F414641

General Info

Members Datasets Scaffolds Average Seq Length
341 224 332 322

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100089342|Ga0070700_1000893421
Length 372
Sequence VPCLQPAHEGWLEAARSLAAPMRDQYPRGVELHEHGLLRFILNGLARATHDEAQEVTTMVDEILIFGGSGSPKLTLKICEYLNVQPGAGEVLHFSEGNLFVRVNENVRGRRVYLVQSTVFPTNDHFMELLFWVDALKRASAESVTVVMPYFSYAKGDKKDEPRVSIRARVCADAIEAAGADRVVTLDLHTPQIQGFFRIPVDDLYALPVLCAEIVRKQLPNLVVVSPDTGFVKHARKYASFLGTSIAIADKQRKAHDERAEILEIIGEVQGKTALIVDDFTISAGTLANAAAALVQRGAKTVYAAVSHGVFSEGSMERIDASSIQRLLVTDSIETQPVTFSPKIEVVSVAPLFGEAIRRIHNRESISVLFPA

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
4 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.36
Metatranscriptomes 0
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0
Rhizoplane 2.93
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003526 3300001989 Bacteria 5977
2 JGI25154J39366_1000001 3300002738 Bacteria 483450
3 JGI25157J39369_1003810 3300002741 Bacteria 2946
4 JGI25153J46596_10000209 3300003215 Bacteria 52915
5 rootL2_10239542 3300003322 Bacteria 2996
6 rootH1_10051410 3300003323 Bacteria 9750
7 JGI25160J50197_1001331 3300003354 Bacteria 12462
8 JGI25160J50197_1011036 3300003354 Bacteria 3229
9 JGI25160J50197_1014531 3300003354 Bacteria 2630
10 Ga0055526_1018500 3300003771 Bacteria 2597
11 Ga0055528_1000308 3300003790 Bacteria 41407
12 Ga0055530_10000385 3300003791 Bacteria 39749
13 JGI25405J52794_10007841 3300003911 Bacteria 1980
14 Ga0065165_1000053 3300005262 Bacteria 189081
15 Ga0065712_10082216 3300005290 Bacteria 2936
16 Ga0070670_100010228 3300005331 Bacteria 8006
17 Ga0068869_100010908 3300005334 Bacteria 5945
18 Ga0070666_10000041 3300005335 Bacteria 112410
19 Ga0068868_100021634 3300005338 Bacteria 4844
20 Ga0068868_100044522 3300005338 Bacteria 3469
21 Ga0070692_10066432 3300005345 Bacteria 1912
22 Ga0070668_100016300 3300005347 Bacteria 5557
23 Ga0070671_100057097 3300005355 Bacteria 3248
24 Ga0070671_100134397 3300005355 Bacteria 2085
25 Ga0070671_100210375 3300005355 Bacteria 1650
26 Ga0070673_100032575 3300005364 Bacteria 3927
27 Ga0070673_100062969 3300005364 Bacteria 2949
28 Ga0070688_100055079 3300005365 Bacteria 2493
29 Ga0070688_100127598 3300005365 Bacteria 1712
30 Ga0070667_100015407 3300005367 Bacteria 6321
31 Ga0070714_100172763 3300005435 Bacteria 1962
32 Ga0070713_100095480 3300005436 Bacteria 2565
33 Ga0070711_100140341 3300005439 Bacteria 1811
34 Ga0070700_100089342 3300005441 Bacteria 2007
35 Ga0070708_100168423 3300005445 Bacteria 2044
36 Ga0070678_100052900 3300005456 Bacteria 2951
37 Ga0070662_100389044 3300005457 Bacteria 1149
38 Ga0068867_100025817 3300005459 Bacteria 4215
39 Ga0070685_10032604 3300005466 Bacteria 2918
40 Ga0070685_10150834 3300005466 Bacteria 1473
41 Ga0070706_100176388 3300005467 Bacteria 1995
42 Ga0070679_100064783 3300005530 Bacteria 3642
43 Ga0070696_100053148 3300005546 Bacteria 2819
44 Ga0068854_100054584 3300005578 Bacteria 2874
45 Ga0068854_100249527 3300005578 Bacteria 1416
46 Ga0068852_100001933 3300005616 Bacteria 14110
47 Ga0068859_100000083 3300005617 Bacteria 87079
48 Ga0068864_100007013 3300005618 Bacteria 9246
49 Ga0068851_10011807 3300005834 Bacteria 4104
50 Ga0068863_100002508 3300005841 Bacteria 18243
51 Ga0068863_100004369 3300005841 Bacteria 13936
52 Ga0068863_100644199 3300005841 Bacteria 1051
53 Ga0068858_100013991 3300005842 Bacteria 7571
54 Ga0068858_100021786 3300005842 Bacteria 5987
55 Ga0068860_100001253 3300005843 Bacteria 27686
56 Ga0068860_100001680 3300005843 Bacteria 23645
57 Ga0068860_100340053 3300005843 Bacteria 1475
58 Ga0068862_100110586 3300005844 Bacteria 2411
59 Ga0081455_10002209 3300005937 Bacteria 23179
60 Ga0081455_10037345 3300005937 Bacteria 4315
61 Ga0081538_10002033 3300005981 Bacteria 20228
62 Ga0081538_10003859 3300005981 Bacteria 13995
63 Ga0081538_10010725 3300005981 Bacteria 7500
64 Ga0081538_10084907 3300005981 Unclassified 1666
65 Ga0081540_1015872 3300005983 Bacteria 4747
66 Ga0081540_1058467 3300005983 Bacteria 1857
67 Ga0081539_10001841 3300005985 Bacteria 33456
68 Ga0081539_10006812 3300005985 Bacteria 10704
69 Ga0081539_10049146 3300005985 Bacteria 2396
70 Ga0075365_10005048 3300006038 Bacteria 7082
71 Ga0075368_10057711 3300006042 Bacteria 1550
72 Ga0075363_100189252 3300006048 Bacteria 1173
73 Ga0075364_10036197 3300006051 Bacteria 3190
74 Ga0075432_10032774 3300006058 Bacteria 1799
75 Ga0068871_100078402 3300006358 Bacteria 2732
76 Ga0068871_100144977 3300006358 Bacteria 2021
77 Ga0075428_100060171 3300006844 Bacteria 4159
78 Ga0075428_100109309 3300006844 Bacteria 3013
79 Ga0075428_100143520 3300006844 Bacteria 2595
80 Ga0075430_100057820 3300006846 Bacteria 3261
81 Ga0075431_100099756 3300006847 Bacteria 2996
82 Ga0075431_100178616 3300006847 Bacteria 2179
83 Ga0075431_100260886 3300006847 Unclassified 1758
84 Ga0075431_100308922 3300006847 Bacteria 1596
85 Ga0075434_100004403 3300006871 Bacteria 12688
86 Ga0075429_100018125 3300006880 Bacteria 6092
87 Ga0097620_100000083 3300006931 Bacteria 87079
88 Ga0075435_100056732 3300007076 Bacteria 3166
89 Ga0105240_10000570 3300009093 Bacteria 68288
90 Ga0105240_10117027 3300009093 Bacteria 3214
91 Ga0111539_10018886 3300009094 Bacteria 8529
92 Ga0105245_10225025 3300009098 Bacteria 1812
93 Ga0105245_10414657 3300009098 Bacteria 1348
94 Ga0105247_10002836 3300009101 Bacteria 11566
95 Ga0105247_10005313 3300009101 Bacteria 8121
