F414620

General Info

Members Datasets Scaffolds Average Seq Length
341 150 682 120

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100122964|Ga0070669_1001229645
Length 123
Sequence MAAEAVLTRIIQAERRTLQLTCPRCGRAPLFRGWFRMNVVCAVCDLRFERAQGYWVGAIYVNYGVTVGIAVGGFFLLRQWPGLETAGQLALWVPFVLVFPLWFFRFSRALWLGLEYGLNPDEG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 16.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100122964 3300005353 Bacteria 1982
2 JGI25406J46586_10006266 3300003203 Bacteria 5490
3 rootH2_10056304 3300003320 Bacteria 1352
4 rootL2_10093100 3300003322 Unclassified 1755
5 Ga0068869_101086637 3300005334 Unclassified 699
6 Ga0070680_100035151 3300005336 Bacteria 4044
7 Ga0070689_101009138 3300005340 Bacteria 741
8 Ga0070687_100143265 3300005343 Bacteria 1394
9 Ga0070692_10371058 3300005345 Unclassified 895
10 Ga0070668_100492658 3300005347 Bacteria 1060
11 Ga0070669_101384881 3300005353 Bacteria 610
12 Ga0070701_10328152 3300005438 Unclassified 949
13 Ga0070705_100152018 3300005440 Bacteria 1537
14 Ga0070700_100563097 3300005441 Bacteria 887
15 Ga0070694_100043046 3300005444 Bacteria 3018
16 Ga0070694_100156041 3300005444 Bacteria 1671
17 Ga0070694_100383101 3300005444 Unclassified 1097
18 Ga0070708_100040407 3300005445 Bacteria 4084
19 Ga0070708_100627110 3300005445 Unclassified 1013
20 Ga0070662_100658269 3300005457 Bacteria 884
21 Ga0070662_100810350 3300005457 Unclassified 796
22 Ga0068867_100174372 3300005459 Bacteria 1705
23 Ga0070706_100908203 3300005467 Unclassified 813
24 Ga0070707_100037692 3300005468 Bacteria 4615
25 Ga0070698_100145414 3300005471 Bacteria 2320
26 Ga0070699_100812934 3300005518 Unclassified 855
27 Ga0070679_100401771 3300005530 Bacteria 1316
28 Ga0070697_100006237 3300005536 Bacteria 9231
29 Ga0070697_101314602 3300005536 Unclassified 645
30 Ga0070672_100045547 3300005543 Bacteria 3394
31 Ga0070695_100072011 3300005545 Bacteria 2265
32 Ga0070695_100187580 3300005545 Bacteria 1469
33 Ga0070696_100005759 3300005546 Bacteria 8271
34 Ga0070704_100147736 3300005549 Bacteria 1844
35 Ga0070704_101592042 3300005549 Unclassified 602
36 Ga0068859_101393788 3300005617 Unclassified 773
37 Ga0068861_100656470 3300005719 Unclassified 970
38 Ga0068863_101622410 3300005841 Unclassified 656
39 Ga0068860_100089264 3300005843 Bacteria 2935
40 Ga0068862_102350157 3300005844 Bacteria 545
41 Ga0081539_10000702 3300005985 Bacteria 67205
42 Ga0075432_10157776 3300006058 Bacteria 876
43 Ga0070716_100103160 3300006173 Bacteria 1753
44 Ga0070716_100332738 3300006173 Bacteria 1068
45 Ga0075428_100000123 3300006844 Bacteria 66826
46 Ga0075428_100002086 3300006844 Bacteria 21561
47 Ga0075428_100020650 3300006844 Bacteria 7292
48 Ga0075428_100133355 3300006844 Bacteria 2701
49 Ga0075428_100429742 3300006844 Unclassified 1415
50 Ga0075428_100662695 3300006844 Bacteria 1113
51 Ga0075428_100946918 3300006844 Bacteria 912
52 Ga0075430_100001228 3300006846 Bacteria 20620
53 Ga0075430_100011291 3300006846 Bacteria 7575
54 Ga0075430_100034663 3300006846 Bacteria 4284
55 Ga0075430_100170248 3300006846 Bacteria 1812
56 Ga0075430_100372490 3300006846 Bacteria 1179
57 Ga0075431_100001438 3300006847 Bacteria 21928
58 Ga0075431_100001903 3300006847 Bacteria 19814
59 Ga0075431_100012038 3300006847 Bacteria 8729
60 Ga0075431_100032873 3300006847 Bacteria 5346
