F414387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 199 | 340 | 45 |
Family's Representative Sequence
| Representative Sequence | 3300031238|Ga0265332_10356164|Ga0265332_103561641 |
| Length | 55 |
| Sequence | LATTVGNRLTAMENEMVKRLMWSGLLAGVSALASVAANRVAGVIWRRLFDEEPPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 3 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 2.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.29 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070682_100099406 | 3300005337 | Bacteria | 1918 |
| 2 | Ga0070682_100622231 | 3300005337 | Bacteria | 856 |
| 3 | Ga0068868_100528653 | 3300005338 | Bacteria | 1036 |
| 4 | Ga0070689_100270007 | 3300005340 | Bacteria | 1408 |
| 5 | Ga0070691_10160388 | 3300005341 | Bacteria | 1159 |
| 6 | Ga0070687_100005363 | 3300005343 | Bacteria | 5186 |
| 7 | Ga0070661_100289889 | 3300005344 | Bacteria | 1272 |
| 8 | Ga0070692_10525890 | 3300005345 | Bacteria | 771 |
| 9 | Ga0070668_102179514 | 3300005347 | Unclassified | 512 |
| 10 | Ga0070675_102144815 | 3300005354 | Unclassified | 515 |
| 11 | Ga0070671_101112681 | 3300005355 | Bacteria | 694 |
| 12 | Ga0070674_100364935 | 3300005356 | Unclassified | 1170 |
| 13 | Ga0070709_10472648 | 3300005434 | Bacteria | 948 |
| 14 | Ga0070714_100428746 | 3300005435 | Bacteria | 1253 |
| 15 | Ga0070714_100575534 | 3300005435 | Bacteria | 1080 |
| 16 | Ga0070714_100833355 | 3300005435 | Bacteria | 894 |
| 17 | Ga0070713_100083928 | 3300005436 | Bacteria | 2724 |
| 18 | Ga0070713_100153283 | 3300005436 | Bacteria | 2052 |
| 19 | Ga0070700_100078247 | 3300005441 | Bacteria | 2129 |
| 20 | Ga0070700_101516454 | 3300005441 | Unclassified | 570 |
| 21 | Ga0070663_100582865 | 3300005455 | Bacteria | 939 |
| 22 | Ga0070678_100374115 | 3300005456 | Bacteria | 1231 |
| 23 | Ga0070662_101036694 | 3300005457 | Bacteria | 703 |
| 24 | Ga0068867_100084922 | 3300005459 | Bacteria | 2393 |
| 25 | Ga0068867_101600570 | 3300005459 | Bacteria | 609 |
| 26 | Ga0068853_102008545 | 3300005539 | Bacteria | 561 |
| 27 | Ga0070686_100990941 | 3300005544 | Bacteria | 689 |
| 28 | Ga0070696_101962897 | 3300005546 | Bacteria | 508 |
| 29 | Ga0070693_100535484 | 3300005547 | Bacteria | 836 |
| 30 | Ga0070704_100465947 | 3300005549 | Bacteria | 1091 |
| 31 | Ga0068855_100595179 | 3300005563 | Bacteria | 1193 |
| 32 | Ga0068857_100367699 | 3300005577 | Bacteria | 1334 |
| 33 | Ga0068854_100524881 | 3300005578 | Bacteria | 1001 |
| 34 | Ga0068856_101280436 | 3300005614 | Bacteria | 749 |
| 35 | Ga0068856_102366972 | 3300005614 | Unclassified | 539 |
| 36 | Ga0070702_100000689 | 3300005615 | Bacteria | 12722 |
| 37 | Ga0068852_100172480 | 3300005616 | Bacteria | 2029 |
| 38 | Ga0068859_100655242 | 3300005617 | Bacteria | 1142 |
| 39 | Ga0068864_100450904 | 3300005618 | Unclassified | 1230 |
| 40 | Ga0068866_10009163 | 3300005718 | Bacteria | 4196 |
| 41 | Ga0068866_10158150 | 3300005718 | Bacteria | 1319 |
| 42 | Ga0068866_10312917 | 3300005718 | Bacteria | 985 |
| 43 | Ga0068861_100054641 | 3300005719 | Bacteria | 3043 |
| 44 | Ga0068861_102540589 | 3300005719 | Bacteria | 516 |
| 45 | Ga0068870_10039683 | 3300005840 | Bacteria | 2437 |
| 46 | Ga0081538_10006570 | 3300005981 | Bacteria | 10208 |
| 47 | Ga0081538_10024187 | 3300005981 | Bacteria | 4334 |
| 48 | Ga0070717_10006646 | 3300006028 | Bacteria | 8524 |
| 49 | Ga0070717_11530347 | 3300006028 | Bacteria | 605 |
| 50 | Ga0070712_101035728 | 3300006175 | Bacteria | 711 |
| 51 | Ga0068871_101045746 | 3300006358 | Bacteria | 762 |
| 52 | Ga0075433_10002298 | 3300006852 | Bacteria | 14559 |
| 53 | Ga0075429_100106286 | 3300006880 | Bacteria | 2452 |
| 54 | Ga0068865_100852660 | 3300006881 | Bacteria | 789 |
| 55 | Ga0075436_100235358 | 3300006914 | Bacteria | 1301 |
| 56 | Ga0097620_100655249 | 3300006931 | Bacteria | 1142 |
| 57 | Ga0075435_101855730 | 3300007076 | Bacteria | 529 |
| 58 | Ga0105240_10652608 | 3300009093 | Bacteria | 1153 |
| 59 | Ga0111539_10833148 | 3300009094 | Bacteria | 1073 |
| 60 | Ga0111539_11440882 | 3300009094 | Bacteria | 799 |
| 61 | Ga0105245_10353310 | 3300009098 | Bacteria | 1457 |
| 62 | Ga0105245_12403303 | 3300009098 | Unclassified | 580 |
| 63 | Ga0114129_12198678 | 3300009147 | Bacteria | 664 |
| 64 | Ga0114129_12964871 | 3300009147 | Bacteria | 559 |
| 65 | Ga0105243_10046255 | 3300009148 | Bacteria | 3423 |
| 66 | Ga0105243_10108607 | 3300009148 | Bacteria | 2316 |
| 67 | Ga0105243_11595895 | 3300009148 | Bacteria | 679 |
| 68 | Ga0105241_10792312 | 3300009174 | Bacteria | 872 |
| 69 | Ga0105242_10014779 | 3300009176 | Bacteria | 6045 |
| 70 | Ga0105242_12324781 | 3300009176 | Bacteria | 583 |
| 71 | Ga0105248_11586202 | 3300009177 | Bacteria | 741 |
| 72 | Ga0105238_10968046 | 3300009551 | Bacteria | 871 |
| 73 | Ga0105249_10371868 | 3300009553 | Bacteria | 1453 |
| 74 | Ga0105239_10432380 | 3300010375 | Bacteria | 1492 |
| 75 | Ga0105239_11314893 | 3300010375 | Bacteria | 834 |
| 76 | Ga0105239_12796628 | 3300010375 | Bacteria | 569 |
| 77 | Ga0105246_10992856 | 3300011119 | Bacteria | 759 |
| 78 | Ga0157374_11180175 | 3300013296 | Bacteria | 787 |
| 79 | Ga0163162_10218868 | 3300013306 | Bacteria | 2034 |
| 80 | Ga0157372_10291124 | 3300013307 | Bacteria | 1899 |