96 Ga0114129_10062517 3300009147 Bacteria 5201
97 Ga0114129_10069841 3300009147 Bacteria 4897
98 Ga0114129_10270999 3300009147 Bacteria 2271
99 Ga0114129_10368764 3300009147 Bacteria 1898
100 Ga0105241_10004753 3300009174 Bacteria 10008
101 Ga0105241_10006957 3300009174 Bacteria 8323
102 Ga0105241_10061988 3300009174 Bacteria 2881
103 Ga0105242_10315096 3300009176 Bacteria 1433
104 Ga0105248_10085837 3300009177 Bacteria 3542
105 Ga0105248_10184641 3300009177 Bacteria 2350
106 Ga0105237_10006828 3300009545 Bacteria 12580
107 Ga0105237_10045930 3300009545 Bacteria 4394
108 Ga0105237_10380177 3300009545 Bacteria 1417
109 Ga0105238_10002790 3300009551 Bacteria 17438
110 Ga0105238_10028787 3300009551 Bacteria 5658
111 Ga0105238_10075124 3300009551 Bacteria 3371
112 Ga0105249_10005296 3300009553 Bacteria 11138
113 Ga0105249_10081482 3300009553 Bacteria 3008
114 Ga0105249_10244811 3300009553 Unclassified 1775
115 Ga0105249_10318288 3300009553 Bacteria 1566
116 Ga0105239_10090948 3300010375 Bacteria 3367
117 Ga0105239_10265376 3300010375 Bacteria 1930
118 Ga0105246_10013044 3300011119 Bacteria 5200
119 Ga0157374_10054665 3300013296 Bacteria 3725
120 Ga0157374_10191964 3300013296 Bacteria 1998
121 Ga0157378_10010984 3300013297 Bacteria 7924
122 Ga0163162_10021365 3300013306 Bacteria 6372
123 Ga0163162_10058836 3300013306 Unclassified 3873
124 Ga0157372_10001575 3300013307 Bacteria 24869
125 Ga0157372_10015076 3300013307 Bacteria 8273
126 Ga0157372_10030286 3300013307 Bacteria 5920
127 Ga0157372_10038013 3300013307 Bacteria 5311
128 Ga0157372_10044119 3300013307 Bacteria 4940
129 Ga0157372_10351226 3300013307 Bacteria 1718
130 Ga0157375_10129127 3300013308 Bacteria 2645
131 Ga0157375_10267797 3300013308 Bacteria 1870
132 Ga0163163_10117046 3300014325 Bacteria 2697
133 Ga0163163_10221957 3300014325 Bacteria 1939
134 Ga0157379_10029581 3300014968 Bacteria 4870
135 Ga0157379_10030727 3300014968 Bacteria 4784
136 Ga0157376_10000200 3300014969 Bacteria 41411
137 Ga0157376_10042400 3300014969 Bacteria 3730
138 Ga0157376_10351441 3300014969 Bacteria 1411
139 Ga0209646_1000002 3300025246 Bacteria 1425781
140 Ga0209026_1000229 3300025250 Bacteria 76521
141 Ga0209673_1000034 3300025273 Bacteria 328788
142 Ga0209564_1022942 3300025295 Bacteria 2186
143 Ga0209564_1034841 3300025295 Bacteria 1468
144 Ga0209758_1000419 3300025297 Bacteria 72133
145 Ga0209758_1036961 3300025297 Bacteria 1896
146 Ga0209050_1000353 3300025298 Bacteria 88509
147 Ga0207426_1000324 3300025302 Bacteria 91661
148 Ga0207426_1000592 3300025302 Bacteria 47901
149 Ga0209051_1017264 3300025303 Bacteria 3230
150 Ga0209257_1002086 3300025304 Bacteria 21027
151 Ga0207656_10035807 3300025321 Bacteria 2080
152 Ga0207710_10049423 3300025900 Bacteria 1884
153 Ga0207680_10000077 3300025903 Bacteria 43842
154 Ga0207680_10188932 3300025903 Bacteria 1397
155 Ga0207684_10117664 3300025910 Bacteria 2277
156 Ga0207654_10003147 3300025911 Bacteria 8341
157 Ga0207654_10092970 3300025911 Bacteria 1843
158 Ga0207695_10000698 3300025913 Bacteria 65751
159 Ga0207695_10005162 3300025913 Bacteria 17482
160 Ga0207671_10001576 3300025914 Bacteria 25992
161 Ga0207671_10002077 3300025914 Bacteria 21915
162 Ga0207694_10176579 3300025924 Bacteria 1731
163 Ga0207687_10165112 3300025927 Bacteria 1703
164 Ga0207700_10037573 3300025928 Bacteria 3508
165 Ga0207644_10099275 3300025931 Bacteria 2184
166 Ga0207691_10318075 3300025940 Bacteria 1335
167 Ga0207689_10001337 3300025942 Bacteria 23740
168 Ga0207712_10002223 3300025961 Bacteria 12627
169 Ga0207712_10230477 3300025961 Bacteria 1486
170 Ga0207658_10019136 3300025986 Bacteria 4735
171 Ga0207658_10029690 3300025986 Bacteria 3864
172 Ga0207703_10003465 3300026035 Bacteria 13209
173 Ga0207639_10084122 3300026041 Bacteria 2527
174 Ga0207678_10192895 3300026067 Bacteria 1741
175 Ga0207708_10015674 3300026075 Bacteria 5686
176 Ga0207641_10000975 3300026088 Bacteria 29289
177 Ga0207641_10056691 3300026088 Bacteria 3330
178 Ga0207648_10064570 3300026089 Bacteria 3191
179 Ga0207648_10286702 3300026089 Bacteria 1473
180 Ga0207676_10034745 3300026095 Bacteria 3818
181 Ga0207676_10163852 3300026095 Bacteria 1929
182 Ga0207674_10131153 3300026116 Bacteria 2469
183 Ga0207683_10052277 3300026121 Bacteria 3579
184 Ga0207698_10308535 3300026142 Bacteria 1476
185 Ga0209813_10043834 3300027866 Bacteria 1372
186 Ga0268264_10003130 3300028381 Bacteria 14340
187 Ga0307517_10015605 3300028786 Bacteria 10076
188 Ga0307515_10000696 3300028794 Bacteria 77574
189 Ga0307515_10062764 3300028794 Bacteria 5238
190 Ga0265338_10181999 3300028800 Bacteria 1601
191 Ga0307511_10000892 3300030521 Bacteria 31389
192 Ga0307509_10073592 3300031507 Bacteria 3557
193 Ga0307408_100008806 3300031548 Bacteria 6664
194 Ga0316576_10138339 3300031727 Bacteria 1833
195 Ga0316578_10050875 3300031728 Bacteria 2425
196 Ga0307516_10001129 3300031730 Bacteria 37193
197 Ga0307516_10109323 3300031730 Bacteria 2570
198 Ga0307405_10025191 3300031731 Bacteria 3411
199 Ga0307410_10086059 3300031852 Bacteria 2220
200 Ga0307406_10041315 3300031901 Bacteria 2873
201 Ga0307406_10042869 3300031901 Bacteria 2827
202 Ga0307407_10000483 3300031903 Bacteria 12255
203 Ga0307409_100006692 3300031995 Bacteria 6810
204 Ga0307409_100014957 3300031995 Bacteria 5071
205 Ga0307416_100001317 3300032002 Bacteria 13371
206 Ga0307415_100370495 3300032126 Bacteria 1212
