F414387

General Info

Members Datasets Scaffolds Average Seq Length
340 199 340 45

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10356164|Ga0265332_103561641
Length 55
Sequence LATTVGNRLTAMENEMVKRLMWSGLLAGVSALASVAANRVAGVIWRRLFDEEPPE

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100099406 3300005337 Bacteria 1918
2 Ga0070682_100622231 3300005337 Bacteria 856
3 Ga0068868_100528653 3300005338 Bacteria 1036
4 Ga0070689_100270007 3300005340 Bacteria 1408
5 Ga0070691_10160388 3300005341 Bacteria 1159
6 Ga0070687_100005363 3300005343 Bacteria 5186
7 Ga0070661_100289889 3300005344 Bacteria 1272
8 Ga0070692_10525890 3300005345 Bacteria 771
9 Ga0070668_102179514 3300005347 Unclassified 512
10 Ga0070675_102144815 3300005354 Unclassified 515
11 Ga0070671_101112681 3300005355 Bacteria 694
12 Ga0070674_100364935 3300005356 Unclassified 1170
13 Ga0070709_10472648 3300005434 Bacteria 948
14 Ga0070714_100428746 3300005435 Bacteria 1253
15 Ga0070714_100575534 3300005435 Bacteria 1080
16 Ga0070714_100833355 3300005435 Bacteria 894
17 Ga0070713_100083928 3300005436 Bacteria 2724
18 Ga0070713_100153283 3300005436 Bacteria 2052
19 Ga0070700_100078247 3300005441 Bacteria 2129
20 Ga0070700_101516454 3300005441 Unclassified 570
21 Ga0070663_100582865 3300005455 Bacteria 939
22 Ga0070678_100374115 3300005456 Bacteria 1231
23 Ga0070662_101036694 3300005457 Bacteria 703
24 Ga0068867_100084922 3300005459 Bacteria 2393
25 Ga0068867_101600570 3300005459 Bacteria 609
26 Ga0068853_102008545 3300005539 Bacteria 561
27 Ga0070686_100990941 3300005544 Bacteria 689
28 Ga0070696_101962897 3300005546 Bacteria 508
29 Ga0070693_100535484 3300005547 Bacteria 836
30 Ga0070704_100465947 3300005549 Bacteria 1091
31 Ga0068855_100595179 3300005563 Bacteria 1193
32 Ga0068857_100367699 3300005577 Bacteria 1334
33 Ga0068854_100524881 3300005578 Bacteria 1001
34 Ga0068856_101280436 3300005614 Bacteria 749
35 Ga0068856_102366972 3300005614 Unclassified 539
36 Ga0070702_100000689 3300005615 Bacteria 12722
37 Ga0068852_100172480 3300005616 Bacteria 2029
38 Ga0068859_100655242 3300005617 Bacteria 1142
39 Ga0068864_100450904 3300005618 Unclassified 1230
40 Ga0068866_10009163 3300005718 Bacteria 4196
41 Ga0068866_10158150 3300005718 Bacteria 1319
42 Ga0068866_10312917 3300005718 Bacteria 985
43 Ga0068861_100054641 3300005719 Bacteria 3043
44 Ga0068861_102540589 3300005719 Bacteria 516
45 Ga0068870_10039683 3300005840 Bacteria 2437
46 Ga0081538_10006570 3300005981 Bacteria 10208
47 Ga0081538_10024187 3300005981 Bacteria 4334
48 Ga0070717_10006646 3300006028 Bacteria 8524
49 Ga0070717_11530347 3300006028 Bacteria 605
50 Ga0070712_101035728 3300006175 Bacteria 711
51 Ga0068871_101045746 3300006358 Bacteria 762
52 Ga0075433_10002298 3300006852 Bacteria 14559
53 Ga0075429_100106286 3300006880 Bacteria 2452
54 Ga0068865_100852660 3300006881 Bacteria 789
55 Ga0075436_100235358 3300006914 Bacteria 1301
56 Ga0097620_100655249 3300006931 Bacteria 1142
57 Ga0075435_101855730 3300007076 Bacteria 529
58 Ga0105240_10652608 3300009093 Bacteria 1153
59 Ga0111539_10833148 3300009094 Bacteria 1073
60 Ga0111539_11440882 3300009094 Bacteria 799
61 Ga0105245_10353310 3300009098 Bacteria 1457
62 Ga0105245_12403303 3300009098 Unclassified 580
63 Ga0114129_12198678 3300009147 Bacteria 664
64 Ga0114129_12964871 3300009147 Bacteria 559
65 Ga0105243_10046255 3300009148 Bacteria 3423
66 Ga0105243_10108607 3300009148 Bacteria 2316
67 Ga0105243_11595895 3300009148 Bacteria 679
68 Ga0105241_10792312 3300009174 Bacteria 872
69 Ga0105242_10014779 3300009176 Bacteria 6045
70 Ga0105242_12324781 3300009176 Bacteria 583
71 Ga0105248_11586202 3300009177 Bacteria 741
72 Ga0105238_10968046 3300009551 Bacteria 871
73 Ga0105249_10371868 3300009553 Bacteria 1453
74 Ga0105239_10432380 3300010375 Bacteria 1492
75 Ga0105239_11314893 3300010375 Bacteria 834
76 Ga0105239_12796628 3300010375 Bacteria 569
77 Ga0105246_10992856 3300011119 Bacteria 759
78 Ga0157374_11180175 3300013296 Bacteria 787
79 Ga0163162_10218868 3300013306 Bacteria 2034
80 Ga0157372_10291124 3300013307 Bacteria 1899
81 Ga0157372_13003762 3300013307 Bacteria 539
82 Ga0157372_13350217 3300013307 Bacteria 510
83 Ga0157375_10895996 3300013308 Bacteria 1031
84 Ga0163163_11286173 3300014325 Bacteria 794
85 Ga0182008_10071873 3300014497 Bacteria 1702
86 Ga0157377_10136393 3300014745 Bacteria 1504
87 Ga0206356_11681944 3300020070 Bacteria 720
88 Ga0206350_11661502 3300020080 Bacteria 517
89 Ga0206354_10154821 3300020081 Bacteria 628
90 Ga0206354_10420497 3300020081 Bacteria 659
91 Ga0206353_10137514 3300020082 Bacteria 565
92 Ga0206353_11401555 3300020082 Bacteria 724
93 Ga0213876_10019184 3300021384 Bacteria 3611
94 Ga0213876_10051432 3300021384 Bacteria 2177
95 Ga0213876_10098734 3300021384 Bacteria 1548