61 Ga0075431_100052929 3300006847 Bacteria 4186
62 Ga0075431_100062344 3300006847 Bacteria 3847
63 Ga0075431_100279450 3300006847 Bacteria 1690
64 Ga0075431_100426597 3300006847 Bacteria 1324
65 Ga0075431_101091983 3300006847 Bacteria 763
66 Ga0075433_10011086 3300006852 Bacteria 7251
67 Ga0075433_10210764 3300006852 Bacteria 1727
68 Ga0075433_10287722 3300006852 Bacteria 1456
69 Ga0075434_100030047 3300006871 Bacteria 5349
70 Ga0075434_100318480 3300006871 Bacteria 1576
71 Ga0075434_100991666 3300006871 Unclassified 854
72 Ga0075434_101158067 3300006871 Bacteria 786
73 Ga0075434_102058919 3300006871 Unclassified 576
74 Ga0075429_100000222 3300006880 Bacteria 38478
75 Ga0075429_100015429 3300006880 Bacteria 6619
76 Ga0075429_100018851 3300006880 Bacteria 5977
77 Ga0075429_100148280 3300006880 Bacteria 2054
78 Ga0075429_100304681 3300006880 Bacteria 1395
79 Ga0075436_100007325 3300006914 Bacteria 7544
80 Ga0075436_100013908 3300006914 Bacteria 5511
81 Ga0097620_101394203 3300006931 Unclassified 773
82 Ga0075435_100007177 3300007076 Bacteria 7923
83 Ga0075435_100526592 3300007076 Bacteria 1023
84 Ga0099794_10087772 3300007265 Bacteria 1541
85 Ga0111539_10051850 3300009094 Bacteria 4885
86 Ga0111539_10068737 3300009094 Bacteria 4182
87 Ga0111539_10342848 3300009094 Bacteria 1739
88 Ga0105245_12269750 3300009098 Unclassified 596
89 Ga0114129_10002359 3300009147 Bacteria 26209
90 Ga0114129_10002470 3300009147 Bacteria 25675
91 Ga0114129_10022120 3300009147 Bacteria 9024
92 Ga0114129_10040597 3300009147 Bacteria 6559
93 Ga0114129_10055268 3300009147 Bacteria 5565
94 Ga0114129_10078518 3300009147 Bacteria 4591
95 Ga0114129_10110994 3300009147 Bacteria 3785
96 Ga0114129_10149007 3300009147 Bacteria 3203
97 Ga0114129_10258988 3300009147 Bacteria 2333
98 Ga0114129_10562261 3300009147 Bacteria 1482
99 Ga0114129_12145831 3300009147 Unclassified 673
100 Ga0105243_10276958 3300009148 Bacteria 1509
101 Ga0105241_10692374 3300009174 Bacteria 930
102 Ga0105242_11742858 3300009176 Bacteria 660
103 Ga0105248_11811147 3300009177 Bacteria 692
104 Ga0105249_10222087 3300009553 Bacteria 1859
105 Ga0105249_12432129 3300009553 Unclassified 596
106 Ga0105239_13219144 3300010375 Unclassified 532
107 Ga0157373_10083802 3300013100 Bacteria 2247
108 Ga0157378_10604857 3300013297 Bacteria 1108
109 Ga0163162_11233055 3300013306 Bacteria 849
110 Ga0163161_10178040 3300017792 Bacteria 1629
111 Ga0207684_10000888 3300025910 Bacteria 33994
112 Ga0207660_10176709 3300025917 Bacteria 1656
113 Ga0207652_10318611 3300025921 Bacteria 1404
114 Ga0207646_10022814 3300025922 Bacteria 5756
115 Ga0207681_10333313 3300025923 Bacteria 1210
116 Ga0207681_11346501 3300025923 Unclassified 599
117 Ga0207706_10118825 3300025933 Bacteria 2324
118 Ga0207686_10509083 3300025934 Bacteria 935
119 Ga0207709_11376959 3300025935 Bacteria 584
120 Ga0207670_10529759 3300025936 Bacteria 960
121 Ga0207665_10331875 3300025939 Bacteria 1144
122 Ga0207665_10409457 3300025939 Bacteria 1034
123 Ga0207691_10033083 3300025940 Bacteria 4816
124 Ga0207708_11994235 3300026075 Bacteria 508
125 Ga0207648_10029579 3300026089 Bacteria 4858
126 Ga0207675_100485075 3300026118 Unclassified 1229
127 Ga0207675_101620104 3300026118 Bacteria 668
128 Ga0209983_1010869 3300027665 Bacteria 1859
129 Ga0209588_1260469 3300027671 Bacteria 528