207 Ga0316583_10000314 3300032133 Bacteria 13598
208 Ga0373931_0029040 3300035691 Bacteria 2836
209 Ga0373927_0005927 3300035695 Bacteria 8369
210 Ga0373937_0334588 3300036401 Bacteria 1433
211 Ga0316582_0017456 3300036647 Bacteria 4154
212 Ga0373925_0001072 3300037068 Bacteria 24683
213 Ga0395898_0346681 3300037466 Unclassified 1416
214 Ga0400489_02188 3300039093 Bacteria 3727
215 Ga0439465_0003537 3300041413 Bacteria 5092
216 Ga0439431_0002865 3300041997 Bacteria 3794
217 Ga0439463_021129 3300042016 Bacteria 1625
218 Ga0439458_0034497 3300042157 Bacteria 1214
219 Ga0466972_0000050 3300044658 Bacteria 118759
220 Ga0453683_0060697 3300044673 Bacteria 2364
221 Ga0466965_0074759 3300044683 Bacteria 1708
222 Ga0466966_0146789 3300044684 Bacteria 1440
223 Ga0466963_0001131 3300044694 Bacteria 13925
224 Ga0453684_0000769 3300044712 Bacteria 110832
225 Ga0453684_0025708 3300044712 Bacteria 8536
226 Ga0453684_0087046 3300044712 Bacteria 3873
227 Ga0466970_0027475 3300044765 Bacteria 2986
228 Ga0466957_0076602 3300044842 Bacteria 2077
229 Ga0466960_0001266 3300044901 Bacteria 9148
230 Ga0451576_0000684 3300045051 Bacteria 68989
231 Ga0451576_0048453 3300045051 Unclassified 4463
232 Ga0466958_0019577 3300045836 Bacteria 3941
233 Ga0466958_0024297 3300045836 Bacteria 3565
234 Ga0466958_0078339 3300045836 Bacteria 2031
235 Ga0466967_0017110 3300045976 Bacteria 5743
236 Ga0466967_0034176 3300045976 Bacteria 4312
237 Ga0466967_0065641 3300045976 Bacteria 3231
238 Ga0466967_0411851 3300045976 Bacteria 1316
239 Ga0495638_0098561 3300046460 Bacteria 1751
240 Ga0495630_0184831 3300046517 Bacteria 1590
241 Ga0495652_0325540 3300046529 Bacteria 1109
242 Ga0495672_0041412 3300047320 Bacteria 2786
243 Ga0495684_0130045 3300047471 Bacteria 1892
244 Ga0496102_0246927 3300048905 Bacteria 1683
245 Ga0496106_0032701 3300048909 Bacteria 3879
246 Ga0496108_0013988 3300048911 Bacteria 6546
247 Ga0496108_0136702 3300048911 Bacteria 2109
248 Ga0496109_0033389 3300048912 Bacteria 4629
249 Ga0496109_0591979 3300048912 Bacteria 1045
250 Ga0496111_0048454 3300048914 Bacteria 3061
251 Ga0496112_0016538 3300048915 Bacteria 6915
252 Ga0496114_0119528 3300048917 Bacteria 2265
253 Ga0496114_0284676 3300048917 Bacteria 1458
254 Ga0501033_0026709 3300049570 Bacteria 4343
255 Ga0501034_0396993 3300049571 Bacteria 1302
256 Ga0501036_0102057 3300049572 Bacteria 2426
257 Ga0501037_0032889 3300049573 Bacteria 3832
258 Ga0501037_0053683 3300049573 Bacteria 2948
259 Ga0501039_0007604 3300049575 Bacteria 8277
260 Ga0501040_0005140 3300049576 Bacteria 8463
261 Ga0501041_0009928 3300049577 Bacteria 5607
262 Ga0501042_0016097 3300049578 Bacteria 5131
263 Ga0501043_0012602 3300049579 Bacteria 6613
264 Ga0501046_0015167 3300049580 Bacteria 6479
265 Ga0501046_0160722 3300049580 Bacteria 1690
266 Ga0501046_0190144 3300049580 Bacteria 1532
267 Ga0501047_0047328 3300049581 Bacteria 4156
268 Ga0501047_0083057 3300049581 Bacteria 3079
269 Ga0501047_0152432 3300049581 Bacteria 2186
270 Ga0501048_0005876 3300049582 Bacteria 9339
271 Ga0501067_0000277 3300049583 Bacteria 28071
272 Ga0501067_0008288 3300049583 Bacteria 5771
273 Ga0501068_0000494 3300049584 Bacteria 20035
274 Ga0501068_0012086 3300049584 Bacteria 4886
275 Ga0501068_0057152 3300049584 Unclassified 2365
276 Ga0501069_0000788 3300049585 Bacteria 14910
277 Ga0501069_0060149 3300049585 Bacteria 2120
278 Ga0501071_0014269 3300049587 Bacteria 5434
279 Ga0501071_0071759 3300049587 Unclassified 2525
280 Ga0501071_0102025 3300049587 Bacteria 2115
281 Ga0501072_0035983 3300049588 Bacteria 3881
282 Ga0501073_0008337 3300049589 Bacteria 7687
283 Ga0501073_0266807 3300049589 Bacteria 1181
284 Ga0501074_0003612 3300049590 Bacteria 10981
285 Ga0501074_0014344 3300049590 Bacteria 5765
286 Ga0501074_0121332 3300049590 Bacteria 1869
287 Ga0501075_0091947 3300049591 Bacteria 2302
288 Ga0501075_0241388 3300049591 Bacteria 1377
289 Ga0501075_0250996 3300049591 Bacteria 1348
290 Ga0501076_0017683 3300049592 Bacteria 5419
291 Ga0501076_0272001 3300049592 Bacteria 1387
292 Ga0501077_0058330 3300049593 Bacteria 2450
293 Ga0501079_0008002 3300049741 Bacteria 8011
294 Ga0501079_0098100 3300049741 Bacteria 2272
295 Ga0501079_0100876 3300049741 Unclassified 2238
296 Ga0501080_0026762 3300049742 Bacteria 5360
297 Ga0501080_0425732 3300049742 Bacteria 1192
298 Ga0501081_0002265 3300049743 Bacteria 12106
299 Ga0501083_0130432 3300049744 Bacteria 1647
300 Ga0501035_0072144 3300049822 Bacteria 3057
301 Ga0501044_0027598 3300049823 Bacteria 5997
302 Ga0501044_0073464 3300049823 Unclassified 3476
303 Ga0501044_0076914 3300049823 Bacteria 3386
304 Ga0501045_0005956 3300049824 Bacteria 8433
305 Ga0501045_0007522 3300049824 Bacteria 7570
306 Ga0501045_0069637 3300049824 Bacteria 2587
307 nmdc:mga03n38_106309_c1 3300050490 Bacteria 1360
308 nmdc:mga00v17_3599_c1 3300050491 Bacteria 7085
309 nmdc:mga04h51_37837_c1 3300050495 Bacteria 1559
310 nmdc:mga05p37_123972_c1 3300050507 Bacteria 3174
311 nmdc:mga05p37_134719_c1 3300050507 Unclassified 3030
312 nmdc:mga05p37_639930_c1 3300050507 Unclassified 1193
313 nmdc:mga05p37_99042_c1 3300050507 Bacteria 3591
314 nmdc:mga05p37_99982_c1 3300050507 Bacteria 3572
315 nmdc:mga09592_48247_c1 3300050508 Bacteria 3590
316 nmdc:mga06r32_1540_c1 3300050510 Bacteria 20758
317 nmdc:mga0n895_361599_c1 3300050512 Bacteria 1470
318 nmdc:mga0n895_9545_c1 3300050512 Bacteria 8499
