404 Ga0207711_10043845
405 Ga0207679_10932847
406 Ga0207668_10001159
407 Ga0207668_10019713
408 Ga0207668_10059702
409 Ga0207703_10763747
410 Ga0207639_10056483
411 Ga0207678_10000040
412 Ga0207678_11161665
413 Ga0207641_10390518
414 Ga0207675_101041539
415 Ga0207675_101414563
416 Ga0268266_10075197
417 Ga0268265_10029111
418 Ga0268264_11345694
419 Ga0307517_10382959
420 Ga0307517_10384677
421 Ga0307515_10000476
422 Ga0307515_10034706
423 Ga0307515_10055553
424 Ga0307515_10178379
425 Ga0307515_10216647
426 Ga0265338_10078599
427 Ga0307511_10047504
428 Ga0307511_10174689
429 Ga0307512_10002606
430 Ga0307512_10282697
431 Ga0265760_10224927
432 Ga0265325_10309932
433 Ga0307513_10300205
434 Ga0307509_10007003
435 Ga0307509_10017663
436 Ga0307509_10212076
437 Ga0307508_10072147
438 Ga0307508_10112496
439 Ga0307508_10126998
440 Ga0307508_10492773
441 Ga0307514_10336582
442 Ga0307514_10365162
443 Ga0307516_10001584
444 Ga0307516_10020000
445 Ga0307516_10072679
446 Ga0307516_10113476
447 Ga0307405_10114772
448 Ga0307413_11108343
449 Ga0307518_10006079
450 Ga0307518_10117650
451 Ga0307518_10210908
452 Ga0307518_10471397
453 Ga0307410_11239365
454 Ga0307410_11424129
455 Ga0307409_100361743
456 Ga0307416_100197995
457 Ga0307416_100898244
458 Ga0307415_101457783
459 Ga0307507_10003351
460 Ga0307507_10280597
461 Ga0307507_10673035
462 Ga0373938_0066561
463 Ga0373956_0172205
464 Ga0373957_0300970
465 Ga0373955_0047940
466 Ga0373962_0027015
467 Ga0373935_0060921
468 Ga0373935_0490221
469 Ga0373933_0070469
470 Ga0373937_0095874
471 Ga0373937_0366873
472 Ga0372808_048657
473 Ga0373925_0044785
474 Ga0373925_0045829
475 Ga0451791_0812950
476 Ga0451800_1558109
477 Ga0451802_1277495
478 Ga0451837_0424499
479 Ga0451851_0479081
480 Ga0451853_2227904
481 Ga0451853_3177871
482 Ga0466969_0034007
483 Ga0466969_0163545
484 Ga0466969_0189704
485 Ga0466966_0359587
486 Ga0466961_0024564
487 Ga0453684_1258767
488 Ga0466970_0029650
489 Ga0466960_0685794
490 Ga0466959_0980849
491 Ga0466967_0133318
492 Ga0495592_0002986
493 Ga0495592_0056539
494 Ga0495592_0609573
495 Ga0495592_0671438
496 Ga0495603_0002716
497 Ga0495603_0004746
498 Ga0495603_0765617
499 Ga0495629_0000792
500 Ga0495629_0006812
501 Ga0495638_0355510
502 Ga0495651_0003849
503 Ga0495651_0005025
504 Ga0495651_0022102
505 Ga0495651_0293582
506 Ga0495653_0115196
507 Ga0495664_0050453
508 Ga0495664_0200590
509 Ga0495585_0058041
510 Ga0495594_0000294
511 Ga0495594_0132670
512 Ga0495606_0000332
513 Ga0495608_0253605
514 Ga0495618_0004828
515 Ga0495618_0291897
516 Ga0495620_0149798
517 Ga0495628_0004055
518 Ga0495628_0077050
519 Ga0495630_0402623
520 Ga0495632_0099051
521 Ga0495648_0091376
522 Ga0495666_0079998
523 Ga0495652_0001107
524 Ga0495652_0003990
525 Ga0495652_0007052
526 Ga0495640_0270509
527 Ga0495640_0476836
528 Ga0495587_0106140
529 Ga0495645_0053320
530 Ga0495645_0218786
531 Ga0495645_0894509
532 Ga0495667_0000620
533 Ga0495667_0417185
534 Ga0495667_0419380
535 Ga0495667_0483011
536 Ga0495668_0000721
537 Ga0495634_0035631
538 Ga0495625_0001207
539 Ga0495635_0034489
540 Ga0495635_0054811
541 Ga0495635_0071358
542 Ga0495635_0226525
543 Ga0495588_0110629
544 Ga0495657_0008035
545 Ga0495657_0009205
546 Ga0495657_0012799
547 Ga0495657_0477466
548 Ga0495599_0023447
549 Ga0495623_0013348
550 Ga0495623_0035327
551 Ga0495646_0056324
552 Ga0495646_0299987
553 Ga0495613_0010042
554 Ga0495613_0015383
555 Ga0495613_0017929
556 Ga0495624_0081101
557 Ga0495671_0461688
558 Ga0495600_0010754
559 Ga0495600_0013790
560 Ga0495600_0033249
561 Ga0495600_0033959
562 Ga0495581_0205196
563 Ga0495604_0013747
564 Ga0495604_0025794
565 Ga0495604_0260095
566 Ga0495674_0117968
567 Ga0495676_0017158
568 Ga0495676_0323016
569 Ga0495676_1103888
570 Ga0495680_0001288
571 Ga0495680_0004095
572 Ga0495683_0009732
573 Ga0495675_0067156
574 Ga0495675_0102133
575 Ga0495675_0326928
576 Ga0495684_0084819
577 Ga0495602_0031670
578 Ga0495602_0343341
579 Ga0495614_0000687
580 Ga0495614_0200569
581 Ga0495626_0000385
582 Ga0496104_0176499
583 Ga0496105_0402470
584 Ga0496108_0398737
585 Ga0496109_0972902
586 Ga0496110_0174385
587 Ga0496110_0688042
588 Ga0496114_0072298
589 Ga0496119_0024875
590 Ga0496120_0001870
591 Ga0496126_0012313
592 Ga0496126_0091315
593 Ga0501031_0963341
594 Ga0501032_0119698
595 Ga0501033_0192281
596 Ga0501034_0006960
597 Ga0501034_0015658
598 Ga0501036_0055356
599 Ga0501036_0427989
600 Ga0501037_0002883
601 Ga0501037_0038681
602 Ga0501039_0077282
603 Ga0501039_0294408
604 Ga0501042_0001564
605 Ga0501043_0003748
606 Ga0501043_0367546
607 Ga0501046_0033236
608 Ga0501046_0735516
609 Ga0501047_0135466
610 Ga0501047_0577156
611 Ga0501047_0832375
612 Ga0501047_1363442
613 Ga0501048_0001955
614 Ga0501048_0185395
615 Ga0501069_0528661
616 Ga0501070_0928916
617 Ga0501080_1007276
618 Ga0501044_0347543
619 Ga0501044_0392522
620 Ga0501044_0455371
621 Ga0501044_0717848
622 Ga0501045_0355867
623 Ga0501045_0682004
624 Ga0495601_0021033
625 Ga0495601_0239650
626 Ga0495595_0171527
627 Ga0495619_0078743
628 Ga0495619_0239129
629 Ga0500644_0021333
630 Ga0500644_0024366
631 Ga0500644_0104389
632 Ga0500646_0169983
633 Ga0500646_0179345
634 Ga0500651_0046510
635 Ga0500641_0018709
636 Ga0500556_0296820
637 Ga0500594_0023270
638 Ga0500652_024402
639 Ga0500658_0250938
640 Ga0500573_0055414
641 Ga0500577_0398935
642 Ga0500633_0028077
643 Ga0500645_082962
644 Ga0501084_0280489
645 2515857633
646 2547410714
647 2644267530
648 2644387822
649 2676484486
650 2768644681
651 2785346718
652 2791914167
653 2819744321
654 2856746290
655 2861524422
656 2862183614
657 2866615512
658 2867317559
659 2867325625
660 2873158716
661 2873319846
662 2884700091
663 2887478863
664 2891563772
665 2895434798
666 2895450686
667 2899360681
668 2915770769
669 2918501902
670 2929223236
671 2935391275
672 2954691769
673 2995466886
674 2997607511
675 8001787460
676 8003319013
677 8008576281
678 8053951141
679 8055067672
680 8056209605
681 8056448684
682 8057571696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06304