96 Ga0213876_10597218 3300021384 Bacteria 587
97 Ga0213875_10009419 3300021388 Bacteria 4947
98 Ga0213875_10011176 3300021388 Bacteria 4474
99 Ga0213875_10073704 3300021388 Bacteria 1593
100 Ga0213875_10085100 3300021388 Bacteria 1475
101 Ga0213875_10173422 3300021388 Bacteria 1013
102 Ga0213875_10214026 3300021388 Unclassified 907
103 Ga0213875_10299620 3300021388 Unclassified 760
104 Ga0213875_10407570 3300021388 Bacteria 648
105 Ga0213875_10557672 3300021388 Archaea 552
106 Ga0213875_10570645 3300021388 Unclassified 546
107 Ga0224712_10116191 3300022467 Bacteria 1153
108 Ga0207692_10038996 3300025898 Bacteria 2334
109 Ga0207642_10000038 3300025899 Bacteria 38220
110 Ga0207642_10256672 3300025899 Bacteria 995
111 Ga0207688_10050264 3300025901 Bacteria 2333
112 Ga0207643_10146769 3300025908 Bacteria 1411
113 Ga0207643_10415234 3300025908 Bacteria 852
114 Ga0207707_10582119 3300025912 Bacteria 949
115 Ga0207695_11334173 3300025913 Bacteria 598
116 Ga0207695_11484045 3300025913 Bacteria 558
117 Ga0207663_11227145 3300025916 Unclassified 604
118 Ga0207662_10011742 3300025918 Bacteria 4866
119 Ga0207652_10644900 3300025921 Bacteria 947
120 Ga0207694_10634554 3300025924 Bacteria 899
121 Ga0207659_11454150 3300025926 Unclassified 587
122 Ga0207687_10295611 3300025927 Bacteria 1303
123 Ga0207700_10027685 3300025928 Bacteria 3974
124 Ga0207664_10013009 3300025929 Bacteria 5963
125 Ga0207664_10810548 3300025929 Bacteria 842
126 Ga0207664_11048417 3300025929 Bacteria 730
127 Ga0207686_10013202 3300025934 Bacteria 4567
128 Ga0207686_10657024 3300025934 Bacteria 830
129 Ga0207709_10016389 3300025935 Bacteria 4118
130 Ga0207709_10035456 3300025935 Bacteria 2949
131 Ga0207669_10000010 3300025937 Bacteria 150070
132 Ga0207669_11143574 3300025937 Unclassified 658
133 Ga0207704_10137103 3300025938 Bacteria 1705
134 Ga0207665_10172452 3300025939 Bacteria 1563
135 Ga0207711_10973633 3300025941 Bacteria 787
136 Ga0207689_10346365 3300025942 Bacteria 1235
137 Ga0207661_10965651 3300025944 Bacteria 785
138 Ga0207679_10637145 3300025945 Unclassified 963
139 Ga0207668_11419331 3300025972 Bacteria 626
140 Ga0207640_10998279 3300025981 Bacteria 736
141 Ga0207677_10548521 3300026023 Bacteria 1007
142 Ga0207703_10063809 3300026035 Bacteria 3021
143 Ga0207678_10109058 3300026067 Bacteria 2361
144 Ga0207708_10008594 3300026075 Bacteria 7557
145 Ga0207708_10564672 3300026075 Bacteria 961
146 Ga0207702_10356795 3300026078 Bacteria 1400
147 Ga0207641_12553418 3300026088 Unclassified 509
148 Ga0207648_10525105 3300026089 Bacteria 1085
149 Ga0207676_10495760 3300026095 Unclassified 1159
150 Ga0207674_10069309 3300026116 Bacteria 3547
151 Ga0207675_100034236 3300026118 Bacteria 4735
152 Ga0207675_102041751 3300026118 Bacteria 590
153 Ga0207698_10239135 3300026142 Bacteria 1654
154 Ga0268265_10317226 3300028380 Bacteria 1410
155 Ga0268264_11440621 3300028381 Bacteria 699
156 Ga0265326_10023603 3300028558 Bacteria 1757
157 Ga0265323_10186187 3300028653 Bacteria 656
158 Ga0265322_10083393 3300028654 Bacteria 907
159 Ga0265336_10117599 3300028666 Bacteria 792
160 Ga0265338_10077069 3300028800 Bacteria 2820
161 Ga0265324_10058394 3300029957 Bacteria 1320
162 Ga0265330_10292371 3300031235 Bacteria 686
163 Ga0265332_10356164 3300031238 Bacteria 604
164 Ga0265320_10018068 3300031240 Bacteria 3894
165 Ga0265325_10164170 3300031241 Bacteria 1043
166 Ga0265331_10102251 3300031250 Bacteria 1318
167 Ga0265327_10014430 3300031251 Bacteria 5169
168 Ga0307408_100996342 3300031548 Bacteria 772
169 Ga0265342_10226511 3300031712 Bacteria 1005
170 Ga0307405_12048016 3300031731 Unclassified 513
171 Ga0307413_10174734 3300031824 Bacteria 1525
172 Ga0307413_10808228 3300031824 Bacteria 789
173 Ga0307410_10126944 3300031852 Bacteria 1869
174 Ga0307410_11143737 3300031852 Bacteria 676
175 Ga0307410_12034751 3300031852 Bacteria 513
176 Ga0307406_10698950 3300031901 Bacteria 846
177 Ga0307409_100094619 3300031995 Bacteria 2459
178 Ga0307409_101381197 3300031995 Bacteria 730
179 Ga0307409_102240042 3300031995 Bacteria 576
180 Ga0307416_101203106 3300032002 Bacteria 863
181 Ga0307416_103490034 3300032002 Unclassified 526
182 Ga0307414_10311225 3300032004 Bacteria 1337
183 Ga0307414_12119301 3300032004 Bacteria 525
184 Ga0307415_100056902 3300032126 Bacteria 2684
185 Ga0307415_102525197 3300032126 Unclassified 506
186 Ga0373937_1378020 3300036401 Bacteria 653
187 Ga0436364_0066028 3300037853 Bacteria 1200
188 Ga0436364_0079058 3300037853 Bacteria 560
189 Ga0436364_0256505 3300037853 Bacteria 4278
190 Ga0436364_0337952 3300037853 Bacteria 1548
191 Ga0436364_0549585 3300037853 Bacteria 915
192 Ga0436364_1110030 3300037853 Bacteria 13224
193 Ga0436364_1326262 3300037853 Bacteria 6276
194 Ga0436364_1541019 3300037853 Bacteria 2970