319 nmdc:mga0rr50_113008_c1 3300050513 Bacteria 2152
320 nmdc:mga0a205_381459_c1 3300050515 Unclassified 1275
321 nmdc:mga0a205_423792_c1 3300050515 Bacteria 1193
322 Ga0500595_000061 3300053119 Bacteria 78756
323 Ga0500655_015739 3300053133 Bacteria 1389
324 Ga0500637_0098074 3300053178 Bacteria 1699
325 Ga0500645_082811 3300053730 Bacteria 915
326 Ga0501084_0002785 3300054114 Bacteria 14118
327 Ga0501082_0270572 3300060353 Bacteria 1479
328 Ga0501082_0335938 3300060353 Bacteria 1316
329 Ga0530510_0004816 3300061734 Bacteria 9338
330 Ga0530510_0014053 3300061734 Bacteria 5645
331 Ga0530510_0024005 3300061734 Bacteria 4349
332 Ga0530510_0115366 3300061734 Bacteria 1969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0098561 Ga0495638_0098561_66_860 264
2 3300053730 Ga0500645_082811 Ga0500645_082811_53_847 264
3 3300013307 Ga0157372_10351226 Ga0157372_103512262 297
4 3300048912 Ga0496109_0591979 Ga0496109_0591979_78_1001 301
5 3300053119 Ga0500595_000061 Ga0500595_000061_65434_66378 302
6 3300005445 Ga0070708_100168423 Ga0070708_1001684233 303
7 3300046529 Ga0495652_0325540 Ga0495652_0325540_133_1065 304
8 3300005290 Ga0065712_10082216 Ga0065712_100822164 305
9 3300005842 Ga0068858_100013991 Ga0068858_1000139915 305
10 3300014969 Ga0157376_10000200 Ga0157376_1000020033 305
11 iso_pu_bacteria 2837183177 2837186671 305
12 iso_pu_bacteria 2861520306 2861522816 306
13 3300006844 Ga0075428_100109309 Ga0075428_1001093092 307
14 3300006847 Ga0075431_100099756 Ga0075431_1000997561 307
15 3300006880 Ga0075429_100018125 Ga0075429_1000181255 307
16 3300035691 Ga0373931_0029040 Ga0373931_0029040_840_1784 307
17 3300035695 Ga0373927_0005927 Ga0373927_0005927_4313_5257 307
18 3300037068 Ga0373925_0001072 Ga0373925_0001072_13767_14711 307
19 3300046517 Ga0495630_0184831 Ga0495630_0184831_623_1567 307
20 3300047471 Ga0495684_0130045 Ga0495684_0130045_622_1566 307
21 3300048917 Ga0496114_0284676 Ga0496114_0284676_58_1008 307
22 3300050508 nmdc:mga09592_48247_c1 nmdc:mga09592_48247_c1_1446_2387 307
23 3300050510 nmdc:mga06r32_1540_c1 nmdc:mga06r32_1540_c1_2070_3011 307
24 3300003911 JGI25405J52794_10007841 JGI25405J52794_100078412 308
25 3300005441 Ga0070700_100089342 Ga0070700_1000893421 308
26 3300005467 Ga0070706_100176388 Ga0070706_1001763882 308
27 3300005937 Ga0081455_10002209 Ga0081455_1000220915 308
28 3300005937 Ga0081455_10037345 Ga0081455_100373453 308
29 3300005981 Ga0081538_10002033 Ga0081538_1000203313 308
30 3300005981 Ga0081538_10003859 Ga0081538_100038593 308
31 3300005981 Ga0081538_10010725 Ga0081538_100107258 308
32 3300005981 Ga0081538_10084907 Ga0081538_100849072 308
33 3300005983 Ga0081540_1015872 Ga0081540_10158724 308
34 3300005983 Ga0081540_1058467 Ga0081540_10584672 308
35 3300005985 Ga0081539_10001841 Ga0081539_1000184119 308
36 3300005985 Ga0081539_10006812 Ga0081539_100068128 308
37 3300005985 Ga0081539_10049146 Ga0081539_100491461 308
38 3300006844 Ga0075428_100060171 Ga0075428_1000601713 308
39 3300006844 Ga0075428_100143520 Ga0075428_1001435201 308
40 3300006846 Ga0075430_100057820 Ga0075430_1000578203 308
41 3300006847 Ga0075431_100178616 Ga0075431_1001786163 308
42 3300006847 Ga0075431_100260886 Ga0075431_1002608862 308
43 3300006847 Ga0075431_100308922 Ga0075431_1003089222 308
44 3300009094 Ga0111539_10018886 Ga0111539_100188866 308
45 3300009147 Ga0114129_10062517 Ga0114129_100625175 308
46 3300009147 Ga0114129_10069841 Ga0114129_100698413 308
47 3300009147 Ga0114129_10270999 Ga0114129_102709992 308
48 3300009147 Ga0114129_10368764 Ga0114129_103687642 308
49 3300009553 Ga0105249_10081482 Ga0105249_100814823 308
50 3300009553 Ga0105249_10244811 Ga0105249_102448112 308
51 3300013306 Ga0163162_10058836 Ga0163162_100588365 308
52 3300013308 Ga0157375_10267797 Ga0157375_102677972 308
53 3300014968 Ga0157379_10030727 Ga0157379_100307276 308
54 3300025910 Ga0207684_10117664 Ga0207684_101176642 308
55 3300025961 Ga0207712_10230477 Ga0207712_102304772 308
56 3300028794 Ga0307515_10062764 Ga0307515_100627645 308
57 3300031548 Ga0307408_100008806 Ga0307408_1000088063 308
58 3300031731 Ga0307405_10025191 Ga0307405_100251911 308
59 3300031852 Ga0307410_10086059 Ga0307410_100860591 308
60 3300031901 Ga0307406_10041315 Ga0307406_100413151 308
61 3300031901 Ga0307406_10042869 Ga0307406_100428692 308
62 3300031903 Ga0307407_10000483 Ga0307407_1000048311 308
63 3300031995 Ga0307409_100006692 Ga0307409_1000066928 308
64 3300031995 Ga0307409_100014957 Ga0307409_1000149576 308
65 3300032002 Ga0307416_100001317 Ga0307416_1000013173 308
66 3300032126 Ga0307415_100370495 Ga0307415_1003704951 308
67 3300039093 Ga0400489_02188 Ga0400489_02188_1087_2034 308
68 3300042016 Ga0439463_021129 Ga0439463_021129_532_1488 308
69 3300042157 Ga0439458_0034497 Ga0439458_0034497_33_989 308
70 3300045836 Ga0466958_0078339 Ga0466958_0078339_72_1019 308
71 3300049570 Ga0501033_0026709 Ga0501033_0026709_1596_2597 308
72 3300049571 Ga0501034_0396993 Ga0501034_0396993_236_1186 308
73 3300049572 Ga0501036_0102057 Ga0501036_0102057_668_1669 308
74 3300049573 Ga0501037_0032889 Ga0501037_0032889_2870_3820 308
75 3300049573 Ga0501037_0053683 Ga0501037_0053683_1910_2911 308
76 3300049575 Ga0501039_0007604 Ga0501039_0007604_3670_4671 308
77 3300049576 Ga0501040_0005140 Ga0501040_0005140_3850_4851 308
78 3300049577 Ga0501041_0009928 Ga0501041_0009928_3725_4726 308