| 81 | Ga0157372_13003762 | 3300013307 | Bacteria | 539 |
| 82 | Ga0157372_13350217 | 3300013307 | Bacteria | 510 |
| 83 | Ga0157375_10895996 | 3300013308 | Bacteria | 1031 |
| 84 | Ga0163163_11286173 | 3300014325 | Bacteria | 794 |
| 85 | Ga0182008_10071873 | 3300014497 | Bacteria | 1702 |
| 86 | Ga0157377_10136393 | 3300014745 | Bacteria | 1504 |
| 87 | Ga0206356_11681944 | 3300020070 | Bacteria | 720 |
| 88 | Ga0206350_11661502 | 3300020080 | Bacteria | 517 |
| 89 | Ga0206354_10154821 | 3300020081 | Bacteria | 628 |
| 90 | Ga0206354_10420497 | 3300020081 | Bacteria | 659 |
| 91 | Ga0206353_10137514 | 3300020082 | Bacteria | 565 |
| 92 | Ga0206353_11401555 | 3300020082 | Bacteria | 724 |
| 93 | Ga0213876_10019184 | 3300021384 | Bacteria | 3611 |
| 94 | Ga0213876_10051432 | 3300021384 | Bacteria | 2177 |
| 95 | Ga0213876_10098734 | 3300021384 | Bacteria | 1548 |
| 96 | Ga0213876_10597218 | 3300021384 | Bacteria | 587 |
| 97 | Ga0213875_10009419 | 3300021388 | Bacteria | 4947 |
| 98 | Ga0213875_10011176 | 3300021388 | Bacteria | 4474 |
| 99 | Ga0213875_10073704 | 3300021388 | Bacteria | 1593 |
| 100 | Ga0213875_10085100 | 3300021388 | Bacteria | 1475 |
| 101 | Ga0213875_10173422 | 3300021388 | Bacteria | 1013 |
| 102 | Ga0213875_10214026 | 3300021388 | Unclassified | 907 |
| 103 | Ga0213875_10299620 | 3300021388 | Unclassified | 760 |
| 104 | Ga0213875_10407570 | 3300021388 | Bacteria | 648 |
| 105 | Ga0213875_10557672 | 3300021388 | Archaea | 552 |
| 106 | Ga0213875_10570645 | 3300021388 | Unclassified | 546 |
| 107 | Ga0224712_10116191 | 3300022467 | Bacteria | 1153 |
| 108 | Ga0207692_10038996 | 3300025898 | Bacteria | 2334 |
| 109 | Ga0207642_10000038 | 3300025899 | Bacteria | 38220 |
| 110 | Ga0207642_10256672 | 3300025899 | Bacteria | 995 |
| 111 | Ga0207688_10050264 | 3300025901 | Bacteria | 2333 |
| 112 | Ga0207643_10146769 | 3300025908 | Bacteria | 1411 |
| 113 | Ga0207643_10415234 | 3300025908 | Bacteria | 852 |
| 114 | Ga0207707_10582119 | 3300025912 | Bacteria | 949 |
| 115 | Ga0207695_11334173 | 3300025913 | Bacteria | 598 |
| 116 | Ga0207695_11484045 | 3300025913 | Bacteria | 558 |
| 117 | Ga0207663_11227145 | 3300025916 | Unclassified | 604 |
| 118 | Ga0207662_10011742 | 3300025918 | Bacteria | 4866 |
| 119 | Ga0207652_10644900 | 3300025921 | Bacteria | 947 |
| 120 | Ga0207694_10634554 | 3300025924 | Bacteria | 899 |
| 121 | Ga0207659_11454150 | 3300025926 | Unclassified | 587 |
| 122 | Ga0207687_10295611 | 3300025927 | Bacteria | 1303 |
| 123 | Ga0207700_10027685 | 3300025928 | Bacteria | 3974 |
| 124 | Ga0207664_10013009 | 3300025929 | Bacteria | 5963 |
| 125 | Ga0207664_10810548 | 3300025929 | Bacteria | 842 |
| 126 | Ga0207664_11048417 | 3300025929 | Bacteria | 730 |
| 127 | Ga0207686_10013202 | 3300025934 | Bacteria | 4567 |
| 128 | Ga0207686_10657024 | 3300025934 | Bacteria | 830 |
| 129 | Ga0207709_10016389 | 3300025935 | Bacteria | 4118 |
| 130 | Ga0207709_10035456 | 3300025935 | Bacteria | 2949 |
| 131 | Ga0207669_10000010 | 3300025937 | Bacteria | 150070 |
| 132 | Ga0207669_11143574 | 3300025937 | Unclassified | 658 |
| 133 | Ga0207704_10137103 | 3300025938 | Bacteria | 1705 |
| 134 | Ga0207665_10172452 | 3300025939 | Bacteria | 1563 |
| 135 | Ga0207711_10973633 | 3300025941 | Bacteria | 787 |
| 136 | Ga0207689_10346365 | 3300025942 | Bacteria | 1235 |
| 137 | Ga0207661_10965651 | 3300025944 | Bacteria | 785 |
| 138 | Ga0207679_10637145 | 3300025945 | Unclassified | 963 |
| 139 | Ga0207668_11419331 | 3300025972 | Bacteria | 626 |
| 140 | Ga0207640_10998279 | 3300025981 | Bacteria | 736 |
| 141 | Ga0207677_10548521 | 3300026023 | Bacteria | 1007 |
| 142 | Ga0207703_10063809 | 3300026035 | Bacteria | 3021 |
| 143 | Ga0207678_10109058 | 3300026067 | Bacteria | 2361 |
| 144 | Ga0207708_10008594 | 3300026075 | Bacteria | 7557 |
| 145 | Ga0207708_10564672 | 3300026075 | Bacteria | 961 |
| 146 | Ga0207702_10356795 | 3300026078 | Bacteria | 1400 |
| 147 | Ga0207641_12553418 | 3300026088 | Unclassified | 509 |
| 148 | Ga0207648_10525105 | 3300026089 | Bacteria | 1085 |
| 149 | Ga0207676_10495760 | 3300026095 | Unclassified | 1159 |
| 150 | Ga0207674_10069309 | 3300026116 | Bacteria | 3547 |
| 151 | Ga0207675_100034236 | 3300026118 | Bacteria | 4735 |
| 152 | Ga0207675_102041751 | 3300026118 | Bacteria | 590 |
| 153 | Ga0207698_10239135 | 3300026142 | Bacteria | 1654 |
| 154 | Ga0268265_10317226 | 3300028380 | Bacteria | 1410 |
| 155 | Ga0268264_11440621 | 3300028381 | Bacteria | 699 |
| 156 | Ga0265326_10023603 | 3300028558 | Bacteria | 1757 |
| 157 | Ga0265323_10186187 | 3300028653 | Bacteria | 656 |
| 158 | Ga0265322_10083393 | 3300028654 | Bacteria | 907 |
| 159 | Ga0265336_10117599 | 3300028666 | Bacteria | 792 |
| 160 | Ga0265338_10077069 | 3300028800 | Bacteria | 2820 |
| 161 | Ga0265324_10058394 | 3300029957 | Bacteria | 1320 |
| 162 | Ga0265330_10292371 | 3300031235 | Bacteria | 686 |
| 163 | Ga0265332_10356164 | 3300031238 | Bacteria | 604 |
| 164 | Ga0265320_10018068 | 3300031240 | Bacteria | 3894 |
| 165 | Ga0265325_10164170 | 3300031241 | Bacteria | 1043 |
| 166 | Ga0265331_10102251 | 3300031250 | Bacteria | 1318 |
| 167 | Ga0265327_10014430 | 3300031251 | Bacteria | 5169 |
| 168 | Ga0307408_100996342 | 3300031548 | Bacteria | 772 |