195 Ga0436364_1564718 3300037853 Bacteria 2231
196 Ga0436365_0126994 3300039437 Bacteria 624
197 Ga0436365_0320671 3300039437 Bacteria 13607
198 Ga0436365_0413376 3300039437 Bacteria 3489
199 Ga0436365_0490499 3300039437 Bacteria 985
200 Ga0436365_0681915 3300039437 Bacteria 7618
201 Ga0436365_1445890 3300039437 Bacteria 900
202 Ga0436365_1461348 3300039437 Bacteria 1838
203 Ga0436365_1580551 3300039437 Bacteria 12859
204 Ga0436365_1637070 3300039437 Bacteria 2185
205 Ga0436363_0127754 3300039450 Bacteria 1186
206 Ga0436363_0365240 3300039450 Bacteria 691
207 Ga0436363_0865842 3300039450 Bacteria 1215
208 Ga0436363_1615119 3300039450 Unclassified 583
209 Ga0436363_1660580 3300039450 Bacteria 2056
210 Ga0436362_0033283 3300039453 Bacteria 2206
211 Ga0436362_0121361 3300039453 Bacteria 887
212 Ga0436362_1079981 3300039453 Bacteria 942
213 Ga0436362_1134516 3300039453 Bacteria 509
214 Ga0451787_446334 3300041441 Bacteria 516
215 Ga0451839_0267224 3300041496 Bacteria 592
216 Ga0451853_3742564 3300041512 Bacteria 768
217 Ga0466969_0364954 3300044656 Unclassified 654
218 Ga0466965_0152362 3300044683 Bacteria 1209
219 Ga0466965_0368635 3300044683 Bacteria 789
220 Ga0466966_0052340 3300044684 Bacteria 2594
221 Ga0466966_0067776 3300044684 Bacteria 2241
222 Ga0466966_0421392 3300044684 Bacteria 802
223 Ga0466966_0422030 3300044684 Bacteria 802
224 Ga0466966_1014228 3300044684 Bacteria 501
225 Ga0466961_0058579 3300044693 Bacteria 2450
226 Ga0466961_0949118 3300044693 Bacteria 511
227 Ga0466963_0005515 3300044694 Bacteria 7406
228 Ga0466963_0032477 3300044694 Bacteria 3381
229 Ga0466963_0070309 3300044694 Bacteria 2354
230 Ga0466963_0290208 3300044694 Unclassified 1150
231 Ga0466963_0524079 3300044694 Bacteria 837
232 Ga0466963_0601962 3300044694 Bacteria 776
233 Ga0466963_0616340 3300044694 Bacteria 766
234 Ga0466964_0035803 3300044706 Bacteria 1987
235 Ga0466971_0011620 3300044719 Bacteria 3854
236 Ga0466971_0030442 3300044719 Bacteria 2415
237 Ga0466971_0088451 3300044719 Bacteria 1417
238 Ga0466971_0147005 3300044719 Bacteria 1099
239 Ga0466971_0208442 3300044719 Bacteria 924
240 Ga0466970_0022065 3300044765 Bacteria 3323
241 Ga0466970_0060652 3300044765 Bacteria 2026
242 Ga0466970_0248730 3300044765 Bacteria 996
243 Ga0466970_0734634 3300044765 Bacteria 576
244 Ga0466957_0183649 3300044842 Bacteria 1367
245 Ga0466957_0184629 3300044842 Bacteria 1363
246 Ga0466957_0229222 3300044842 Bacteria 1229
247 Ga0466960_0424848 3300044901 Bacteria 769
248 Ga0466959_0017058 3300045049 Bacteria 5316
249 Ga0466959_0159288 3300045049 Bacteria 1587
250 Ga0466959_0231441 3300045049 Bacteria 1279
251 Ga0466959_0651910 3300045049 Bacteria 707
252 Ga0466959_0657568 3300045049 Bacteria 703
253 Ga0466959_0716066 3300045049 Bacteria 670
254 Ga0466958_0005993 3300045836 Bacteria 6582
255 Ga0466958_0058113 3300045836 Bacteria 2351
256 Ga0466958_0065166 3300045836 Bacteria 2223
257 Ga0466958_0138529 3300045836 Bacteria 1531
258 Ga0466958_0174031 3300045836 Bacteria 1364
259 Ga0466967_0001141 3300045976 Bacteria 14830
260 Ga0466967_0025580 3300045976 Bacteria 4871
261 Ga0466967_0059392 3300045976 Bacteria 3385
262 Ga0466967_0140931 3300045976 Bacteria 2246
263 Ga0466967_0150694 3300045976 Bacteria 2173
264 Ga0466967_0163800 3300045976 Bacteria 2089
265 Ga0466967_0180824 3300045976 Bacteria 1989
266 Ga0466967_0310767 3300045976 Bacteria 1518
267 Ga0466967_0692015 3300045976 Bacteria 1009
268 Ga0466967_1026799 3300045976 Bacteria 821
269 Ga0466967_1081575 3300045976 Unclassified 799
270 Ga0466967_1194413 3300045976 Bacteria 758
271 Ga0466967_1264146 3300045976 Bacteria 735
272 Ga0466967_1586484 3300045976 Bacteria 652
273 Ga0466967_1850955 3300045976 Bacteria 600
274 Ga0466967_1912755 3300045976 Bacteria 590
275 Ga0466967_2506663 3300045976 Bacteria 511
276 Ga0495653_0003139 3300046463 Bacteria 13240
277 Ga0495664_0222435 3300046477 Bacteria 1143
278 Ga0495596_0395032 3300046500 Bacteria 539
279 Ga0495608_0269652 3300046511 Bacteria 1058
280 Ga0495618_0000077 3300046514 Bacteria 69702
281 Ga0495628_0729374 3300046516 Bacteria 698
282 Ga0495630_0003770 3300046517 Bacteria 10586
283 Ga0495666_0511923 3300046526 Bacteria 536
284 Ga0495640_0427378 3300046533 Bacteria 811
285 Ga0495640_0733151 3300046533 Bacteria 592
286 Ga0495586_0539034 3300046535 Bacteria 674
287 Ga0495587_0021968 3300046536 Bacteria 3933
288 Ga0495645_0000050 3300046543 Bacteria 87415
289 Ga0495645_0001809 3300046543 Bacteria 14530
290 Ga0495668_0444982 3300046616 Bacteria 713
291 Ga0495634_0300642 3300046642 Bacteria 970
292 Ga0495657_0000011 3300046675 Bacteria 207360
293 Ga0495646_0448537 3300046680 Bacteria 666
294 Ga0495674_0224962 3300047319 Bacteria 1550
295 Ga0495672_0236763 3300047320 Bacteria 893
296 Ga0495680_0110254 3300047322 Bacteria 2040