130 Ga0207428_10064190 3300027907 Bacteria 2900
131 Ga0207428_10234508 3300027907 Bacteria 1372
132 Ga0268265_11881779 3300028380 Bacteria 605
133 Ga0268264_10057639 3300028381 Bacteria 3249
134 Ga0307408_100010998 3300031548 Bacteria 5971
135 Ga0307408_100042094 3300031548 Bacteria 3242
136 Ga0307408_100148091 3300031548 Bacteria 1850
137 Ga0307408_100241813 3300031548 Unclassified 1484
138 Ga0307408_100314552 3300031548 Bacteria 1317
139 Ga0307408_100902318 3300031548 Unclassified 809
140 Ga0307408_101023409 3300031548 Bacteria 762
141 Ga0307408_102244529 3300031548 Unclassified 528
142 Ga0307413_10646125 3300031824 Bacteria 872
143 Ga0307413_11095618 3300031824 Bacteria 688
144 Ga0307410_10137268 3300031852 Bacteria 1804
145 Ga0307407_10052376 3300031903 Bacteria 2344
146 Ga0307407_10527171 3300031903 Unclassified 870
147 Ga0307407_10658329 3300031903 Bacteria 785
148 Ga0307412_10065404 3300031911 Bacteria 2461
149 Ga0307412_10303509 3300031911 Unclassified 1263
150 Ga0307409_100135232 3300031995 Bacteria 2114
151 Ga0307409_100247997 3300031995 Bacteria 1626
152 Ga0307409_100357316 3300031995 Bacteria 1381
153 Ga0307416_100077770 3300032002 Bacteria 2788
154 Ga0307416_100515977 3300032002 Bacteria 1262
155 Ga0307416_102231091 3300032002 Unclassified 648
156 Ga0307416_102489058 3300032002 Bacteria 616
157 Ga0307411_10024043 3300032005 Bacteria 3624
158 Ga0307411_10140770 3300032005 Bacteria 1779
159 Ga0307415_100490421 3300032126 Bacteria 1072
160 Ga0307415_100661250 3300032126 Bacteria 938
161 Ga0307415_101874328 3300032126 Unclassified 582
162 Ga0373930_0173463 3300034816 Unclassified 551
163 Ga0373951_0271248 3300035091 Unclassified 515
164 Ga0373931_0003145 3300035691 Bacteria 7369
165 Ga0395899_0050711 3300037312 Bacteria 3081
166 Ga0395900_0081510 3300037418 Bacteria 3324
167 Ga0395900_0572884 3300037418 Bacteria 1072
168 Ga0395898_0120534 3300037466 Bacteria 2513
169 Ga0395898_0271355 3300037466 Bacteria 1618
170 Ga0395905_0870280 3300037471 Unclassified 804
171 Ga0395905_0929488 3300037471 Bacteria 773
172 Ga0395901_0013258 3300038443 Bacteria 8370
173 Ga0451577_0051580 3300042876 Bacteria 3673
174 Ga0451576_0712284 3300045051 Bacteria 1055
175 Ga0495594_0291725 3300046499 Unclassified 929
176 Ga0495642_0377277 3300046528 Unclassified 624
177 Ga0495598_0178640 3300046537 Bacteria 756
178 Ga0495656_0291028 3300046615 Bacteria 835
179 Ga0495659_0071018 3300046664 Bacteria 1304
180 Ga0495669_0168012 3300046684 Bacteria 1043
181 Ga0495669_0195864 3300046684 Bacteria 965
182 Ga0496100_0552501 3300048903 Unclassified 891
183 Ga0496102_0010005 3300048905 Bacteria 8155
184 Ga0496106_0115882 3300048909 Bacteria 2090
185 Ga0496106_0418438 3300048909 Unclassified 1077
186 Ga0496113_0870892 3300048916 Unclassified 713
187 Ga0501031_0459349 3300049568 Unclassified 822
188 Ga0501031_0571777 3300049568 Bacteria 728
189 Ga0501033_0229527 3300049570 Bacteria 1319
190 Ga0501033_0687368 3300049570 Bacteria 697
191 Ga0501036_0055597 3300049572 Bacteria 3353
192 Ga0501036_0190199 3300049572 Bacteria 1727
193 Ga0501036_0324083 3300049572 Bacteria 1287
194 Ga0501036_1284213 3300049572 Bacteria 595
195 Ga0501038_0602703 3300049574 Bacteria 831
196 Ga0501038_1163017 3300049574 Unclassified 561
197 Ga0501039_0180961 3300049575 Bacteria 1658
198 Ga0501039_0390878 3300049575 Bacteria 1092