79 3300049578 Ga0501042_0016097 Ga0501042_0016097_388_1389 308
80 3300049579 Ga0501043_0012602 Ga0501043_0012602_2931_3932 308
81 3300049580 Ga0501046_0015167 Ga0501046_0015167_3541_4542 308
82 3300049580 Ga0501046_0160722 Ga0501046_0160722_57_1016 308
83 3300049580 Ga0501046_0190144 Ga0501046_0190144_73_1020 308
84 3300049581 Ga0501047_0047328 Ga0501047_0047328_1609_2559 308
85 3300049581 Ga0501047_0083057 Ga0501047_0083057_1493_2494 308
86 3300049582 Ga0501048_0005876 Ga0501048_0005876_3804_4805 308
87 3300049584 Ga0501068_0012086 Ga0501068_0012086_2299_3300 308
88 3300049587 Ga0501071_0102025 Ga0501071_0102025_717_1718 308
89 3300049588 Ga0501072_0035983 Ga0501072_0035983_2895_3854 308
90 3300049589 Ga0501073_0266807 Ga0501073_0266807_117_1067 308
91 3300049590 Ga0501074_0003612 Ga0501074_0003612_2626_3627 308
92 3300049590 Ga0501074_0014344 Ga0501074_0014344_3868_4824 308
93 3300049591 Ga0501075_0091947 Ga0501075_0091947_568_1569 308
94 3300049591 Ga0501075_0241388 Ga0501075_0241388_394_1338 308
95 3300049591 Ga0501075_0250996 Ga0501075_0250996_313_1272 308
96 3300049592 Ga0501076_0017683 Ga0501076_0017683_3649_4650 308
97 3300049592 Ga0501076_0272001 Ga0501076_0272001_198_1184 308
98 3300049593 Ga0501077_0058330 Ga0501077_0058330_989_1990 308
99 3300049741 Ga0501079_0008002 Ga0501079_0008002_3613_4614 308
100 3300049741 Ga0501079_0098100 Ga0501079_0098100_78_1064 308
101 3300049742 Ga0501080_0425732 Ga0501080_0425732_58_1002 308
102 3300049743 Ga0501081_0002265 Ga0501081_0002265_9184_10185 308
103 3300049823 Ga0501044_0027598 Ga0501044_0027598_2360_3310 308
104 3300049824 Ga0501045_0005956 Ga0501045_0005956_3717_4718 308
105 3300049824 Ga0501045_0007522 Ga0501045_0007522_1411_2367 308
106 3300049824 Ga0501045_0069637 Ga0501045_0069637_1119_2093 308
107 3300050507 nmdc:mga05p37_123972_c1 nmdc:mga05p37_123972_c1_1370_2314 308
108 3300050507 nmdc:mga05p37_134719_c1 nmdc:mga05p37_134719_c1_627_1574 308
109 3300050507 nmdc:mga05p37_639930_c1 nmdc:mga05p37_639930_c1_53_1000 308
110 3300050507 nmdc:mga05p37_99042_c1 nmdc:mga05p37_99042_c1_293_1249 308
111 3300050507 nmdc:mga05p37_99982_c1 nmdc:mga05p37_99982_c1_1573_2652 308
112 3300050515 nmdc:mga0a205_381459_c1 nmdc:mga0a205_381459_c1_186_1133 308
113 3300054114 Ga0501084_0002785 Ga0501084_0002785_725_1726 308
114 3300060353 Ga0501082_0270572 Ga0501082_0270572_119_1093 308
115 3300060353 Ga0501082_0335938 Ga0501082_0335938_110_1066 308
116 3300061734 Ga0530510_0004816 Ga0530510_0004816_3803_4804 308
117 3300061734 Ga0530510_0014053 Ga0530510_0014053_664_1623 308
118 3300061734 Ga0530510_0115366 Ga0530510_0115366_397_1341 308
119 3300005435 Ga0070714_100172763 Ga0070714_1001727633 309
120 3300005436 Ga0070713_100095480 Ga0070713_1000954804 309
121 3300006058 Ga0075432_10032774 Ga0075432_100327742 309
122 3300007076 Ga0075435_100056732 Ga0075435_1000567321 309
123 3300009101 Ga0105247_10005313 Ga0105247_100053138 309
124 3300009177 Ga0105248_10184641 Ga0105248_101846413 309
125 3300014325 Ga0163163_10221957 Ga0163163_102219573 309
126 3300025900 Ga0207710_10049423 Ga0207710_100494233 309
127 3300025928 Ga0207700_10037573 Ga0207700_100375732 309
128 3300026095 Ga0207676_10163852 Ga0207676_101638522 309
129 3300037466 Ga0395898_0346681 Ga0395898_0346681_375_1325 309
130 3300044712 Ga0453684_0000769 Ga0453684_0000769_98470_99438 309
131 3300045051 Ga0451576_0000684 Ga0451576_0000684_55141_56109 309
132 3300045836 Ga0466958_0024297 Ga0466958_0024297_2007_2954 309
133 3300045976 Ga0466967_0065641 Ga0466967_0065641_715_1665 309
134 3300048911 Ga0496108_0013988 Ga0496108_0013988_4941_5906 309
135 3300048915 Ga0496112_0016538 Ga0496112_0016538_2862_3827 309
136 3300050512 nmdc:mga0n895_361599_c1 nmdc:mga0n895_361599_c1_38_988 309
137 3300050513 nmdc:mga0rr50_113008_c1 nmdc:mga0rr50_113008_c1_1036_1986 309
138 3300050515 nmdc:mga0a205_423792_c1 nmdc:mga0a205_423792_c1_78_1028 309
139 3300031728 Ga0316578_10050875 Ga0316578_100508752 310
140 3300036647 Ga0316582_0017456 Ga0316582_0017456_3159_4100 310
141 iso_pu_bacteria 2818991442 2819573252 310
142 iso_pu_bacteria 2821136567 2821136672 310
143 iso_pu_bacteria 2904467357 2904468583 310
144 3300003322 rootL2_10239542 rootL2_102395423 311
145 3300031727 Ga0316576_10138339 Ga0316576_101383392 311
146 3300032133 Ga0316583_10000314 Ga0316583_100003145 311
147 3300036401 Ga0373937_0334588 Ga0373937_0334588_425_1369 311
148 3300044673 Ga0453683_0060697 Ga0453683_0060697_801_1760 311
149 3300045051 Ga0451576_0048453 Ga0451576_0048453_2463_3422 311
150 iso_pu_bacteria 3006988479 3006992003 311
151 3300005546 Ga0070696_100053148 Ga0070696_1000531482 312
152 iso_pu_bacteria 2896109856 2896114850 312
153 iso_pu_bacteria 2929921140 2929922902 312
154 iso_pu_bacteria 8003151029 8003154729 312
155 3300006038 Ga0075365_10005048 Ga0075365_100050482 313
156 3300006042 Ga0075368_10057711 Ga0075368_100577112 313
157 3300006048 Ga0075363_100189252 Ga0075363_1001892521 313
158 3300006051 Ga0075364_10036197 Ga0075364_100361972 313
159 3300027866 Ga0209813_10043834 Ga0209813_100438342 313
160 3300044683 Ga0466965_0074759 Ga0466965_0074759_327_1286 313
161 3300044694 Ga0466963_0001131 Ga0466963_0001131_7865_8824 313
162 3300044901 Ga0466960_0001266 Ga0466960_0001266_3715_4725 313
163 3300045836 Ga0466958_0019577 Ga0466958_0019577_1056_2015 313
164 3300045976 Ga0466967_0017110 Ga0466967_0017110_4408_5370 313