297 Ga0495680_0262957 3300047322 Bacteria 1220
298 Ga0495684_0040677 3300047471 Bacteria 3563
299 Ga0496100_0000226 3300048903 Bacteria 30341
300 Ga0496101_0000492 3300048904 Bacteria 24919
301 Ga0496102_0221639 3300048905 Bacteria 1783
302 Ga0496102_1382053 3300048905 Unclassified 623
303 Ga0496106_0035731 3300048909 Bacteria 3716
304 Ga0496107_1333656 3300048910 Bacteria 512
305 Ga0496108_0233472 3300048911 Bacteria 1600
306 Ga0496108_0636401 3300048911 Bacteria 928
307 Ga0496109_0002320 3300048912 Bacteria 15849
308 Ga0496109_0136090 3300048912 Bacteria 2296
309 Ga0496110_0218354 3300048913 Bacteria 1734
310 Ga0496110_0565107 3300048913 Bacteria 1033
311 Ga0496110_1022254 3300048913 Bacteria 734
312 Ga0496111_0046310 3300048914 Bacteria 3131
313 Ga0496111_0303137 3300048914 Bacteria 1184
314 Ga0496114_0278522 3300048917 Bacteria 1474
315 Ga0496115_0000005 3300048918 Bacteria 290756
316 Ga0501040_0494192 3300049576 Bacteria 882
317 Ga0501042_0328722 3300049578 Bacteria 1105
318 Ga0501067_0491901 3300049583 Bacteria 686
319 Ga0501079_1558690 3300049741 Unclassified 520
320 Ga0501081_0121802 3300049743 Bacteria 1858
321 Ga0501081_0703125 3300049743 Unclassified 759
322 nmdc:mga05p37_1911004_c1 3300050507 Bacteria 566
323 nmdc:mga09592_98323_c1 3300050508 Bacteria 2505
324 nmdc:mga06r32_1410263_c1 3300050510 Bacteria 638
325 nmdc:mga08y16_1377212_c1 3300050511 Bacteria 669
326 nmdc:mga0a205_1389911_c1 3300050515 Bacteria 550
327 nmdc:mga0a205_352_c1 3300050515 Bacteria 34822
328 Ga0495601_0001623 3300053077 Bacteria 12376
329 Ga0495612_0000076 3300053078 Bacteria 44649
330 Ga0495612_0242074 3300053078 Bacteria 801
331 Ga0495655_0164238 3300053083 Bacteria 707
332 Ga0495619_0000119 3300053085 Bacteria 58302
333 Ga0495619_0136456 3300053085 Bacteria 1688
334 Ga0495619_0317725 3300053085 Bacteria 1078
335 Ga0501084_0488267 3300054114 Bacteria 1041
336 Ga0466962_0051266 3300061719 Bacteria 1973
337 Ga0466962_0083275 3300061719 Bacteria 1530
338 Ga0466962_0119449 3300061719 Bacteria 1271
339 Ga0466962_0317793 3300061719 Bacteria 772
340 Ga0466962_0656051 3300061719 Bacteria 537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10472648 Ga0070709_104726481 44
2 3300005435 Ga0070714_100575534 Ga0070714_1005755341 44
3 3300005436 Ga0070713_100153283 Ga0070713_1001532833 44
4 3300005614 Ga0068856_102366972 Ga0068856_1023669721 44
5 3300005718 Ga0068866_10009163 Ga0068866_100091635 44
6 3300005719 Ga0068861_102540589 Ga0068861_1025405893 44
7 3300005981 Ga0081538_10006570 Ga0081538_1000657010 44
8 3300005981 Ga0081538_10024187 Ga0081538_100241874 44
9 3300006028 Ga0070717_11530347 Ga0070717_115303471 44
10 3300006175 Ga0070712_101035728 Ga0070712_1010357282 44
11 3300006358 Ga0068871_101045746 Ga0068871_1010457462 44
12 3300006852 Ga0075433_10002298 Ga0075433_1000229812 44
13 3300009148 Ga0105243_10046255 Ga0105243_100462554 44
14 3300009176 Ga0105242_10014779 Ga0105242_100147797 44
15 3300010375 Ga0105239_11314893 Ga0105239_113148932 44
16 3300010375 Ga0105239_12796628 Ga0105239_127966282 44
17 3300013307 Ga0157372_13003762 Ga0157372_130037622 44
18 3300025898 Ga0207692_10038996 Ga0207692_100389963 44
19 3300025899 Ga0207642_10000038 Ga0207642_1000003845 44
20 3300025928 Ga0207700_10027685 Ga0207700_100276853 44
21 3300025929 Ga0207664_11048417 Ga0207664_110484172 44
22 3300025934 Ga0207686_10013202 Ga0207686_100132024 44
23 3300025935 Ga0207709_10016389 Ga0207709_100163894 44
24 3300025937 Ga0207669_10000010 Ga0207669_1000001021 44
25 3300025939 Ga0207665_10172452 Ga0207665_101724522 44
26 3300026118 Ga0207675_102041751 Ga0207675_1020417512 44
27 3300028558 Ga0265326_10023603 Ga0265326_100236033 44
28 3300028653 Ga0265323_10186187 Ga0265323_101861872 44
29 3300028654 Ga0265322_10083393 Ga0265322_100833932 44
30 3300028666 Ga0265336_10117599 Ga0265336_101175992 44
31 3300028800 Ga0265338_10077069 Ga0265338_100770691 44
32 3300029957 Ga0265324_10058394 Ga0265324_100583942 44
33 3300031235 Ga0265330_10292371 Ga0265330_102923712 44
34 3300031241 Ga0265325_10164170 Ga0265325_101641703 44
35 3300031250 Ga0265331_10102251 Ga0265331_101022513 44
36 3300031251 Ga0265327_10014430 Ga0265327_100144305 44
37 3300031712 Ga0265342_10226511 Ga0265342_102265112 44
38 3300031852 Ga0307410_11143737 Ga0307410_111437372 44
39 3300032002 Ga0307416_101203106 Ga0307416_1012031063 44
40 3300041512 Ga0451853_3742564 Ga0451853_3742564_207_341 44
41 3300044901 Ga0466960_0424848 Ga0466960_0424848_288_422 44
42 3300045976 Ga0466967_0140931 Ga0466967_0140931_640_774 44
43 3300045976 Ga0466967_0180824 Ga0466967_0180824_927_1061 44
44 3300045976 Ga0466967_1026799 Ga0466967_1026799_519_653 44
45 3300045976 Ga0466967_1264146 Ga0466967_1264146_201_335 44
46 3300046463 Ga0495653_0003139 Ga0495653_0003139_5539_5673 44