199 Ga0501040_0012400 3300049576 Bacteria 5584
200 Ga0501040_0181584 3300049576 Bacteria 1492
201 Ga0501040_0231499 3300049576 Bacteria 1316
202 Ga0501040_0333527 3300049576 Bacteria 1086
203 Ga0501040_0347180 3300049576 Bacteria 1063
204 Ga0501041_0026566 3300049577 Bacteria 3484
205 Ga0501041_0099496 3300049577 Bacteria 1799
206 Ga0501041_0185900 3300049577 Bacteria 1301
207 Ga0501041_0283464 3300049577 Bacteria 1043
208 Ga0501041_0600245 3300049577 Bacteria 703
209 Ga0501041_0734948 3300049577 Unclassified 632
210 Ga0501042_0119266 3300049578 Bacteria 1899
211 Ga0501042_0144843 3300049578 Bacteria 1713
212 Ga0501042_0172606 3300049578 Bacteria 1560
213 Ga0501046_0048325 3300049580 Bacteria 3370
214 Ga0501048_0231231 3300049582 Bacteria 1312
215 Ga0501048_0567501 3300049582 Unclassified 814
216 Ga0501048_0980364 3300049582 Bacteria 608
217 Ga0501067_0011385 3300049583 Bacteria 4926
218 Ga0501068_0021366 3300049584 Bacteria 3779
219 Ga0501068_0093672 3300049584 Bacteria 1856
220 Ga0501068_0154067 3300049584 Bacteria 1446
221 Ga0501068_0323838 3300049584 Bacteria 988
222 Ga0501069_0024582 3300049585 Bacteria 3286
223 Ga0501069_0189868 3300049585 Bacteria 1189
224 Ga0501070_0258771 3300049586 Bacteria 1423
225 Ga0501070_0469996 3300049586 Bacteria 1012
226 Ga0501071_0175108 3300049587 Unclassified 1607
227 Ga0501071_0184205 3300049587 Bacteria 1565
228 Ga0501071_0239360 3300049587 Bacteria 1368
229 Ga0501071_0368739 3300049587 Bacteria 1094
230 Ga0501071_0901388 3300049587 Unclassified 682
231 Ga0501072_0003201 3300049588 Bacteria 12298
232 Ga0501072_0031634 3300049588 Bacteria 4144
233 Ga0501072_0065994 3300049588 Bacteria 2854
234 Ga0501072_0066374 3300049588 Bacteria 2846
235 Ga0501072_0114867 3300049588 Bacteria 2143
236 Ga0501072_1465493 3300049588 Unclassified 527
237 Ga0501073_0138299 3300049589 Bacteria 1688
238 Ga0501074_0030943 3300049590 Bacteria 3878
239 Ga0501074_0117667 3300049590 Bacteria 1901
240 Ga0501074_0558551 3300049590 Bacteria 810
241 Ga0501075_0006039 3300049591 Bacteria 8303
242 Ga0501075_0038860 3300049591 Bacteria 3559
243 Ga0501075_0337664 3300049591 Unclassified 1148
244 Ga0501075_0378972 3300049591 Bacteria 1078
245 Ga0501075_0688231 3300049591 Bacteria 779
246 Ga0501075_0770990 3300049591 Bacteria 732
247 Ga0501075_1099842 3300049591 Bacteria 604
248 Ga0501076_0003683 3300049592 Bacteria 10774
249 Ga0501076_0062155 3300049592 Bacteria 2973
250 Ga0501076_0142986 3300049592 Bacteria 1944
251 Ga0501076_0175760 3300049592 Bacteria 1745
252 Ga0501076_0220740 3300049592 Bacteria 1549
253 Ga0501077_0013435 3300049593 Bacteria 5135
254 Ga0501077_0018271 3300049593 Bacteria 4436
255 Ga0501233_287900 3300049668 Unclassified 504
256 Ga0501079_0109756 3300049741 Bacteria 2143
257 Ga0501079_0133631 3300049741 Bacteria 1931
258 Ga0501079_0144898 3300049741 Bacteria 1851
259 Ga0501079_0470634 3300049741 Unclassified 987
260 Ga0501080_0230587 3300049742 Bacteria 1693
261 Ga0501080_0304306 3300049742 Bacteria 1445
262 Ga0501080_1076928 3300049742 Unclassified 695
263 Ga0501081_0007889 3300049743 Bacteria 6905
264 Ga0501081_0012746 3300049743 Bacteria 5529
265 Ga0501081_0040664 3300049743 Bacteria 3183
266 Ga0501081_0075829 3300049743 Bacteria 2348
267 Ga0501081_0144898 3300049743 Bacteria 1704
268 Ga0501081_0554664 3300049743 Bacteria 858
269 Ga0501083_0287262 3300049744 Bacteria 1070