| 169 | Ga0265342_10226511 | 3300031712 | Bacteria | 1005 |
| 170 | Ga0307405_12048016 | 3300031731 | Unclassified | 513 |
| 171 | Ga0307413_10174734 | 3300031824 | Bacteria | 1525 |
| 172 | Ga0307413_10808228 | 3300031824 | Bacteria | 789 |
| 173 | Ga0307410_10126944 | 3300031852 | Bacteria | 1869 |
| 174 | Ga0307410_11143737 | 3300031852 | Bacteria | 676 |
| 175 | Ga0307410_12034751 | 3300031852 | Bacteria | 513 |
| 176 | Ga0307406_10698950 | 3300031901 | Bacteria | 846 |
| 177 | Ga0307409_100094619 | 3300031995 | Bacteria | 2459 |
| 178 | Ga0307409_101381197 | 3300031995 | Bacteria | 730 |
| 179 | Ga0307409_102240042 | 3300031995 | Bacteria | 576 |
| 180 | Ga0307416_101203106 | 3300032002 | Bacteria | 863 |
| 181 | Ga0307416_103490034 | 3300032002 | Unclassified | 526 |
| 182 | Ga0307414_10311225 | 3300032004 | Bacteria | 1337 |
| 183 | Ga0307414_12119301 | 3300032004 | Bacteria | 525 |
| 184 | Ga0307415_100056902 | 3300032126 | Bacteria | 2684 |
| 185 | Ga0307415_102525197 | 3300032126 | Unclassified | 506 |
| 186 | Ga0373937_1378020 | 3300036401 | Bacteria | 653 |
| 187 | Ga0436364_0066028 | 3300037853 | Bacteria | 1200 |
| 188 | Ga0436364_0079058 | 3300037853 | Bacteria | 560 |
| 189 | Ga0436364_0256505 | 3300037853 | Bacteria | 4278 |
| 190 | Ga0436364_0337952 | 3300037853 | Bacteria | 1548 |
| 191 | Ga0436364_0549585 | 3300037853 | Bacteria | 915 |
| 192 | Ga0436364_1110030 | 3300037853 | Bacteria | 13224 |
| 193 | Ga0436364_1326262 | 3300037853 | Bacteria | 6276 |
| 194 | Ga0436364_1541019 | 3300037853 | Bacteria | 2970 |
| 195 | Ga0436364_1564718 | 3300037853 | Bacteria | 2231 |
| 196 | Ga0436365_0126994 | 3300039437 | Bacteria | 624 |
| 197 | Ga0436365_0320671 | 3300039437 | Bacteria | 13607 |
| 198 | Ga0436365_0413376 | 3300039437 | Bacteria | 3489 |
| 199 | Ga0436365_0490499 | 3300039437 | Bacteria | 985 |
| 200 | Ga0436365_0681915 | 3300039437 | Bacteria | 7618 |
| 201 | Ga0436365_1445890 | 3300039437 | Bacteria | 900 |
| 202 | Ga0436365_1461348 | 3300039437 | Bacteria | 1838 |
| 203 | Ga0436365_1580551 | 3300039437 | Bacteria | 12859 |
| 204 | Ga0436365_1637070 | 3300039437 | Bacteria | 2185 |
| 205 | Ga0436363_0127754 | 3300039450 | Bacteria | 1186 |
| 206 | Ga0436363_0365240 | 3300039450 | Bacteria | 691 |
| 207 | Ga0436363_0865842 | 3300039450 | Bacteria | 1215 |
| 208 | Ga0436363_1615119 | 3300039450 | Unclassified | 583 |
| 209 | Ga0436363_1660580 | 3300039450 | Bacteria | 2056 |
| 210 | Ga0436362_0033283 | 3300039453 | Bacteria | 2206 |
| 211 | Ga0436362_0121361 | 3300039453 | Bacteria | 887 |
| 212 | Ga0436362_1079981 | 3300039453 | Bacteria | 942 |
| 213 | Ga0436362_1134516 | 3300039453 | Bacteria | 509 |
| 214 | Ga0451787_446334 | 3300041441 | Bacteria | 516 |
| 215 | Ga0451839_0267224 | 3300041496 | Bacteria | 592 |
| 216 | Ga0451853_3742564 | 3300041512 | Bacteria | 768 |
| 217 | Ga0466969_0364954 | 3300044656 | Unclassified | 654 |
| 218 | Ga0466965_0152362 | 3300044683 | Bacteria | 1209 |
| 219 | Ga0466965_0368635 | 3300044683 | Bacteria | 789 |
| 220 | Ga0466966_0052340 | 3300044684 | Bacteria | 2594 |
| 221 | Ga0466966_0067776 | 3300044684 | Bacteria | 2241 |
| 222 | Ga0466966_0421392 | 3300044684 | Bacteria | 802 |
| 223 | Ga0466966_0422030 | 3300044684 | Bacteria | 802 |
| 224 | Ga0466966_1014228 | 3300044684 | Bacteria | 501 |
| 225 | Ga0466961_0058579 | 3300044693 | Bacteria | 2450 |
| 226 | Ga0466961_0949118 | 3300044693 | Bacteria | 511 |
| 227 | Ga0466963_0005515 | 3300044694 | Bacteria | 7406 |
| 228 | Ga0466963_0032477 | 3300044694 | Bacteria | 3381 |
| 229 | Ga0466963_0070309 | 3300044694 | Bacteria | 2354 |
| 230 | Ga0466963_0290208 | 3300044694 | Unclassified | 1150 |
| 231 | Ga0466963_0524079 | 3300044694 | Bacteria | 837 |
| 232 | Ga0466963_0601962 | 3300044694 | Bacteria | 776 |
| 233 | Ga0466963_0616340 | 3300044694 | Bacteria | 766 |
| 234 | Ga0466964_0035803 | 3300044706 | Bacteria | 1987 |
| 235 | Ga0466971_0011620 | 3300044719 | Bacteria | 3854 |
| 236 | Ga0466971_0030442 | 3300044719 | Bacteria | 2415 |
| 237 | Ga0466971_0088451 | 3300044719 | Bacteria | 1417 |
| 238 | Ga0466971_0147005 | 3300044719 | Bacteria | 1099 |
| 239 | Ga0466971_0208442 | 3300044719 | Bacteria | 924 |
| 240 | Ga0466970_0022065 | 3300044765 | Bacteria | 3323 |
| 241 | Ga0466970_0060652 | 3300044765 | Bacteria | 2026 |
| 242 | Ga0466970_0248730 | 3300044765 | Bacteria | 996 |
| 243 | Ga0466970_0734634 | 3300044765 | Bacteria | 576 |
| 244 | Ga0466957_0183649 | 3300044842 | Bacteria | 1367 |
| 245 | Ga0466957_0184629 | 3300044842 | Bacteria | 1363 |
| 246 | Ga0466957_0229222 | 3300044842 | Bacteria | 1229 |
| 247 | Ga0466960_0424848 | 3300044901 | Bacteria | 769 |
| 248 | Ga0466959_0017058 | 3300045049 | Bacteria | 5316 |
| 249 | Ga0466959_0159288 | 3300045049 | Bacteria | 1587 |
| 250 | Ga0466959_0231441 | 3300045049 | Bacteria | 1279 |
| 251 | Ga0466959_0651910 | 3300045049 | Bacteria | 707 |
| 252 | Ga0466959_0657568 | 3300045049 | Bacteria | 703 |
| 253 | Ga0466959_0716066 | 3300045049 | Bacteria | 670 |
| 254 | Ga0466958_0005993 | 3300045836 | Bacteria | 6582 |
| 255 | Ga0466958_0058113 | 3300045836 | Bacteria | 2351 |
| 256 | Ga0466958_0065166 | 3300045836 | Bacteria | 2223 |
| 257 | Ga0466958_0138529 | 3300045836 | Bacteria | 1531 |