47 3300046511 Ga0495608_0269652 Ga0495608_0269652_18_152 44
48 3300046514 Ga0495618_0000077 Ga0495618_0000077_11369_11503 44
49 3300046517 Ga0495630_0003770 Ga0495630_0003770_6287_6421 44
50 3300046526 Ga0495666_0511923 Ga0495666_0511923_124_258 44
51 3300046533 Ga0495640_0427378 Ga0495640_0427378_38_172 44
52 3300046535 Ga0495586_0539034 Ga0495586_0539034_31_165 44
53 3300046536 Ga0495587_0021968 Ga0495587_0021968_2449_2583 44
54 3300046543 Ga0495645_0000050 Ga0495645_0000050_10683_10817 44
55 3300046543 Ga0495645_0001809 Ga0495645_0001809_268_402 44
56 3300046642 Ga0495634_0300642 Ga0495634_0300642_537_671 44
57 3300046675 Ga0495657_0000011 Ga0495657_0000011_132045_132179 44
58 3300046680 Ga0495646_0448537 Ga0495646_0448537_455_589 44
59 3300047320 Ga0495672_0236763 Ga0495672_0236763_391_528 44
60 3300047322 Ga0495680_0110254 Ga0495680_0110254_865_999 44
61 3300047322 Ga0495680_0262957 Ga0495680_0262957_44_178 44
62 3300047471 Ga0495684_0040677 Ga0495684_0040677_436_570 44
63 3300048905 Ga0496102_1382053 Ga0496102_1382053_273_407 44
64 3300048917 Ga0496114_0278522 Ga0496114_0278522_1118_1252 44
65 3300048918 Ga0496115_0000005 Ga0496115_0000005_46269_46403 44
66 3300049578 Ga0501042_0328722 Ga0501042_0328722_381_518 44
67 3300049743 Ga0501081_0121802 Ga0501081_0121802_1501_1635 44
68 3300049743 Ga0501081_0703125 Ga0501081_0703125_571_705 44
69 3300050515 nmdc:mga0a205_352_c1 nmdc:mga0a205_352_c1_29234_29368 44
70 3300053077 Ga0495601_0001623 Ga0495601_0001623_10507_10641 44
71 3300053078 Ga0495612_0000076 Ga0495612_0000076_33066_33200 44
72 3300053078 Ga0495612_0242074 Ga0495612_0242074_418_552 44
73 3300053085 Ga0495619_0000119 Ga0495619_0000119_34371_34505 44
74 3300053085 Ga0495619_0317725 Ga0495619_0317725_508_642 44
75 3300005337 Ga0070682_100099406 Ga0070682_1000994063 45
76 3300005337 Ga0070682_100622231 Ga0070682_1006222312 45
77 3300005338 Ga0068868_100528653 Ga0068868_1005286532 45
78 3300005340 Ga0070689_100270007 Ga0070689_1002700073 45
79 3300005341 Ga0070691_10160388 Ga0070691_101603883 45
80 3300005343 Ga0070687_100005363 Ga0070687_1000053634 45
81 3300005344 Ga0070661_100289889 Ga0070661_1002898892 45
82 3300005345 Ga0070692_10525890 Ga0070692_105258902 45
83 3300005347 Ga0070668_102179514 Ga0070668_1021795142 45
84 3300005354 Ga0070675_102144815 Ga0070675_1021448152 45
85 3300005355 Ga0070671_101112681 Ga0070671_1011126812 45
86 3300005356 Ga0070674_100364935 Ga0070674_1003649351 45
87 3300005435 Ga0070714_100428746 Ga0070714_1004287463 45
88 3300005435 Ga0070714_100833355 Ga0070714_1008333552 45
89 3300005436 Ga0070713_100083928 Ga0070713_1000839284 45
90 3300005441 Ga0070700_100078247 Ga0070700_1000782472 45
91 3300005441 Ga0070700_101516454 Ga0070700_1015164542 45
92 3300005455 Ga0070663_100582865 Ga0070663_1005828652 45
93 3300005456 Ga0070678_100374115 Ga0070678_1003741152 45
94 3300005457 Ga0070662_101036694 Ga0070662_1010366942 45
95 3300005459 Ga0068867_100084922 Ga0068867_1000849225 45
96 3300005459 Ga0068867_101600570 Ga0068867_1016005702 45
97 3300005539 Ga0068853_102008545 Ga0068853_1020085452 45
98 3300005544 Ga0070686_100990941 Ga0070686_1009909411 45
99 3300005546 Ga0070696_101962897 Ga0070696_1019628972 45
100 3300005547 Ga0070693_100535484 Ga0070693_1005354842 45
101 3300005549 Ga0070704_100465947 Ga0070704_1004659472 45
102 3300005563 Ga0068855_100595179 Ga0068855_1005951793 45
103 3300005577 Ga0068857_100367699 Ga0068857_1003676992 45
104 3300005578 Ga0068854_100524881 Ga0068854_1005248812 45
105 3300005614 Ga0068856_101280436 Ga0068856_1012804361 45
106 3300005615 Ga0070702_100000689 Ga0070702_1000006898 45
107 3300005616 Ga0068852_100172480 Ga0068852_1001724802 45
108 3300005617 Ga0068859_100655242 Ga0068859_1006552422 45
109 3300005618 Ga0068864_100450904 Ga0068864_1004509043 45
110 3300005718 Ga0068866_10158150 Ga0068866_101581502 45
111 3300005718 Ga0068866_10312917 Ga0068866_103129172 45
112 3300005719 Ga0068861_100054641 Ga0068861_1000546413 45
113 3300005840 Ga0068870_10039683 Ga0068870_100396832 45
114 3300006028 Ga0070717_10006646 Ga0070717_100066461 45
115 3300006880 Ga0075429_100106286 Ga0075429_1001062863 45
116 3300006881 Ga0068865_100852660 Ga0068865_1008526602 45
117 3300006914 Ga0075436_100235358 Ga0075436_1002353581 45
118 3300006931 Ga0097620_100655249 Ga0097620_1006552492 45
119 3300007076 Ga0075435_101855730 Ga0075435_1018557302 45
120 3300009093 Ga0105240_10652608 Ga0105240_106526082 45
121 3300009094 Ga0111539_10833148 Ga0111539_108331482 45
122 3300009094 Ga0111539_11440882 Ga0111539_114408822 45
123 3300009098 Ga0105245_10353310 Ga0105245_103533102 45
124 3300009098 Ga0105245_12403303 Ga0105245_124033032 45
125 3300009147 Ga0114129_12198678 Ga0114129_121986782 45
126 3300009147 Ga0114129_12964871 Ga0114129_129648712 45