165 3300045976 Ga0466967_0034176 Ga0466967_0034176_1053_2012 313
166 3300045976 Ga0466967_0411851 Ga0466967_0411851_223_1233 313
167 3300050490 nmdc:mga03n38_106309_c1 nmdc:mga03n38_106309_c1_199_1158 313
168 3300050491 nmdc:mga00v17_3599_c1 nmdc:mga00v17_3599_c1_1769_2728 313
169 3300050495 nmdc:mga04h51_37837_c1 nmdc:mga04h51_37837_c1_306_1265 313
170 3300005345 Ga0070692_10066432 Ga0070692_100664322 314
171 3300005365 Ga0070688_100055079 Ga0070688_1000550793 314
172 3300005439 Ga0070711_100140341 Ga0070711_1001403411 314
173 3300005456 Ga0070678_100052900 Ga0070678_1000529002 314
174 3300005457 Ga0070662_100389044 Ga0070662_1003890441 314
175 3300005459 Ga0068867_100025817 Ga0068867_1000258173 314
176 3300005466 Ga0070685_10032604 Ga0070685_100326043 314
177 3300005530 Ga0070679_100064783 Ga0070679_1000647832 314
178 3300005578 Ga0068854_100054584 Ga0068854_1000545843 314
179 3300005841 Ga0068863_100644199 Ga0068863_1006441991 314
180 3300005843 Ga0068860_100340053 Ga0068860_1003400531 314
181 3300006358 Ga0068871_100144977 Ga0068871_1001449773 314
182 3300006871 Ga0075434_100004403 Ga0075434_1000044035 314
183 3300009098 Ga0105245_10225025 Ga0105245_102250252 314
184 3300009174 Ga0105241_10061988 Ga0105241_100619883 314
185 3300009177 Ga0105248_10085837 Ga0105248_100858374 314
186 3300009545 Ga0105237_10380177 Ga0105237_103801772 314
187 3300009551 Ga0105238_10028787 Ga0105238_100287875 314
188 3300009553 Ga0105249_10318288 Ga0105249_103182882 314
189 3300010375 Ga0105239_10265376 Ga0105239_102653762 314
190 3300013307 Ga0157372_10030286 Ga0157372_100302864 314
191 3300013307 Ga0157372_10038013 Ga0157372_100380132 314
192 3300013308 Ga0157375_10129127 Ga0157375_101291273 314
193 3300014969 Ga0157376_10042400 Ga0157376_100424001 314
194 3300025903 Ga0207680_10188932 Ga0207680_101889322 314
195 3300025911 Ga0207654_10092970 Ga0207654_100929701 314
196 3300025924 Ga0207694_10176579 Ga0207694_101765791 314
197 3300025927 Ga0207687_10165112 Ga0207687_101651122 314
198 3300026067 Ga0207678_10192895 Ga0207678_101928952 314
199 3300026075 Ga0207708_10015674 Ga0207708_100156745 314
200 3300026089 Ga0207648_10064570 Ga0207648_100645703 314
201 3300026116 Ga0207674_10131153 Ga0207674_101311532 314
202 3300026121 Ga0207683_10052277 Ga0207683_100522774 314
203 3300028800 Ga0265338_10181999 Ga0265338_101819992 314
204 3300044712 Ga0453684_0025708 Ga0453684_0025708_1094_2086 314
205 3300044712 Ga0453684_0087046 Ga0453684_0087046_77_1066 314
206 3300047320 Ga0495672_0041412 Ga0495672_0041412_189_1133 314
207 3300048905 Ga0496102_0246927 Ga0496102_0246927_603_1619 314
208 3300048909 Ga0496106_0032701 Ga0496106_0032701_1276_2292 314
209 3300048911 Ga0496108_0136702 Ga0496108_0136702_90_1106 314
210 3300048912 Ga0496109_0033389 Ga0496109_0033389_1444_2460 314
211 3300048914 Ga0496111_0048454 Ga0496111_0048454_1403_2419 314
212 3300048917 Ga0496114_0119528 Ga0496114_0119528_744_1760 314
213 3300049583 Ga0501067_0000277 Ga0501067_0000277_14110_15126 314
214 3300049584 Ga0501068_0000494 Ga0501068_0000494_7205_8221 314
215 3300049585 Ga0501069_0000788 Ga0501069_0000788_4417_5433 314
216 3300049587 Ga0501071_0014269 Ga0501071_0014269_3394_4410 314
217 3300050512 nmdc:mga0n895_9545_c1 nmdc:mga0n895_9545_c1_3824_4840 314
218 3300061734 Ga0530510_0024005 Ga0530510_0024005_410_1426 314
219 3300041413 Ga0439465_0003537 Ga0439465_0003537_3559_4512 315
220 3300001989 JGI24739J22299_10003526 JGI24739J22299_100035264 316
221 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001185 316
222 3300002741 JGI25157J39369_1003810 JGI25157J39369_10038103 316
223 3300003215 JGI25153J46596_10000209 JGI25153J46596_100002099 316
224 3300003323 rootH1_10051410 rootH1_100514103 316
225 3300003354 JGI25160J50197_1001331 JGI25160J50197_100133111 316
226 3300003354 JGI25160J50197_1011036 JGI25160J50197_10110363 316
227 3300003354 JGI25160J50197_1014531 JGI25160J50197_10145312 316
228 3300003771 Ga0055526_1018500 Ga0055526_10185002 316
229 3300003790 Ga0055528_1000308 Ga0055528_100030826 316
230 3300003791 Ga0055530_10000385 Ga0055530_1000038528 316
231 3300005262 Ga0065165_1000053 Ga0065165_100005343 316
232 3300005331 Ga0070670_100010228 Ga0070670_1000102285 316
233 3300005334 Ga0068869_100010908 Ga0068869_1000109084 316
234 3300005335 Ga0070666_10000041 Ga0070666_1000004119 316
235 3300005338 Ga0068868_100021634 Ga0068868_1000216344 316
236 3300005338 Ga0068868_100044522 Ga0068868_1000445224 316
237 3300005347 Ga0070668_100016300 Ga0070668_1000163005 316
238 3300005355 Ga0070671_100057097 Ga0070671_1000570973 316
239 3300005355 Ga0070671_100134397 Ga0070671_1001343973 316
240 3300005355 Ga0070671_100210375 Ga0070671_1002103752 316
241 3300005364 Ga0070673_100032575 Ga0070673_1000325753 316
242 3300005364 Ga0070673_100062969 Ga0070673_1000629694 316
243 3300005365 Ga0070688_100127598 Ga0070688_1001275982 316
244 3300005367 Ga0070667_100015407 Ga0070667_1000154073 316
245 3300005466 Ga0070685_10150834 Ga0070685_101508342 316
246 3300005578 Ga0068854_100249527 Ga0068854_1002495271 316
247 3300005616 Ga0068852_100001933 Ga0068852_1000019339 316
248 3300005617 Ga0068859_100000083 Ga0068859_10000008326 316
249 3300005618 Ga0068864_100007013 Ga0068864_1000070136 316
250 3300005834 Ga0068851_10011807 Ga0068851_100118075 316
251 3300005841 Ga0068863_100002508 Ga0068863_10000250823 316
252 3300005841 Ga0068863_100004369 Ga0068863_1000043694 316