| 258 | Ga0466958_0174031 | 3300045836 | Bacteria | 1364 |
| 259 | Ga0466967_0001141 | 3300045976 | Bacteria | 14830 |
| 260 | Ga0466967_0025580 | 3300045976 | Bacteria | 4871 |
| 261 | Ga0466967_0059392 | 3300045976 | Bacteria | 3385 |
| 262 | Ga0466967_0140931 | 3300045976 | Bacteria | 2246 |
| 263 | Ga0466967_0150694 | 3300045976 | Bacteria | 2173 |
| 264 | Ga0466967_0163800 | 3300045976 | Bacteria | 2089 |
| 265 | Ga0466967_0180824 | 3300045976 | Bacteria | 1989 |
| 266 | Ga0466967_0310767 | 3300045976 | Bacteria | 1518 |
| 267 | Ga0466967_0692015 | 3300045976 | Bacteria | 1009 |
| 268 | Ga0466967_1026799 | 3300045976 | Bacteria | 821 |
| 269 | Ga0466967_1081575 | 3300045976 | Unclassified | 799 |
| 270 | Ga0466967_1194413 | 3300045976 | Bacteria | 758 |
| 271 | Ga0466967_1264146 | 3300045976 | Bacteria | 735 |
| 272 | Ga0466967_1586484 | 3300045976 | Bacteria | 652 |
| 273 | Ga0466967_1850955 | 3300045976 | Bacteria | 600 |
| 274 | Ga0466967_1912755 | 3300045976 | Bacteria | 590 |
| 275 | Ga0466967_2506663 | 3300045976 | Bacteria | 511 |
| 276 | Ga0495653_0003139 | 3300046463 | Bacteria | 13240 |
| 277 | Ga0495664_0222435 | 3300046477 | Bacteria | 1143 |
| 278 | Ga0495596_0395032 | 3300046500 | Bacteria | 539 |
| 279 | Ga0495608_0269652 | 3300046511 | Bacteria | 1058 |
| 280 | Ga0495618_0000077 | 3300046514 | Bacteria | 69702 |
| 281 | Ga0495628_0729374 | 3300046516 | Bacteria | 698 |
| 282 | Ga0495630_0003770 | 3300046517 | Bacteria | 10586 |
| 283 | Ga0495666_0511923 | 3300046526 | Bacteria | 536 |
| 284 | Ga0495640_0427378 | 3300046533 | Bacteria | 811 |
| 285 | Ga0495640_0733151 | 3300046533 | Bacteria | 592 |
| 286 | Ga0495586_0539034 | 3300046535 | Bacteria | 674 |
| 287 | Ga0495587_0021968 | 3300046536 | Bacteria | 3933 |
| 288 | Ga0495645_0000050 | 3300046543 | Bacteria | 87415 |
| 289 | Ga0495645_0001809 | 3300046543 | Bacteria | 14530 |
| 290 | Ga0495668_0444982 | 3300046616 | Bacteria | 713 |
| 291 | Ga0495634_0300642 | 3300046642 | Bacteria | 970 |
| 292 | Ga0495657_0000011 | 3300046675 | Bacteria | 207360 |
| 293 | Ga0495646_0448537 | 3300046680 | Bacteria | 666 |
| 294 | Ga0495674_0224962 | 3300047319 | Bacteria | 1550 |
| 295 | Ga0495672_0236763 | 3300047320 | Bacteria | 893 |
| 296 | Ga0495680_0110254 | 3300047322 | Bacteria | 2040 |
| 297 | Ga0495680_0262957 | 3300047322 | Bacteria | 1220 |
| 298 | Ga0495684_0040677 | 3300047471 | Bacteria | 3563 |
| 299 | Ga0496100_0000226 | 3300048903 | Bacteria | 30341 |
| 300 | Ga0496101_0000492 | 3300048904 | Bacteria | 24919 |
| 301 | Ga0496102_0221639 | 3300048905 | Bacteria | 1783 |
| 302 | Ga0496102_1382053 | 3300048905 | Unclassified | 623 |
| 303 | Ga0496106_0035731 | 3300048909 | Bacteria | 3716 |
| 304 | Ga0496107_1333656 | 3300048910 | Bacteria | 512 |
| 305 | Ga0496108_0233472 | 3300048911 | Bacteria | 1600 |
| 306 | Ga0496108_0636401 | 3300048911 | Bacteria | 928 |
| 307 | Ga0496109_0002320 | 3300048912 | Bacteria | 15849 |
| 308 | Ga0496109_0136090 | 3300048912 | Bacteria | 2296 |
| 309 | Ga0496110_0218354 | 3300048913 | Bacteria | 1734 |
| 310 | Ga0496110_0565107 | 3300048913 | Bacteria | 1033 |
| 311 | Ga0496110_1022254 | 3300048913 | Bacteria | 734 |
| 312 | Ga0496111_0046310 | 3300048914 | Bacteria | 3131 |
| 313 | Ga0496111_0303137 | 3300048914 | Bacteria | 1184 |
| 314 | Ga0496114_0278522 | 3300048917 | Bacteria | 1474 |
| 315 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 316 | Ga0501040_0494192 | 3300049576 | Bacteria | 882 |
| 317 | Ga0501042_0328722 | 3300049578 | Bacteria | 1105 |
| 318 | Ga0501067_0491901 | 3300049583 | Bacteria | 686 |
| 319 | Ga0501079_1558690 | 3300049741 | Unclassified | 520 |
| 320 | Ga0501081_0121802 | 3300049743 | Bacteria | 1858 |
| 321 | Ga0501081_0703125 | 3300049743 | Unclassified | 759 |
| 322 | nmdc:mga05p37_1911004_c1 | 3300050507 | Bacteria | 566 |
| 323 | nmdc:mga09592_98323_c1 | 3300050508 | Bacteria | 2505 |
| 324 | nmdc:mga06r32_1410263_c1 | 3300050510 | Bacteria | 638 |
| 325 | nmdc:mga08y16_1377212_c1 | 3300050511 | Bacteria | 669 |
| 326 | nmdc:mga0a205_1389911_c1 | 3300050515 | Bacteria | 550 |
| 327 | nmdc:mga0a205_352_c1 | 3300050515 | Bacteria | 34822 |
| 328 | Ga0495601_0001623 | 3300053077 | Bacteria | 12376 |
| 329 | Ga0495612_0000076 | 3300053078 | Bacteria | 44649 |
| 330 | Ga0495612_0242074 | 3300053078 | Bacteria | 801 |
| 331 | Ga0495655_0164238 | 3300053083 | Bacteria | 707 |
| 332 | Ga0495619_0000119 | 3300053085 | Bacteria | 58302 |
| 333 | Ga0495619_0136456 | 3300053085 | Bacteria | 1688 |
| 334 | Ga0495619_0317725 | 3300053085 | Bacteria | 1078 |
| 335 | Ga0501084_0488267 | 3300054114 | Bacteria | 1041 |
| 336 | Ga0466962_0051266 | 3300061719 | Bacteria | 1973 |
| 337 | Ga0466962_0083275 | 3300061719 | Bacteria | 1530 |
| 338 | Ga0466962_0119449 | 3300061719 | Bacteria | 1271 |
| 339 | Ga0466962_0317793 | 3300061719 | Bacteria | 772 |
| 340 | Ga0466962_0656051 | 3300061719 | Bacteria | 537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10472648 | Ga0070709_104726481 | 44 |
| 2 | 3300005435 | Ga0070714_100575534 | Ga0070714_1005755341 | 44 |
| 3 | 3300005436 | Ga0070713_100153283 | Ga0070713_1001532833 | 44 |
| 4 | 3300005614 | Ga0068856_102366972 | Ga0068856_1023669721 | 44 |