127 3300009148 Ga0105243_10108607 Ga0105243_101086073 45
128 3300009148 Ga0105243_11595895 Ga0105243_115958952 45
129 3300009174 Ga0105241_10792312 Ga0105241_107923122 45
130 3300009176 Ga0105242_12324781 Ga0105242_123247812 45
131 3300009177 Ga0105248_11586202 Ga0105248_115862022 45
132 3300009551 Ga0105238_10968046 Ga0105238_109680462 45
133 3300009553 Ga0105249_10371868 Ga0105249_103718683 45
134 3300010375 Ga0105239_10432380 Ga0105239_104323803 45
135 3300011119 Ga0105246_10992856 Ga0105246_109928562 45
136 3300013296 Ga0157374_11180175 Ga0157374_111801752 45
137 3300013306 Ga0163162_10218868 Ga0163162_102188683 45
138 3300013307 Ga0157372_10291124 Ga0157372_102911243 45
139 3300013307 Ga0157372_13350217 Ga0157372_133502172 45
140 3300013308 Ga0157375_10895996 Ga0157375_108959963 45
141 3300014325 Ga0163163_11286173 Ga0163163_112861732 45
142 3300014497 Ga0182008_10071873 Ga0182008_100718732 45
143 3300014745 Ga0157377_10136393 Ga0157377_101363933 45
144 3300020070 Ga0206356_11681944 Ga0206356_116819442 45
145 3300020080 Ga0206350_11661502 Ga0206350_116615021 45
146 3300020081 Ga0206354_10154821 Ga0206354_101548212 45
147 3300020081 Ga0206354_10420497 Ga0206354_104204973 45
148 3300020082 Ga0206353_10137514 Ga0206353_101375143 45
149 3300020082 Ga0206353_11401555 Ga0206353_114015552 45
150 3300021384 Ga0213876_10019184 Ga0213876_100191845 45
151 3300021384 Ga0213876_10051432 Ga0213876_100514323 45
152 3300021384 Ga0213876_10098734 Ga0213876_100987342 45
153 3300021384 Ga0213876_10597218 Ga0213876_105972183 45
154 3300021388 Ga0213875_10009419 Ga0213875_100094193 45
155 3300021388 Ga0213875_10011176 Ga0213875_100111764 45
156 3300021388 Ga0213875_10073704 Ga0213875_100737043 45
157 3300021388 Ga0213875_10085100 Ga0213875_100851003 45
158 3300021388 Ga0213875_10173422 Ga0213875_101734222 45
159 3300021388 Ga0213875_10214026 Ga0213875_102140262 45
160 3300021388 Ga0213875_10299620 Ga0213875_102996202 45
161 3300021388 Ga0213875_10407570 Ga0213875_104075702 45
162 3300021388 Ga0213875_10557672 Ga0213875_105576721 45
163 3300021388 Ga0213875_10570645 Ga0213875_105706452 45
164 3300022467 Ga0224712_10116191 Ga0224712_101161914 45
165 3300025899 Ga0207642_10256672 Ga0207642_102566722 45
166 3300025901 Ga0207688_10050264 Ga0207688_100502642 45
167 3300025908 Ga0207643_10146769 Ga0207643_101467693 45
168 3300025908 Ga0207643_10415234 Ga0207643_104152342 45
169 3300025912 Ga0207707_10582119 Ga0207707_105821194 45
170 3300025913 Ga0207695_11334173 Ga0207695_113341732 45
171 3300025913 Ga0207695_11484045 Ga0207695_114840452 45
172 3300025916 Ga0207663_11227145 Ga0207663_112271452 45
173 3300025918 Ga0207662_10011742 Ga0207662_100117427 45
174 3300025921 Ga0207652_10644900 Ga0207652_106449001 45
175 3300025924 Ga0207694_10634554 Ga0207694_106345542 45
176 3300025926 Ga0207659_11454150 Ga0207659_114541502 45
177 3300025927 Ga0207687_10295611 Ga0207687_102956113 45
178 3300025929 Ga0207664_10013009 Ga0207664_100130092 45
179 3300025929 Ga0207664_10810548 Ga0207664_108105482 45
180 3300025934 Ga0207686_10657024 Ga0207686_106570242 45
181 3300025935 Ga0207709_10035456 Ga0207709_100354563 45
182 3300025937 Ga0207669_11143574 Ga0207669_111435742 45
183 3300025938 Ga0207704_10137103 Ga0207704_101371035 45
184 3300025941 Ga0207711_10973633 Ga0207711_109736332 45
185 3300025942 Ga0207689_10346365 Ga0207689_103463652 45
186 3300025944 Ga0207661_10965651 Ga0207661_109656512 45
187 3300025945 Ga0207679_10637145 Ga0207679_106371453 45
188 3300025972 Ga0207668_11419331 Ga0207668_114193312 45
189 3300025981 Ga0207640_10998279 Ga0207640_109982792 45
190 3300026023 Ga0207677_10548521 Ga0207677_105485212 45
191 3300026035 Ga0207703_10063809 Ga0207703_100638092 45
192 3300026067 Ga0207678_10109058 Ga0207678_101090585 45
193 3300026075 Ga0207708_10008594 Ga0207708_100085946 45
194 3300026075 Ga0207708_10564672 Ga0207708_105646722 45
195 3300026078 Ga0207702_10356795 Ga0207702_103567953 45
196 3300026088 Ga0207641_12553418 Ga0207641_125534182 45
197 3300026089 Ga0207648_10525105 Ga0207648_105251052 45
198 3300026095 Ga0207676_10495760 Ga0207676_104957602 45
199 3300026116 Ga0207674_10069309 Ga0207674_100693097 45
200 3300026118 Ga0207675_100034236 Ga0207675_1000342364 45
201 3300026142 Ga0207698_10239135 Ga0207698_102391353 45
202 3300028380 Ga0268265_10317226 Ga0268265_103172262 45
203 3300028381 Ga0268264_11440621 Ga0268264_114406212 45
204 3300031238 Ga0265332_10356164 Ga0265332_103561641 45
205 3300031240 Ga0265320_10018068 Ga0265320_100180686 45
206 3300031548 Ga0307408_100996342 Ga0307408_1009963422 45
207 3300031731 Ga0307405_12048016 Ga0307405_120480161 45
208 3300031824 Ga0307413_10174734 Ga0307413_101747343 45
209 3300031824 Ga0307413_10808228 Ga0307413_108082282 45
210 3300031852 Ga0307410_10126944 Ga0307410_101269444 45