DUF1048

Protein of unknown function (DUF1048)

7

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.8447 17 94
2o3l-assembly2.cif.gz_B crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution 0.7976 17 94
2hh6-assembly1.cif.gz_A-2 crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution 0.6644 1 108
2hh6-assembly1.cif.gz_A-2 crystal structure of bh3980 (10176605) from bacillus halodurans at 2.04 a resolution 0.637 1 108
7tmo-assembly1.cif.gz_C v1 complex lacking subunit c from saccharomyces cerevisiae, state 1 0.5245 42 108
ID Description Score Start End Superfamily
2hh6A00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.6815 2 108 1.10.1900.10
2hh6A00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;c-terminal domain of poly(a) binding protein 0.6698 2 108 1.10.1900.10
af_Q54SX7_107_191_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.4419 9 77 1.10.225.10
3kyiA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.4061 30 104 1.20.120.160
af_Q54SX7_107_191_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.3661 9 77 1.10.225.10
ID Description Score Start End GO Terms
AF-A0A7Y8TJP1-F1-model_v4 deleted 0.9054 2 85
AF-A0A2P9IYM3-F1-model_v4 deleted 0.8753 20 115
AF-A0A2A5SKR3-F1-model_v4 PadR family transcriptional regulator 0.8688 9 90
AF-A0A073K448-F1-model_v4 Cytoplasmic protein 0.8612 9 85
AF-A0A2N1SMU4-F1-model_v4 DUF1048 domain-containing protein 0.8611 1 77

Map