| 5 | 3300005718 | Ga0068866_10009163 | Ga0068866_100091635 | 44 |
| 6 | 3300005719 | Ga0068861_102540589 | Ga0068861_1025405893 | 44 |
| 7 | 3300005981 | Ga0081538_10006570 | Ga0081538_1000657010 | 44 |
| 8 | 3300005981 | Ga0081538_10024187 | Ga0081538_100241874 | 44 |
| 9 | 3300006028 | Ga0070717_11530347 | Ga0070717_115303471 | 44 |
| 10 | 3300006175 | Ga0070712_101035728 | Ga0070712_1010357282 | 44 |
| 11 | 3300006358 | Ga0068871_101045746 | Ga0068871_1010457462 | 44 |
| 12 | 3300006852 | Ga0075433_10002298 | Ga0075433_1000229812 | 44 |
| 13 | 3300009148 | Ga0105243_10046255 | Ga0105243_100462554 | 44 |
| 14 | 3300009176 | Ga0105242_10014779 | Ga0105242_100147797 | 44 |
| 15 | 3300010375 | Ga0105239_11314893 | Ga0105239_113148932 | 44 |
| 16 | 3300010375 | Ga0105239_12796628 | Ga0105239_127966282 | 44 |
| 17 | 3300013307 | Ga0157372_13003762 | Ga0157372_130037622 | 44 |
| 18 | 3300025898 | Ga0207692_10038996 | Ga0207692_100389963 | 44 |
| 19 | 3300025899 | Ga0207642_10000038 | Ga0207642_1000003845 | 44 |
| 20 | 3300025928 | Ga0207700_10027685 | Ga0207700_100276853 | 44 |
| 21 | 3300025929 | Ga0207664_11048417 | Ga0207664_110484172 | 44 |
| 22 | 3300025934 | Ga0207686_10013202 | Ga0207686_100132024 | 44 |
| 23 | 3300025935 | Ga0207709_10016389 | Ga0207709_100163894 | 44 |
| 24 | 3300025937 | Ga0207669_10000010 | Ga0207669_1000001021 | 44 |
| 25 | 3300025939 | Ga0207665_10172452 | Ga0207665_101724522 | 44 |
| 26 | 3300026118 | Ga0207675_102041751 | Ga0207675_1020417512 | 44 |
| 27 | 3300028558 | Ga0265326_10023603 | Ga0265326_100236033 | 44 |
| 28 | 3300028653 | Ga0265323_10186187 | Ga0265323_101861872 | 44 |
| 29 | 3300028654 | Ga0265322_10083393 | Ga0265322_100833932 | 44 |
| 30 | 3300028666 | Ga0265336_10117599 | Ga0265336_101175992 | 44 |
| 31 | 3300028800 | Ga0265338_10077069 | Ga0265338_100770691 | 44 |
| 32 | 3300029957 | Ga0265324_10058394 | Ga0265324_100583942 | 44 |
| 33 | 3300031235 | Ga0265330_10292371 | Ga0265330_102923712 | 44 |
| 34 | 3300031241 | Ga0265325_10164170 | Ga0265325_101641703 | 44 |
| 35 | 3300031250 | Ga0265331_10102251 | Ga0265331_101022513 | 44 |
| 36 | 3300031251 | Ga0265327_10014430 | Ga0265327_100144305 | 44 |
| 37 | 3300031712 | Ga0265342_10226511 | Ga0265342_102265112 | 44 |
| 38 | 3300031852 | Ga0307410_11143737 | Ga0307410_111437372 | 44 |
| 39 | 3300032002 | Ga0307416_101203106 | Ga0307416_1012031063 | 44 |
| 40 | 3300041512 | Ga0451853_3742564 | Ga0451853_3742564_207_341 | 44 |
| 41 | 3300044901 | Ga0466960_0424848 | Ga0466960_0424848_288_422 | 44 |
| 42 | 3300045976 | Ga0466967_0140931 | Ga0466967_0140931_640_774 | 44 |
| 43 | 3300045976 | Ga0466967_0180824 | Ga0466967_0180824_927_1061 | 44 |
| 44 | 3300045976 | Ga0466967_1026799 | Ga0466967_1026799_519_653 | 44 |
| 45 | 3300045976 | Ga0466967_1264146 | Ga0466967_1264146_201_335 | 44 |
| 46 | 3300046463 | Ga0495653_0003139 | Ga0495653_0003139_5539_5673 | 44 |
| 47 | 3300046511 | Ga0495608_0269652 | Ga0495608_0269652_18_152 | 44 |
| 48 | 3300046514 | Ga0495618_0000077 | Ga0495618_0000077_11369_11503 | 44 |
| 49 | 3300046517 | Ga0495630_0003770 | Ga0495630_0003770_6287_6421 | 44 |
| 50 | 3300046526 | Ga0495666_0511923 | Ga0495666_0511923_124_258 | 44 |
| 51 | 3300046533 | Ga0495640_0427378 | Ga0495640_0427378_38_172 | 44 |
| 52 | 3300046535 | Ga0495586_0539034 | Ga0495586_0539034_31_165 | 44 |
| 53 | 3300046536 | Ga0495587_0021968 | Ga0495587_0021968_2449_2583 | 44 |
| 54 | 3300046543 | Ga0495645_0000050 | Ga0495645_0000050_10683_10817 | 44 |
| 55 | 3300046543 | Ga0495645_0001809 | Ga0495645_0001809_268_402 | 44 |
| 56 | 3300046642 | Ga0495634_0300642 | Ga0495634_0300642_537_671 | 44 |
| 57 | 3300046675 | Ga0495657_0000011 | Ga0495657_0000011_132045_132179 | 44 |
| 58 | 3300046680 | Ga0495646_0448537 | Ga0495646_0448537_455_589 | 44 |
| 59 | 3300047320 | Ga0495672_0236763 | Ga0495672_0236763_391_528 | 44 |
| 60 | 3300047322 | Ga0495680_0110254 | Ga0495680_0110254_865_999 | 44 |
| 61 | 3300047322 | Ga0495680_0262957 | Ga0495680_0262957_44_178 | 44 |
| 62 | 3300047471 | Ga0495684_0040677 | Ga0495684_0040677_436_570 | 44 |
| 63 | 3300048905 | Ga0496102_1382053 | Ga0496102_1382053_273_407 | 44 |
| 64 | 3300048917 | Ga0496114_0278522 | Ga0496114_0278522_1118_1252 | 44 |
| 65 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_46269_46403 | 44 |
| 66 | 3300049578 | Ga0501042_0328722 | Ga0501042_0328722_381_518 | 44 |
| 67 | 3300049743 | Ga0501081_0121802 | Ga0501081_0121802_1501_1635 | 44 |
| 68 | 3300049743 | Ga0501081_0703125 | Ga0501081_0703125_571_705 | 44 |
| 69 | 3300050515 | nmdc:mga0a205_352_c1 | nmdc:mga0a205_352_c1_29234_29368 | 44 |
| 70 | 3300053077 | Ga0495601_0001623 | Ga0495601_0001623_10507_10641 | 44 |
| 71 | 3300053078 | Ga0495612_0000076 | Ga0495612_0000076_33066_33200 | 44 |
| 72 | 3300053078 | Ga0495612_0242074 | Ga0495612_0242074_418_552 | 44 |
| 73 | 3300053085 | Ga0495619_0000119 | Ga0495619_0000119_34371_34505 | 44 |
| 74 | 3300053085 | Ga0495619_0317725 | Ga0495619_0317725_508_642 | 44 |
| 75 | 3300005337 | Ga0070682_100099406 | Ga0070682_1000994063 | 45 |
| 76 | 3300005337 | Ga0070682_100622231 | Ga0070682_1006222312 | 45 |
| 77 | 3300005338 | Ga0068868_100528653 | Ga0068868_1005286532 | 45 |
| 78 | 3300005340 | Ga0070689_100270007 | Ga0070689_1002700073 | 45 |