270 Ga0501083_0372974 3300049744 Bacteria 928
271 Ga0501035_0311428 3300049822 Bacteria 1325
272 Ga0501045_0072095 3300049824 Bacteria 2543
273 Ga0501045_0106558 3300049824 Bacteria 2077
274 Ga0501045_0189429 3300049824 Bacteria 1533
275 Ga0501045_0189910 3300049824 Bacteria 1531
276 Ga0501045_0295341 3300049824 Bacteria 1206
277 Ga0501045_1022238 3300049824 Bacteria 606
278 Ga0501045_1151094 3300049824 Bacteria 567
279 nmdc:mga05p37_1497599_c1 3300050507 Unclassified 672
280 nmdc:mga05p37_1914607_c1 3300050507 Bacteria 566
281 nmdc:mga05p37_2095_c1 3300050507 Bacteria 23279
282 nmdc:mga05p37_31916_c1 3300050507 Bacteria 6438
283 nmdc:mga05p37_42210_c1 3300050507 Bacteria 5603
284 nmdc:mga05p37_50210_c1 3300050507 Bacteria 5130
285 nmdc:mga05p37_64579_c1 3300050507 Bacteria 4504
286 nmdc:mga05p37_651_c1 3300050507 Bacteria 38411
287 nmdc:mga05p37_72642_c1 3300050507 Bacteria 4234
288 nmdc:mga09592_130618_c1 3300050508 Bacteria 2161
289 nmdc:mga09592_1634_c2 3300050508 Bacteria 7105
290 nmdc:mga09592_231906_c1 3300050508 Bacteria 1600
291 nmdc:mga09592_248743_c1 3300050508 Bacteria 1541
292 nmdc:mga09592_369264_c1 3300050508 Bacteria 1241
293 nmdc:mga09592_389924_c1 3300050508 Bacteria 1204
294 nmdc:mga09592_5241_c1 3300050508 Bacteria 10531
295 nmdc:mga09592_6999_c1 3300050508 Bacteria 9170
296 nmdc:mga0qj67_154951_c1 3300050509 Bacteria 1859
297 nmdc:mga0qj67_1872_c1 3300050509 Bacteria 14922
298 nmdc:mga0qj67_319_c1 3300050509 Bacteria 33276
299 nmdc:mga0qj67_621182_c1 3300050509 Bacteria 863
300 nmdc:mga0qj67_65627_c1 3300050509 Bacteria 2890
301 nmdc:mga0qj67_77866_c1 3300050509 Bacteria 2653
302 nmdc:mga06r32_172710_c1 3300050510 Bacteria 2146
303 nmdc:mga06r32_1760_c1 3300050510 Bacteria 19429
304 nmdc:mga06r32_217731_c1 3300050510 Bacteria 1897
305 nmdc:mga06r32_2844_c1 3300050510 Bacteria 15537
306 nmdc:mga06r32_46211_c1 3300050510 Bacteria 4155
307 nmdc:mga06r32_68362_c1 3300050510 Bacteria 3432
308 nmdc:mga06r32_7382_c1 3300050510 Bacteria 9892
309 nmdc:mga08y16_12053_c1 3300050511 Bacteria 9084
310 nmdc:mga08y16_21718_c1 3300050511 Bacteria 6775
311 nmdc:mga08y16_628215_c1 3300050511 Unclassified 1080
312 nmdc:mga0n895_1920640_c1 3300050512 Bacteria 551
313 nmdc:mga0n895_30351_c2 3300050512 Bacteria 4546
314 nmdc:mga0n895_358371_c1 3300050512 Bacteria 1477
315 nmdc:mga0n895_380_c1 3300050512 Bacteria 30032
316 nmdc:mga0n895_43619_c1 3300050512 Bacteria 4371
317 nmdc:mga0n895_650658_c1 3300050512 Bacteria 1053
318 nmdc:mga0rr50_337003_c1 3300050513 Bacteria 1267
319 nmdc:mga08x19_1319035_c1 3300050514 Bacteria 511
320 nmdc:mga08x19_4928_c1 3300050514 Bacteria 7881
321 nmdc:mga08x19_9123_c1 3300050514 Bacteria 5922
322 nmdc:mga08x19_925893_c1 3300050514 Bacteria 619
323 nmdc:mga0a205_1109078_c1 3300050515 Bacteria 639
324 nmdc:mga0a205_141168_c1 3300050515 Bacteria 2309
325 nmdc:mga0a205_160354_c1 3300050515 Bacteria 2146
326 Ga0501084_0007974 3300054114 Bacteria 8718
327 Ga0501084_0013642 3300054114 Bacteria 6725
328 Ga0501084_0182909 3300054114 Bacteria 1769
329 Ga0501084_0204707 3300054114 Bacteria 1665
330 Ga0501084_0552696 3300054114 Bacteria 973
331 Ga0590071_011189 3300059421 Bacteria 2100
332 Ga0590071_028667 3300059421 Bacteria 1323
333 Ga0590074_006128 3300059423 Bacteria 1996
334 Ga0590075_036336 3300059424 Bacteria 1255