211 3300031852 Ga0307410_12034751 Ga0307410_120347512 45
212 3300031901 Ga0307406_10698950 Ga0307406_106989502 45
213 3300031995 Ga0307409_100094619 Ga0307409_1000946194 45
214 3300031995 Ga0307409_101381197 Ga0307409_1013811972 45
215 3300031995 Ga0307409_102240042 Ga0307409_1022400422 45
216 3300032002 Ga0307416_103490034 Ga0307416_1034900342 45
217 3300032004 Ga0307414_10311225 Ga0307414_103112252 45
218 3300032004 Ga0307414_12119301 Ga0307414_121193012 45
219 3300032126 Ga0307415_100056902 Ga0307415_1000569023 45
220 3300032126 Ga0307415_102525197 Ga0307415_1025251972 45
221 3300036401 Ga0373937_1378020 Ga0373937_1378020_355_495 45
222 3300037853 Ga0436364_0066028 Ga0436364_0066028_923_1060 45
223 3300037853 Ga0436364_0079058 Ga0436364_0079058_402_539 45
224 3300037853 Ga0436364_0256505 Ga0436364_0256505_3852_3989 45
225 3300037853 Ga0436364_0337952 Ga0436364_0337952_1095_1232 45
226 3300037853 Ga0436364_0549585 Ga0436364_0549585_34_171 45
227 3300037853 Ga0436364_1110030 Ga0436364_1110030_11210_11347 45
228 3300037853 Ga0436364_1326262 Ga0436364_1326262_3387_3524 45
229 3300037853 Ga0436364_1541019 Ga0436364_1541019_201_338 45
230 3300037853 Ga0436364_1564718 Ga0436364_1564718_1815_1952 45
231 3300039437 Ga0436365_0126994 Ga0436365_0126994_459_596 45
232 3300039437 Ga0436365_0320671 Ga0436365_0320671_8752_8889 45
233 3300039437 Ga0436365_0413376 Ga0436365_0413376_1125_1262 45
234 3300039437 Ga0436365_0490499 Ga0436365_0490499_615_752 45
235 3300039437 Ga0436365_0681915 Ga0436365_0681915_3953_4090 45
236 3300039437 Ga0436365_1445890 Ga0436365_1445890_451_588 45
237 3300039437 Ga0436365_1461348 Ga0436365_1461348_1080_1217 45
238 3300039437 Ga0436365_1580551 Ga0436365_1580551_3828_3965 45
239 3300039437 Ga0436365_1637070 Ga0436365_1637070_2036_2173 45
240 3300039450 Ga0436363_0127754 Ga0436363_0127754_1016_1153 45
241 3300039450 Ga0436363_0365240 Ga0436363_0365240_392_529 45
242 3300039450 Ga0436363_0865842 Ga0436363_0865842_982_1119 45
243 3300039450 Ga0436363_1615119 Ga0436363_1615119_129_266 45
244 3300039450 Ga0436363_1660580 Ga0436363_1660580_1602_1739 45
245 3300039453 Ga0436362_0033283 Ga0436362_0033283_1168_1305 45
246 3300039453 Ga0436362_0121361 Ga0436362_0121361_620_757 45
247 3300039453 Ga0436362_1079981 Ga0436362_1079981_478_615 45
248 3300039453 Ga0436362_1134516 Ga0436362_1134516_279_416 45
249 3300041441 Ga0451787_446334 Ga0451787_446334_293_430 45
250 3300041496 Ga0451839_0267224 Ga0451839_0267224_207_344 45
251 3300044656 Ga0466969_0364954 Ga0466969_0364954_447_584 45
252 3300044683 Ga0466965_0152362 Ga0466965_0152362_381_518 45
253 3300044683 Ga0466965_0368635 Ga0466965_0368635_45_182 45
254 3300044684 Ga0466966_0052340 Ga0466966_0052340_536_673 45
255 3300044684 Ga0466966_0067776 Ga0466966_0067776_661_798 45
256 3300044684 Ga0466966_0421392 Ga0466966_0421392_120_257 45
257 3300044684 Ga0466966_0422030 Ga0466966_0422030_78_215 45
258 3300044684 Ga0466966_1014228 Ga0466966_1014228_79_216 45
259 3300044693 Ga0466961_0058579 Ga0466961_0058579_773_910 45
260 3300044693 Ga0466961_0949118 Ga0466961_0949118_253_390 45
261 3300044694 Ga0466963_0005515 Ga0466963_0005515_330_467 45
262 3300044694 Ga0466963_0032477 Ga0466963_0032477_186_323 45
263 3300044694 Ga0466963_0070309 Ga0466963_0070309_1156_1293 45
264 3300044694 Ga0466963_0290208 Ga0466963_0290208_966_1103 45
265 3300044694 Ga0466963_0524079 Ga0466963_0524079_641_778 45
266 3300044694 Ga0466963_0601962 Ga0466963_0601962_450_587 45
267 3300044694 Ga0466963_0616340 Ga0466963_0616340_43_180 45
268 3300044706 Ga0466964_0035803 Ga0466964_0035803_951_1088 45
269 3300044719 Ga0466971_0011620 Ga0466971_0011620_519_656 45
270 3300044719 Ga0466971_0030442 Ga0466971_0030442_41_178 45
271 3300044719 Ga0466971_0088451 Ga0466971_0088451_59_196 45
272 3300044719 Ga0466971_0147005 Ga0466971_0147005_56_193 45
273 3300044719 Ga0466971_0208442 Ga0466971_0208442_205_342 45
274 3300044765 Ga0466970_0022065 Ga0466970_0022065_2824_2961 45
275 3300044765 Ga0466970_0060652 Ga0466970_0060652_343_480 45
276 3300044765 Ga0466970_0248730 Ga0466970_0248730_566_703 45
277 3300044765 Ga0466970_0734634 Ga0466970_0734634_312_449 45
278 3300044842 Ga0466957_0183649 Ga0466957_0183649_1194_1331 45
279 3300044842 Ga0466957_0184629 Ga0466957_0184629_910_1047 45
280 3300044842 Ga0466957_0229222 Ga0466957_0229222_440_577 45
281 3300045049 Ga0466959_0017058 Ga0466959_0017058_1001_1138 45
282 3300045049 Ga0466959_0159288 Ga0466959_0159288_244_381 45
283 3300045049 Ga0466959_0231441 Ga0466959_0231441_139_276 45
284 3300045049 Ga0466959_0651910 Ga0466959_0651910_168_305 45
285 3300045049 Ga0466959_0657568 Ga0466959_0657568_113_250 45
286 3300045049 Ga0466959_0716066 Ga0466959_0716066_403_540 45
287 3300045836 Ga0466958_0005993 Ga0466958_0005993_3826_3963 45