| 79 | 3300005341 | Ga0070691_10160388 | Ga0070691_101603883 | 45 |
| 80 | 3300005343 | Ga0070687_100005363 | Ga0070687_1000053634 | 45 |
| 81 | 3300005344 | Ga0070661_100289889 | Ga0070661_1002898892 | 45 |
| 82 | 3300005345 | Ga0070692_10525890 | Ga0070692_105258902 | 45 |
| 83 | 3300005347 | Ga0070668_102179514 | Ga0070668_1021795142 | 45 |
| 84 | 3300005354 | Ga0070675_102144815 | Ga0070675_1021448152 | 45 |
| 85 | 3300005355 | Ga0070671_101112681 | Ga0070671_1011126812 | 45 |
| 86 | 3300005356 | Ga0070674_100364935 | Ga0070674_1003649351 | 45 |
| 87 | 3300005435 | Ga0070714_100428746 | Ga0070714_1004287463 | 45 |
| 88 | 3300005435 | Ga0070714_100833355 | Ga0070714_1008333552 | 45 |
| 89 | 3300005436 | Ga0070713_100083928 | Ga0070713_1000839284 | 45 |
| 90 | 3300005441 | Ga0070700_100078247 | Ga0070700_1000782472 | 45 |
| 91 | 3300005441 | Ga0070700_101516454 | Ga0070700_1015164542 | 45 |
| 92 | 3300005455 | Ga0070663_100582865 | Ga0070663_1005828652 | 45 |
| 93 | 3300005456 | Ga0070678_100374115 | Ga0070678_1003741152 | 45 |
| 94 | 3300005457 | Ga0070662_101036694 | Ga0070662_1010366942 | 45 |
| 95 | 3300005459 | Ga0068867_100084922 | Ga0068867_1000849225 | 45 |
| 96 | 3300005459 | Ga0068867_101600570 | Ga0068867_1016005702 | 45 |
| 97 | 3300005539 | Ga0068853_102008545 | Ga0068853_1020085452 | 45 |
| 98 | 3300005544 | Ga0070686_100990941 | Ga0070686_1009909411 | 45 |
| 99 | 3300005546 | Ga0070696_101962897 | Ga0070696_1019628972 | 45 |
| 100 | 3300005547 | Ga0070693_100535484 | Ga0070693_1005354842 | 45 |
| 101 | 3300005549 | Ga0070704_100465947 | Ga0070704_1004659472 | 45 |
| 102 | 3300005563 | Ga0068855_100595179 | Ga0068855_1005951793 | 45 |
| 103 | 3300005577 | Ga0068857_100367699 | Ga0068857_1003676992 | 45 |
| 104 | 3300005578 | Ga0068854_100524881 | Ga0068854_1005248812 | 45 |
| 105 | 3300005614 | Ga0068856_101280436 | Ga0068856_1012804361 | 45 |
| 106 | 3300005615 | Ga0070702_100000689 | Ga0070702_1000006898 | 45 |
| 107 | 3300005616 | Ga0068852_100172480 | Ga0068852_1001724802 | 45 |
| 108 | 3300005617 | Ga0068859_100655242 | Ga0068859_1006552422 | 45 |
| 109 | 3300005618 | Ga0068864_100450904 | Ga0068864_1004509043 | 45 |
| 110 | 3300005718 | Ga0068866_10158150 | Ga0068866_101581502 | 45 |
| 111 | 3300005718 | Ga0068866_10312917 | Ga0068866_103129172 | 45 |
| 112 | 3300005719 | Ga0068861_100054641 | Ga0068861_1000546413 | 45 |
| 113 | 3300005840 | Ga0068870_10039683 | Ga0068870_100396832 | 45 |
| 114 | 3300006028 | Ga0070717_10006646 | Ga0070717_100066461 | 45 |
| 115 | 3300006880 | Ga0075429_100106286 | Ga0075429_1001062863 | 45 |
| 116 | 3300006881 | Ga0068865_100852660 | Ga0068865_1008526602 | 45 |
| 117 | 3300006914 | Ga0075436_100235358 | Ga0075436_1002353581 | 45 |
| 118 | 3300006931 | Ga0097620_100655249 | Ga0097620_1006552492 | 45 |
| 119 | 3300007076 | Ga0075435_101855730 | Ga0075435_1018557302 | 45 |
| 120 | 3300009093 | Ga0105240_10652608 | Ga0105240_106526082 | 45 |
| 121 | 3300009094 | Ga0111539_10833148 | Ga0111539_108331482 | 45 |
| 122 | 3300009094 | Ga0111539_11440882 | Ga0111539_114408822 | 45 |
| 123 | 3300009098 | Ga0105245_10353310 | Ga0105245_103533102 | 45 |
| 124 | 3300009098 | Ga0105245_12403303 | Ga0105245_124033032 | 45 |
| 125 | 3300009147 | Ga0114129_12198678 | Ga0114129_121986782 | 45 |
| 126 | 3300009147 | Ga0114129_12964871 | Ga0114129_129648712 | 45 |
| 127 | 3300009148 | Ga0105243_10108607 | Ga0105243_101086073 | 45 |
| 128 | 3300009148 | Ga0105243_11595895 | Ga0105243_115958952 | 45 |
| 129 | 3300009174 | Ga0105241_10792312 | Ga0105241_107923122 | 45 |
| 130 | 3300009176 | Ga0105242_12324781 | Ga0105242_123247812 | 45 |
| 131 | 3300009177 | Ga0105248_11586202 | Ga0105248_115862022 | 45 |
| 132 | 3300009551 | Ga0105238_10968046 | Ga0105238_109680462 | 45 |
| 133 | 3300009553 | Ga0105249_10371868 | Ga0105249_103718683 | 45 |
| 134 | 3300010375 | Ga0105239_10432380 | Ga0105239_104323803 | 45 |
| 135 | 3300011119 | Ga0105246_10992856 | Ga0105246_109928562 | 45 |
| 136 | 3300013296 | Ga0157374_11180175 | Ga0157374_111801752 | 45 |
| 137 | 3300013306 | Ga0163162_10218868 | Ga0163162_102188683 | 45 |
| 138 | 3300013307 | Ga0157372_10291124 | Ga0157372_102911243 | 45 |
| 139 | 3300013307 | Ga0157372_13350217 | Ga0157372_133502172 | 45 |
| 140 | 3300013308 | Ga0157375_10895996 | Ga0157375_108959963 | 45 |
| 141 | 3300014325 | Ga0163163_11286173 | Ga0163163_112861732 | 45 |
| 142 | 3300014497 | Ga0182008_10071873 | Ga0182008_100718732 | 45 |
| 143 | 3300014745 | Ga0157377_10136393 | Ga0157377_101363933 | 45 |
| 144 | 3300020070 | Ga0206356_11681944 | Ga0206356_116819442 | 45 |
| 145 | 3300020080 | Ga0206350_11661502 | Ga0206350_116615021 | 45 |
| 146 | 3300020081 | Ga0206354_10154821 | Ga0206354_101548212 | 45 |
| 147 | 3300020081 | Ga0206354_10420497 | Ga0206354_104204973 | 45 |
| 148 | 3300020082 | Ga0206353_10137514 | Ga0206353_101375143 | 45 |
| 149 | 3300020082 | Ga0206353_11401555 | Ga0206353_114015552 | 45 |
| 150 | 3300021384 | Ga0213876_10019184 | Ga0213876_100191845 | 45 |
| 151 | 3300021384 | Ga0213876_10051432 | Ga0213876_100514323 | 45 |
| 152 | 3300021384 | Ga0213876_10098734 | Ga0213876_100987342 | 45 |
| 153 | 3300021384 | Ga0213876_10597218 | Ga0213876_105972183 | 45 |