335 Ga0590077_030897 3300059426 Unclassified 1169
336 Ga0501082_0207706 3300060353 Bacteria 1704
337 Ga0501082_0573278 3300060353 Bacteria 987
338 Ga0530510_0065236 3300061734 Bacteria 2638
339 Ga0530510_0747655 3300061734 Bacteria 746
340 Ga0530510_0999076 3300061734 Unclassified 640
341 Ga0530510_1091401 3300061734 Unclassified 611
342 Ga0070669_100122964
343 JGI25406J46586_10006266
344 rootH2_10056304
345 rootL2_10093100
346 Ga0068869_101086637
347 Ga0070680_100035151
348 Ga0070689_101009138
349 Ga0070687_100143265
350 Ga0070692_10371058
351 Ga0070668_100492658
352 Ga0070669_101384881
353 Ga0070701_10328152
354 Ga0070705_100152018
355 Ga0070700_100563097
356 Ga0070694_100043046
357 Ga0070694_100156041
358 Ga0070694_100383101
359 Ga0070708_100040407
360 Ga0070708_100627110
361 Ga0070662_100658269
362 Ga0070662_100810350
363 Ga0068867_100174372
364 Ga0070706_100908203
365 Ga0070707_100037692
366 Ga0070698_100145414
367 Ga0070699_100812934
368 Ga0070679_100401771
369 Ga0070697_100006237
370 Ga0070697_101314602
371 Ga0070672_100045547
372 Ga0070695_100072011
373 Ga0070695_100187580
374 Ga0070696_100005759
375 Ga0070704_100147736
376 Ga0070704_101592042
377 Ga0068859_101393788
378 Ga0068861_100656470
379 Ga0068863_101622410
380 Ga0068860_100089264
381 Ga0068862_102350157
382 Ga0081539_10000702
383 Ga0075432_10157776
384 Ga0070716_100103160
385 Ga0070716_100332738
386 Ga0075428_100000123
387 Ga0075428_100002086
388 Ga0075428_100020650
389 Ga0075428_100133355
390 Ga0075428_100429742
391 Ga0075428_100662695
392 Ga0075428_100946918
393 Ga0075430_100001228
394 Ga0075430_100011291
395 Ga0075430_100034663
396 Ga0075430_100170248
397 Ga0075430_100372490
398 Ga0075431_100001438
399 Ga0075431_100001903
400 Ga0075431_100012038
401 Ga0075431_100032873
402 Ga0075431_100052929
403 Ga0075431_100062344
404 Ga0075431_100279450
405 Ga0075431_100426597
406 Ga0075431_101091983
407 Ga0075433_10011086
408 Ga0075433_10210764
409 Ga0075433_10287722
410 Ga0075434_100030047
411 Ga0075434_100318480
412 Ga0075434_100991666
413 Ga0075434_101158067
414 Ga0075434_102058919
415 Ga0075429_100000222
416 Ga0075429_100015429
417 Ga0075429_100018851
418 Ga0075429_100148280
419 Ga0075429_100304681
420 Ga0075436_100007325
421 Ga0075436_100013908
422 Ga0097620_101394203
423 Ga0075435_100007177
424 Ga0075435_100526592
425 Ga0099794_10087772
426 Ga0111539_10051850
427 Ga0111539_10068737
428 Ga0111539_10342848
429 Ga0105245_12269750
430 Ga0114129_10002359
431 Ga0114129_10002470
432 Ga0114129_10022120
433 Ga0114129_10040597
434 Ga0114129_10055268
435 Ga0114129_10078518
436 Ga0114129_10110994
437 Ga0114129_10149007
438 Ga0114129_10258988
439 Ga0114129_10562261
440 Ga0114129_12145831
441 Ga0105243_10276958
442 Ga0105241_10692374
443 Ga0105242_11742858
444 Ga0105248_11811147
445 Ga0105249_10222087
446 Ga0105249_12432129
447 Ga0105239_13219144
448 Ga0157373_10083802
449 Ga0157378_10604857
450 Ga0163162_11233055
451 Ga0163161_10178040
452 Ga0207684_10000888
453 Ga0207660_10176709
454 Ga0207652_10318611
455 Ga0207646_10022814
456 Ga0207681_10333313
457 Ga0207681_11346501
458 Ga0207706_10118825
459 Ga0207686_10509083
460 Ga0207709_11376959
461 Ga0207670_10529759
462 Ga0207665_10331875
463 Ga0207665_10409457
464 Ga0207691_10033083
465 Ga0207708_11994235
466 Ga0207648_10029579
467 Ga0207675_100485075
468 Ga0207675_101620104
469 Ga0209983_1010869