253 3300005842 Ga0068858_100021786 Ga0068858_1000217863 316
254 3300005843 Ga0068860_100001253 Ga0068860_1000012538 316
255 3300005843 Ga0068860_100001680 Ga0068860_1000016805 316
256 3300005844 Ga0068862_100110586 Ga0068862_1001105863 316
257 3300006358 Ga0068871_100078402 Ga0068871_1000784022 316
258 3300006931 Ga0097620_100000083 Ga0097620_10000008326 316
259 3300009093 Ga0105240_10000570 Ga0105240_100005706 316
260 3300009093 Ga0105240_10117027 Ga0105240_101170272 316
261 3300009098 Ga0105245_10414657 Ga0105245_104146571 316
262 3300009101 Ga0105247_10002836 Ga0105247_100028368 316
263 3300009174 Ga0105241_10004753 Ga0105241_100047536 316
264 3300009174 Ga0105241_10006957 Ga0105241_100069576 316
265 3300009176 Ga0105242_10315096 Ga0105242_103150962 316
266 3300009545 Ga0105237_10006828 Ga0105237_100068287 316
267 3300009545 Ga0105237_10045930 Ga0105237_100459303 316
268 3300009551 Ga0105238_10002790 Ga0105238_100027908 316
269 3300009551 Ga0105238_10075124 Ga0105238_100751244 316
270 3300009553 Ga0105249_10005296 Ga0105249_100052966 316
271 3300010375 Ga0105239_10090948 Ga0105239_100909482 316
272 3300011119 Ga0105246_10013044 Ga0105246_100130442 316
273 3300013296 Ga0157374_10054665 Ga0157374_100546653 316
274 3300013296 Ga0157374_10191964 Ga0157374_101919643 316
275 3300013297 Ga0157378_10010984 Ga0157378_100109842 316
276 3300013306 Ga0163162_10021365 Ga0163162_100213655 316
277 3300013307 Ga0157372_10001575 Ga0157372_1000157515 316
278 3300013307 Ga0157372_10015076 Ga0157372_100150764 316
279 3300013307 Ga0157372_10044119 Ga0157372_100441195 316
280 3300014325 Ga0163163_10117046 Ga0163163_101170463 316
281 3300014968 Ga0157379_10029581 Ga0157379_100295813 316
282 3300014969 Ga0157376_10351441 Ga0157376_103514412 316
283 3300025246 Ga0209646_1000002 Ga0209646_1000002185 316
284 3300025250 Ga0209026_1000229 Ga0209026_10002296 316
285 3300025273 Ga0209673_1000034 Ga0209673_1000034154 316
286 3300025295 Ga0209564_1022942 Ga0209564_10229424 316
287 3300025295 Ga0209564_1034841 Ga0209564_10348412 316
288 3300025297 Ga0209758_1000419 Ga0209758_100041926 316
289 3300025297 Ga0209758_1036961 Ga0209758_10369612 316
290 3300025298 Ga0209050_1000353 Ga0209050_100035346 316
291 3300025302 Ga0207426_1000324 Ga0207426_100032434 316
292 3300025302 Ga0207426_1000592 Ga0207426_100059237 316
293 3300025303 Ga0209051_1017264 Ga0209051_10172644 316
294 3300025304 Ga0209257_1002086 Ga0209257_10020866 316
295 3300025321 Ga0207656_10035807 Ga0207656_100358073 316
296 3300025903 Ga0207680_10000077 Ga0207680_100000775 316
297 3300025911 Ga0207654_10003147 Ga0207654_100031475 316
298 3300025913 Ga0207695_10000698 Ga0207695_1000069845 316
299 3300025913 Ga0207695_10005162 Ga0207695_100051626 316
300 3300025914 Ga0207671_10001576 Ga0207671_1000157610 316
301 3300025914 Ga0207671_10002077 Ga0207671_100020776 316
302 3300025931 Ga0207644_10099275 Ga0207644_100992752 316
303 3300025940 Ga0207691_10318075 Ga0207691_103180752 316
304 3300025942 Ga0207689_10001337 Ga0207689_1000133714 316
305 3300025961 Ga0207712_10002223 Ga0207712_100022235 316
306 3300025986 Ga0207658_10019136 Ga0207658_100191365 316
307 3300025986 Ga0207658_10029690 Ga0207658_100296903 316
308 3300026035 Ga0207703_10003465 Ga0207703_100034658 316
309 3300026041 Ga0207639_10084122 Ga0207639_100841223 316
310 3300026088 Ga0207641_10000975 Ga0207641_1000097520 316
311 3300026088 Ga0207641_10056691 Ga0207641_100566914 316
312 3300026089 Ga0207648_10286702 Ga0207648_102867022 316
313 3300026095 Ga0207676_10034745 Ga0207676_100347454 316
314 3300026142 Ga0207698_10308535 Ga0207698_103085351 316
315 3300028381 Ga0268264_10003130 Ga0268264_1000313011 316
316 3300028786 Ga0307517_10015605 Ga0307517_100156054 316
317 3300028794 Ga0307515_10000696 Ga0307515_1000069640 316
318 3300030521 Ga0307511_10000892 Ga0307511_1000089212 316
319 3300031507 Ga0307509_10073592 Ga0307509_100735924 316
320 3300031730 Ga0307516_10001129 Ga0307516_100011292 316
321 3300031730 Ga0307516_10109323 Ga0307516_101093234 316
322 3300041997 Ga0439431_0002865 Ga0439431_0002865_2173_3123 316
323 3300044658 Ga0466972_0000050 Ga0466972_0000050_39323_40378 316
324 3300044684 Ga0466966_0146789 Ga0466966_0146789_189_1142 316
325 3300044765 Ga0466970_0027475 Ga0466970_0027475_1459_2412 316
326 3300044842 Ga0466957_0076602 Ga0466957_0076602_781_1734 316
327 3300049581 Ga0501047_0152432 Ga0501047_0152432_383_1333 316
328 3300049583 Ga0501067_0008288 Ga0501067_0008288_3336_4286 316
329 3300049584 Ga0501068_0057152 Ga0501068_0057152_77_1027 316
330 3300049585 Ga0501069_0060149 Ga0501069_0060149_333_1283 316
331 3300049587 Ga0501071_0071759 Ga0501071_0071759_1432_2382 316
332 3300049589 Ga0501073_0008337 Ga0501073_0008337_5905_6855 316
333 3300049590 Ga0501074_0121332 Ga0501074_0121332_194_1144 316
334 3300049741 Ga0501079_0100876 Ga0501079_0100876_1126_2076 316
335 3300049742 Ga0501080_0026762 Ga0501080_0026762_2388_3338 316
336 3300049744 Ga0501083_0130432 Ga0501083_0130432_548_1498 316
337 3300049822 Ga0501035_0072144 Ga0501035_0072144_591_1667 316
338 3300049823 Ga0501044_0073464 Ga0501044_0073464_1895_2845 316
339 3300049823 Ga0501044_0076914 Ga0501044_0076914_2141_3091 316
340 3300053133 Ga0500655_015739 Ga0500655_015739_188_1138 316
341 3300053178 Ga0500637_0098074 Ga0500637_0098074_345_1295 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13793