288 3300045836 Ga0466958_0058113 Ga0466958_0058113_661_798 45
289 3300045836 Ga0466958_0065166 Ga0466958_0065166_186_323 45
290 3300045836 Ga0466958_0138529 Ga0466958_0138529_1305_1457 45
291 3300045836 Ga0466958_0174031 Ga0466958_0174031_647_784 45
292 3300045976 Ga0466967_0001141 Ga0466967_0001141_175_312 45
293 3300045976 Ga0466967_0025580 Ga0466967_0025580_2143_2280 45
294 3300045976 Ga0466967_0059392 Ga0466967_0059392_124_261 45
295 3300045976 Ga0466967_0150694 Ga0466967_0150694_2005_2142 45
296 3300045976 Ga0466967_0163800 Ga0466967_0163800_1747_1884 45
297 3300045976 Ga0466967_0310767 Ga0466967_0310767_270_407 45
298 3300045976 Ga0466967_0692015 Ga0466967_0692015_10_147 45
299 3300045976 Ga0466967_1081575 Ga0466967_1081575_368_505 45
300 3300045976 Ga0466967_1194413 Ga0466967_1194413_173_310 45
301 3300045976 Ga0466967_1586484 Ga0466967_1586484_30_179 45
302 3300045976 Ga0466967_1850955 Ga0466967_1850955_214_351 45
303 3300045976 Ga0466967_1912755 Ga0466967_1912755_186_323 45
304 3300045976 Ga0466967_2506663 Ga0466967_2506663_242_379 45
305 3300046477 Ga0495664_0222435 Ga0495664_0222435_283_429 45
306 3300046500 Ga0495596_0395032 Ga0495596_0395032_85_222 45
307 3300046516 Ga0495628_0729374 Ga0495628_0729374_344_481 45
308 3300046533 Ga0495640_0733151 Ga0495640_0733151_399_536 45
309 3300046616 Ga0495668_0444982 Ga0495668_0444982_544_681 45
310 3300047319 Ga0495674_0224962 Ga0495674_0224962_1332_1478 45
311 3300048903 Ga0496100_0000226 Ga0496100_0000226_11469_11618 45
312 3300048904 Ga0496101_0000492 Ga0496101_0000492_3979_4128 45
313 3300048905 Ga0496102_0221639 Ga0496102_0221639_279_416 45
314 3300048909 Ga0496106_0035731 Ga0496106_0035731_914_1051 45
315 3300048910 Ga0496107_1333656 Ga0496107_1333656_22_159 45
316 3300048911 Ga0496108_0233472 Ga0496108_0233472_585_722 45
317 3300048911 Ga0496108_0636401 Ga0496108_0636401_603_740 45
318 3300048912 Ga0496109_0002320 Ga0496109_0002320_2852_3001 45
319 3300048912 Ga0496109_0136090 Ga0496109_0136090_1431_1568 45
320 3300048913 Ga0496110_0218354 Ga0496110_0218354_50_187 45
321 3300048913 Ga0496110_0565107 Ga0496110_0565107_521_670 45
322 3300048913 Ga0496110_1022254 Ga0496110_1022254_454_591 45
323 3300048914 Ga0496111_0046310 Ga0496111_0046310_1149_1298 45
324 3300048914 Ga0496111_0303137 Ga0496111_0303137_267_404 45
325 3300049576 Ga0501040_0494192 Ga0501040_0494192_716_853 45
326 3300049583 Ga0501067_0491901 Ga0501067_0491901_285_422 45
327 3300049741 Ga0501079_1558690 Ga0501079_1558690_323_460 45
328 3300050507 nmdc:mga05p37_1911004_c1 nmdc:mga05p37_1911004_c1_154_291 45
329 3300050508 nmdc:mga09592_98323_c1 nmdc:mga09592_98323_c1_1001_1150 45
330 3300050510 nmdc:mga06r32_1410263_c1 nmdc:mga06r32_1410263_c1_110_247 45
331 3300050511 nmdc:mga08y16_1377212_c1 nmdc:mga08y16_1377212_c1_484_621 45
332 3300050515 nmdc:mga0a205_1389911_c1 nmdc:mga0a205_1389911_c1_46_195 45
333 3300053083 Ga0495655_0164238 Ga0495655_0164238_247_384 45
334 3300053085 Ga0495619_0136456 Ga0495619_0136456_697_837 45
335 3300054114 Ga0501084_0488267 Ga0501084_0488267_642_779 45
336 3300061719 Ga0466962_0051266 Ga0466962_0051266_1136_1273 45
337 3300061719 Ga0466962_0083275 Ga0466962_0083275_340_477 45
338 3300061719 Ga0466962_0119449 Ga0466962_0119449_1011_1148 45
339 3300061719 Ga0466962_0317793 Ga0466962_0317793_545_682 45
340 3300061719 Ga0466962_0656051 Ga0466962_0656051_21_170 45

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bzl-assembly1.cif.gz_G human 20s proteasome in complex with peptide activator peptide blm42 0.9393 23 44
5ley-assembly1.cif.gz_U human 20s proteasome complex with oprozomib at 1.9 angstrom 0.9369 23 44
6r70-assembly1.cif.gz_U endogeneous native human 20s proteasome 0.9341 23 44
6muw-assembly1.cif.gz_G the structure of the plasmodium falciparum 20s proteasome. 0.9338 21 44
8bzl-assembly1.cif.gz_U human 20s proteasome in complex with peptide activator peptide blm42 0.9332 23 44
ID Description Score Start End Superfamily
af_K7LJI3_116_648_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.9644 28 42 2.60.40.150
4hc9A01 Alpha Beta;2-Layer Sandwich;Erythroid Transcription Factor GATA-1; Chain A;Erythroid Transcription Factor GATA-1, subunit A 0.9601 30 45 3.30.50.10
af_O77396_1_252_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9286 25 44 3.60.20.10
af_Q8IAR3_1_260_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9247 22 44 3.60.20.10
af_Q54M79_16_215_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.9213 26 43 3.30.450.50
ID Description Score Start End GO Terms
AF-A0A4Z2H615-F1-model_v4 Uncharacterized protein 0.6652 9 45
AF-A0A4Z2H615-F1-model_v4 Uncharacterized protein 0.5489 9 45

Feature Viewer

pLDDT pTM Quality
90.8 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map