470 Ga0209588_1260469
471 Ga0207428_10064190
472 Ga0207428_10234508
473 Ga0268265_11881779
474 Ga0268264_10057639
475 Ga0307408_100010998
476 Ga0307408_100042094
477 Ga0307408_100148091
478 Ga0307408_100241813
479 Ga0307408_100314552
480 Ga0307408_100902318
481 Ga0307408_101023409
482 Ga0307408_102244529
483 Ga0307413_10646125
484 Ga0307413_11095618
485 Ga0307410_10137268
486 Ga0307407_10052376
487 Ga0307407_10527171
488 Ga0307407_10658329
489 Ga0307412_10065404
490 Ga0307412_10303509
491 Ga0307409_100135232
492 Ga0307409_100247997
493 Ga0307409_100357316
494 Ga0307416_100077770
495 Ga0307416_100515977
496 Ga0307416_102231091
497 Ga0307416_102489058
498 Ga0307411_10024043
499 Ga0307411_10140770
500 Ga0307415_100490421
501 Ga0307415_100661250
502 Ga0307415_101874328
503 Ga0373930_0173463
504 Ga0373951_0271248
505 Ga0373931_0003145
506 Ga0395899_0050711
507 Ga0395900_0081510
508 Ga0395900_0572884
509 Ga0395898_0120534
510 Ga0395898_0271355
511 Ga0395905_0870280
512 Ga0395905_0929488
513 Ga0395901_0013258
514 Ga0451577_0051580
515 Ga0451576_0712284
516 Ga0495594_0291725
517 Ga0495642_0377277
518 Ga0495598_0178640
519 Ga0495656_0291028
520 Ga0495659_0071018
521 Ga0495669_0168012
522 Ga0495669_0195864
523 Ga0496100_0552501
524 Ga0496102_0010005
525 Ga0496106_0115882
526 Ga0496106_0418438
527 Ga0496113_0870892
528 Ga0501031_0459349
529 Ga0501031_0571777
530 Ga0501033_0229527
531 Ga0501033_0687368
532 Ga0501036_0055597
533 Ga0501036_0190199
534 Ga0501036_0324083
535 Ga0501036_1284213
536 Ga0501038_0602703
537 Ga0501038_1163017
538 Ga0501039_0180961
539 Ga0501039_0390878
540 Ga0501040_0012400
541 Ga0501040_0181584
542 Ga0501040_0231499
543 Ga0501040_0333527
544 Ga0501040_0347180
545 Ga0501041_0026566
546 Ga0501041_0099496
547 Ga0501041_0185900
548 Ga0501041_0283464
549 Ga0501041_0600245
550 Ga0501041_0734948
551 Ga0501042_0119266
552 Ga0501042_0144843
553 Ga0501042_0172606
554 Ga0501046_0048325
555 Ga0501048_0231231
556 Ga0501048_0567501
557 Ga0501048_0980364
558 Ga0501067_0011385
559 Ga0501068_0021366
560 Ga0501068_0093672
561 Ga0501068_0154067
562 Ga0501068_0323838
563 Ga0501069_0024582
564 Ga0501069_0189868
565 Ga0501070_0258771
566 Ga0501070_0469996
567 Ga0501071_0175108
568 Ga0501071_0184205
569 Ga0501071_0239360
570 Ga0501071_0368739
571 Ga0501071_0901388
572 Ga0501072_0003201
573 Ga0501072_0031634
574 Ga0501072_0065994
575 Ga0501072_0066374
576 Ga0501072_0114867
577 Ga0501072_1465493
578 Ga0501073_0138299
579 Ga0501074_0030943
580 Ga0501074_0117667
581 Ga0501074_0558551
582 Ga0501075_0006039
583 Ga0501075_0038860
584 Ga0501075_0337664
585 Ga0501075_0378972
586 Ga0501075_0688231
587 Ga0501075_0770990
588 Ga0501075_1099842
589 Ga0501076_0003683
590 Ga0501076_0062155
591 Ga0501076_0142986
592 Ga0501076_0175760
593 Ga0501076_0220740
594 Ga0501077_0013435
595 Ga0501077_0018271
596 Ga0501233_287900
597 Ga0501079_0109756
598 Ga0501079_0133631
599 Ga0501079_0144898
600 Ga0501079_0470634
601 Ga0501080_0230587
602 Ga0501080_0304306
603 Ga0501080_1076928
604 Ga0501081_0007889
605 Ga0501081_0012746
606 Ga0501081_0040664
607 Ga0501081_0075829
608 Ga0501081_0144898
609 Ga0501081_0554664
610 Ga0501083_0287262
611 Ga0501083_0372974
612 Ga0501035_0311428
613 Ga0501045_0072095
614 Ga0501045_0106558
615 Ga0501045_0189429
616 Ga0501045_0189910
617 Ga0501045_0295341
618 Ga0501045_1022238