Pribosyltran_N

N-terminal domain of ribose phosphate pyrophosphokinase

63

179

0.99

PF14572

Pribosyl_synth

Phosphoribosyl synthetase-associated domain

257

371

0.96

PF00156

Pribosyltran

Phosphoribosyl transferase domain

206

343

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dbo-assembly1.cif.gz_A human prps1-e307a engineered mutation with adp; hexamer 0.9541 3 308
8dbe-assembly1.cif.gz_A human prps1 with adp; hexamer 0.954 3 308
6asv-assembly1.cif.gz_C e. coli prpp synthetase 0.9534 5 308
1dku-assembly1.cif.gz_A crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.9517 5 308
1dkr-assembly1.cif.gz_B crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.9507 5 308
ID Description Score Start End Superfamily
af_Q4DXW9_179_347_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9493 140 299 3.40.50.2020
1dkuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.949 150 285 3.40.50.2020
af_P0A717_7_197_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9454 8 194 3.65.10.10
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9451 196 302 3.40.50.2020
af_B4FQE0_230_369_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.94 152 285 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A1V6KDG8-F1-model_v4 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) 0.9894 203 308 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A2V9ZFW7-F1-model_v4 Phosphoribosylpyrophosphate synthetase 0.9881 212 308 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
AF-A0A2V7RRA1-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9861 3 89 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A7V2UKQ2-F1-model_v4 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) 0.98 5 92 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A7Z8G5V9-F1-model_v4 deleted 0.9799 206 308

Feature Viewer

pLDDT pTM Quality
90.1 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map