| 154 | 3300021388 | Ga0213875_10009419 | Ga0213875_100094193 | 45 |
| 155 | 3300021388 | Ga0213875_10011176 | Ga0213875_100111764 | 45 |
| 156 | 3300021388 | Ga0213875_10073704 | Ga0213875_100737043 | 45 |
| 157 | 3300021388 | Ga0213875_10085100 | Ga0213875_100851003 | 45 |
| 158 | 3300021388 | Ga0213875_10173422 | Ga0213875_101734222 | 45 |
| 159 | 3300021388 | Ga0213875_10214026 | Ga0213875_102140262 | 45 |
| 160 | 3300021388 | Ga0213875_10299620 | Ga0213875_102996202 | 45 |
| 161 | 3300021388 | Ga0213875_10407570 | Ga0213875_104075702 | 45 |
| 162 | 3300021388 | Ga0213875_10557672 | Ga0213875_105576721 | 45 |
| 163 | 3300021388 | Ga0213875_10570645 | Ga0213875_105706452 | 45 |
| 164 | 3300022467 | Ga0224712_10116191 | Ga0224712_101161914 | 45 |
| 165 | 3300025899 | Ga0207642_10256672 | Ga0207642_102566722 | 45 |
| 166 | 3300025901 | Ga0207688_10050264 | Ga0207688_100502642 | 45 |
| 167 | 3300025908 | Ga0207643_10146769 | Ga0207643_101467693 | 45 |
| 168 | 3300025908 | Ga0207643_10415234 | Ga0207643_104152342 | 45 |
| 169 | 3300025912 | Ga0207707_10582119 | Ga0207707_105821194 | 45 |
| 170 | 3300025913 | Ga0207695_11334173 | Ga0207695_113341732 | 45 |
| 171 | 3300025913 | Ga0207695_11484045 | Ga0207695_114840452 | 45 |
| 172 | 3300025916 | Ga0207663_11227145 | Ga0207663_112271452 | 45 |
| 173 | 3300025918 | Ga0207662_10011742 | Ga0207662_100117427 | 45 |
| 174 | 3300025921 | Ga0207652_10644900 | Ga0207652_106449001 | 45 |
| 175 | 3300025924 | Ga0207694_10634554 | Ga0207694_106345542 | 45 |
| 176 | 3300025926 | Ga0207659_11454150 | Ga0207659_114541502 | 45 |
| 177 | 3300025927 | Ga0207687_10295611 | Ga0207687_102956113 | 45 |
| 178 | 3300025929 | Ga0207664_10013009 | Ga0207664_100130092 | 45 |
| 179 | 3300025929 | Ga0207664_10810548 | Ga0207664_108105482 | 45 |
| 180 | 3300025934 | Ga0207686_10657024 | Ga0207686_106570242 | 45 |
| 181 | 3300025935 | Ga0207709_10035456 | Ga0207709_100354563 | 45 |
| 182 | 3300025937 | Ga0207669_11143574 | Ga0207669_111435742 | 45 |
| 183 | 3300025938 | Ga0207704_10137103 | Ga0207704_101371035 | 45 |
| 184 | 3300025941 | Ga0207711_10973633 | Ga0207711_109736332 | 45 |
| 185 | 3300025942 | Ga0207689_10346365 | Ga0207689_103463652 | 45 |
| 186 | 3300025944 | Ga0207661_10965651 | Ga0207661_109656512 | 45 |
| 187 | 3300025945 | Ga0207679_10637145 | Ga0207679_106371453 | 45 |
| 188 | 3300025972 | Ga0207668_11419331 | Ga0207668_114193312 | 45 |
| 189 | 3300025981 | Ga0207640_10998279 | Ga0207640_109982792 | 45 |
| 190 | 3300026023 | Ga0207677_10548521 | Ga0207677_105485212 | 45 |
| 191 | 3300026035 | Ga0207703_10063809 | Ga0207703_100638092 | 45 |
| 192 | 3300026067 | Ga0207678_10109058 | Ga0207678_101090585 | 45 |
| 193 | 3300026075 | Ga0207708_10008594 | Ga0207708_100085946 | 45 |
| 194 | 3300026075 | Ga0207708_10564672 | Ga0207708_105646722 | 45 |
| 195 | 3300026078 | Ga0207702_10356795 | Ga0207702_103567953 | 45 |
| 196 | 3300026088 | Ga0207641_12553418 | Ga0207641_125534182 | 45 |
| 197 | 3300026089 | Ga0207648_10525105 | Ga0207648_105251052 | 45 |
| 198 | 3300026095 | Ga0207676_10495760 | Ga0207676_104957602 | 45 |
| 199 | 3300026116 | Ga0207674_10069309 | Ga0207674_100693097 | 45 |
| 200 | 3300026118 | Ga0207675_100034236 | Ga0207675_1000342364 | 45 |
| 201 | 3300026142 | Ga0207698_10239135 | Ga0207698_102391353 | 45 |
| 202 | 3300028380 | Ga0268265_10317226 | Ga0268265_103172262 | 45 |
| 203 | 3300028381 | Ga0268264_11440621 | Ga0268264_114406212 | 45 |
| 204 | 3300031238 | Ga0265332_10356164 | Ga0265332_103561641 | 45 |
| 205 | 3300031240 | Ga0265320_10018068 | Ga0265320_100180686 | 45 |
| 206 | 3300031548 | Ga0307408_100996342 | Ga0307408_1009963422 | 45 |
| 207 | 3300031731 | Ga0307405_12048016 | Ga0307405_120480161 | 45 |
| 208 | 3300031824 | Ga0307413_10174734 | Ga0307413_101747343 | 45 |
| 209 | 3300031824 | Ga0307413_10808228 | Ga0307413_108082282 | 45 |
| 210 | 3300031852 | Ga0307410_10126944 | Ga0307410_101269444 | 45 |
| 211 | 3300031852 | Ga0307410_12034751 | Ga0307410_120347512 | 45 |
| 212 | 3300031901 | Ga0307406_10698950 | Ga0307406_106989502 | 45 |
| 213 | 3300031995 | Ga0307409_100094619 | Ga0307409_1000946194 | 45 |
| 214 | 3300031995 | Ga0307409_101381197 | Ga0307409_1013811972 | 45 |
| 215 | 3300031995 | Ga0307409_102240042 | Ga0307409_1022400422 | 45 |
| 216 | 3300032002 | Ga0307416_103490034 | Ga0307416_1034900342 | 45 |
| 217 | 3300032004 | Ga0307414_10311225 | Ga0307414_103112252 | 45 |
| 218 | 3300032004 | Ga0307414_12119301 | Ga0307414_121193012 | 45 |
| 219 | 3300032126 | Ga0307415_100056902 | Ga0307415_1000569023 | 45 |
| 220 | 3300032126 | Ga0307415_102525197 | Ga0307415_1025251972 | 45 |
| 221 | 3300036401 | Ga0373937_1378020 | Ga0373937_1378020_355_495 | 45 |
| 222 | 3300037853 | Ga0436364_0066028 | Ga0436364_0066028_923_1060 | 45 |
| 223 | 3300037853 | Ga0436364_0079058 | Ga0436364_0079058_402_539 | 45 |
| 224 | 3300037853 | Ga0436364_0256505 | Ga0436364_0256505_3852_3989 | 45 |
| 225 | 3300037853 | Ga0436364_0337952 | Ga0436364_0337952_1095_1232 | 45 |
| 226 | 3300037853 | Ga0436364_0549585 | Ga0436364_0549585_34_171 | 45 |
| 227 | 3300037853 | Ga0436364_1110030 | Ga0436364_1110030_11210_11347 | 45 |
| 228 | 3300037853 | Ga0436364_1326262 | Ga0436364_1326262_3387_3524 | 45 |