619 Ga0501045_1151094
620 nmdc:mga05p37_1497599_c1
621 nmdc:mga05p37_1914607_c1
622 nmdc:mga05p37_2095_c1
623 nmdc:mga05p37_31916_c1
624 nmdc:mga05p37_42210_c1
625 nmdc:mga05p37_50210_c1
626 nmdc:mga05p37_64579_c1
627 nmdc:mga05p37_651_c1
628 nmdc:mga05p37_72642_c1
629 nmdc:mga09592_130618_c1
630 nmdc:mga09592_1634_c2
631 nmdc:mga09592_231906_c1
632 nmdc:mga09592_248743_c1
633 nmdc:mga09592_369264_c1
634 nmdc:mga09592_389924_c1
635 nmdc:mga09592_5241_c1
636 nmdc:mga09592_6999_c1
637 nmdc:mga0qj67_154951_c1
638 nmdc:mga0qj67_1872_c1
639 nmdc:mga0qj67_319_c1
640 nmdc:mga0qj67_621182_c1
641 nmdc:mga0qj67_65627_c1
642 nmdc:mga0qj67_77866_c1
643 nmdc:mga06r32_172710_c1
644 nmdc:mga06r32_1760_c1
645 nmdc:mga06r32_217731_c1
646 nmdc:mga06r32_2844_c1
647 nmdc:mga06r32_46211_c1
648 nmdc:mga06r32_68362_c1
649 nmdc:mga06r32_7382_c1
650 nmdc:mga08y16_12053_c1
651 nmdc:mga08y16_21718_c1
652 nmdc:mga08y16_628215_c1
653 nmdc:mga0n895_1920640_c1
654 nmdc:mga0n895_30351_c2
655 nmdc:mga0n895_358371_c1
656 nmdc:mga0n895_380_c1
657 nmdc:mga0n895_43619_c1
658 nmdc:mga0n895_650658_c1
659 nmdc:mga0rr50_337003_c1
660 nmdc:mga08x19_1319035_c1
661 nmdc:mga08x19_4928_c1
662 nmdc:mga08x19_9123_c1
663 nmdc:mga08x19_925893_c1
664 nmdc:mga0a205_1109078_c1
665 nmdc:mga0a205_141168_c1
666 nmdc:mga0a205_160354_c1
667 Ga0501084_0007974
668 Ga0501084_0013642
669 Ga0501084_0182909
670 Ga0501084_0204707
671 Ga0501084_0552696
672 Ga0590071_011189
673 Ga0590071_028667
674 Ga0590074_006128
675 Ga0590075_036336
676 Ga0590077_030897
677 Ga0501082_0207706
678 Ga0501082_0573278
679 Ga0530510_0065236
680 Ga0530510_0747655
681 Ga0530510_0999076
682 Ga0530510_1091401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

31

116

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t15-assembly1.cif.gz_m the iii2-iv(5b)1 respiratory supercomplex from s. cerevisiae 0.592 52 119
7z51-assembly1.cif.gz_D-10 tick-borne encephalitis virus kuutsalo-14 0.4582 44 99
7z51-assembly1.cif.gz_D-11 tick-borne encephalitis virus kuutsalo-14 0.4582 44 99
7z51-assembly1.cif.gz_D-12 tick-borne encephalitis virus kuutsalo-14 0.4582 44 99
7z51-assembly1.cif.gz_D-13 tick-borne encephalitis virus kuutsalo-14 0.4582 44 99
ID Description Score Start End Superfamily
af_O08815_988_1128_1.20.1230.10 Mainly Alpha;Up-down Bundle;Phospholipase C Beta; Chain: A;Phospholipase C beta, distal C-terminal domain 0.715 53 116 1.20.1230.10
af_Q9H2G2_1020_1160_1.20.1230.10 Mainly Alpha;Up-down Bundle;Phospholipase C Beta; Chain: A;Phospholipase C beta, distal C-terminal domain 0.714 53 116 1.20.1230.10
af_A4HWA9_1_141_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.6071 47 113 1.50.40.10
af_Q20021_77_349_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.5984 46 118 3.90.550.10
af_A4HZS6_258_444_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5801 50 116 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A7T3KTS2-F1-model_v4 Uncharacterized protein 0.7724 50 118 GO:0016020
AF-A0A7V0J9U5-F1-model_v4 GGDEF domain-containing protein 0.7661 52 113 GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A2V6Q503-F1-model_v4 DUF983 domain-containing protein 0.7457 35 95 GO:0016020
AF-L7VX27-F1-model_v4 DUF983 domain-containing protein 0.7373 35 120 GO:0016020
AF-A0A2E3RG74-F1-model_v4 DUF983 domain-containing protein 0.7367 35 120 GO:0016020

Map