| 229 | 3300037853 | Ga0436364_1541019 | Ga0436364_1541019_201_338 | 45 |
| 230 | 3300037853 | Ga0436364_1564718 | Ga0436364_1564718_1815_1952 | 45 |
| 231 | 3300039437 | Ga0436365_0126994 | Ga0436365_0126994_459_596 | 45 |
| 232 | 3300039437 | Ga0436365_0320671 | Ga0436365_0320671_8752_8889 | 45 |
| 233 | 3300039437 | Ga0436365_0413376 | Ga0436365_0413376_1125_1262 | 45 |
| 234 | 3300039437 | Ga0436365_0490499 | Ga0436365_0490499_615_752 | 45 |
| 235 | 3300039437 | Ga0436365_0681915 | Ga0436365_0681915_3953_4090 | 45 |
| 236 | 3300039437 | Ga0436365_1445890 | Ga0436365_1445890_451_588 | 45 |
| 237 | 3300039437 | Ga0436365_1461348 | Ga0436365_1461348_1080_1217 | 45 |
| 238 | 3300039437 | Ga0436365_1580551 | Ga0436365_1580551_3828_3965 | 45 |
| 239 | 3300039437 | Ga0436365_1637070 | Ga0436365_1637070_2036_2173 | 45 |
| 240 | 3300039450 | Ga0436363_0127754 | Ga0436363_0127754_1016_1153 | 45 |
| 241 | 3300039450 | Ga0436363_0365240 | Ga0436363_0365240_392_529 | 45 |
| 242 | 3300039450 | Ga0436363_0865842 | Ga0436363_0865842_982_1119 | 45 |
| 243 | 3300039450 | Ga0436363_1615119 | Ga0436363_1615119_129_266 | 45 |
| 244 | 3300039450 | Ga0436363_1660580 | Ga0436363_1660580_1602_1739 | 45 |
| 245 | 3300039453 | Ga0436362_0033283 | Ga0436362_0033283_1168_1305 | 45 |
| 246 | 3300039453 | Ga0436362_0121361 | Ga0436362_0121361_620_757 | 45 |
| 247 | 3300039453 | Ga0436362_1079981 | Ga0436362_1079981_478_615 | 45 |
| 248 | 3300039453 | Ga0436362_1134516 | Ga0436362_1134516_279_416 | 45 |
| 249 | 3300041441 | Ga0451787_446334 | Ga0451787_446334_293_430 | 45 |
| 250 | 3300041496 | Ga0451839_0267224 | Ga0451839_0267224_207_344 | 45 |
| 251 | 3300044656 | Ga0466969_0364954 | Ga0466969_0364954_447_584 | 45 |
| 252 | 3300044683 | Ga0466965_0152362 | Ga0466965_0152362_381_518 | 45 |
| 253 | 3300044683 | Ga0466965_0368635 | Ga0466965_0368635_45_182 | 45 |
| 254 | 3300044684 | Ga0466966_0052340 | Ga0466966_0052340_536_673 | 45 |
| 255 | 3300044684 | Ga0466966_0067776 | Ga0466966_0067776_661_798 | 45 |
| 256 | 3300044684 | Ga0466966_0421392 | Ga0466966_0421392_120_257 | 45 |
| 257 | 3300044684 | Ga0466966_0422030 | Ga0466966_0422030_78_215 | 45 |
| 258 | 3300044684 | Ga0466966_1014228 | Ga0466966_1014228_79_216 | 45 |
| 259 | 3300044693 | Ga0466961_0058579 | Ga0466961_0058579_773_910 | 45 |
| 260 | 3300044693 | Ga0466961_0949118 | Ga0466961_0949118_253_390 | 45 |
| 261 | 3300044694 | Ga0466963_0005515 | Ga0466963_0005515_330_467 | 45 |
| 262 | 3300044694 | Ga0466963_0032477 | Ga0466963_0032477_186_323 | 45 |
| 263 | 3300044694 | Ga0466963_0070309 | Ga0466963_0070309_1156_1293 | 45 |
| 264 | 3300044694 | Ga0466963_0290208 | Ga0466963_0290208_966_1103 | 45 |
| 265 | 3300044694 | Ga0466963_0524079 | Ga0466963_0524079_641_778 | 45 |
| 266 | 3300044694 | Ga0466963_0601962 | Ga0466963_0601962_450_587 | 45 |
| 267 | 3300044694 | Ga0466963_0616340 | Ga0466963_0616340_43_180 | 45 |
| 268 | 3300044706 | Ga0466964_0035803 | Ga0466964_0035803_951_1088 | 45 |
| 269 | 3300044719 | Ga0466971_0011620 | Ga0466971_0011620_519_656 | 45 |
| 270 | 3300044719 | Ga0466971_0030442 | Ga0466971_0030442_41_178 | 45 |
| 271 | 3300044719 | Ga0466971_0088451 | Ga0466971_0088451_59_196 | 45 |
| 272 | 3300044719 | Ga0466971_0147005 | Ga0466971_0147005_56_193 | 45 |
| 273 | 3300044719 | Ga0466971_0208442 | Ga0466971_0208442_205_342 | 45 |
| 274 | 3300044765 | Ga0466970_0022065 | Ga0466970_0022065_2824_2961 | 45 |
| 275 | 3300044765 | Ga0466970_0060652 | Ga0466970_0060652_343_480 | 45 |
| 276 | 3300044765 | Ga0466970_0248730 | Ga0466970_0248730_566_703 | 45 |
| 277 | 3300044765 | Ga0466970_0734634 | Ga0466970_0734634_312_449 | 45 |
| 278 | 3300044842 | Ga0466957_0183649 | Ga0466957_0183649_1194_1331 | 45 |
| 279 | 3300044842 | Ga0466957_0184629 | Ga0466957_0184629_910_1047 | 45 |
| 280 | 3300044842 | Ga0466957_0229222 | Ga0466957_0229222_440_577 | 45 |
| 281 | 3300045049 | Ga0466959_0017058 | Ga0466959_0017058_1001_1138 | 45 |
| 282 | 3300045049 | Ga0466959_0159288 | Ga0466959_0159288_244_381 | 45 |
| 283 | 3300045049 | Ga0466959_0231441 | Ga0466959_0231441_139_276 | 45 |
| 284 | 3300045049 | Ga0466959_0651910 | Ga0466959_0651910_168_305 | 45 |
| 285 | 3300045049 | Ga0466959_0657568 | Ga0466959_0657568_113_250 | 45 |
| 286 | 3300045049 | Ga0466959_0716066 | Ga0466959_0716066_403_540 | 45 |
| 287 | 3300045836 | Ga0466958_0005993 | Ga0466958_0005993_3826_3963 | 45 |
| 288 | 3300045836 | Ga0466958_0058113 | Ga0466958_0058113_661_798 | 45 |
| 289 | 3300045836 | Ga0466958_0065166 | Ga0466958_0065166_186_323 | 45 |
| 290 | 3300045836 | Ga0466958_0138529 | Ga0466958_0138529_1305_1457 | 45 |
| 291 | 3300045836 | Ga0466958_0174031 | Ga0466958_0174031_647_784 | 45 |
| 292 | 3300045976 | Ga0466967_0001141 | Ga0466967_0001141_175_312 | 45 |
| 293 | 3300045976 | Ga0466967_0025580 | Ga0466967_0025580_2143_2280 | 45 |
| 294 | 3300045976 | Ga0466967_0059392 | Ga0466967_0059392_124_261 | 45 |
| 295 | 3300045976 | Ga0466967_0150694 | Ga0466967_0150694_2005_2142 | 45 |
| 296 | 3300045976 | Ga0466967_0163800 | Ga0466967_0163800_1747_1884 | 45 |
| 297 | 3300045976 | Ga0466967_0310767 | Ga0466967_0310767_270_407 | 45 |
| 298 | 3300045976 | Ga0466967_0692015 | Ga0466967_0692015_10_147 | 45 |
| 299 | 3300045976 | Ga0466967_1081575 | Ga0466967_1081575_368_505 | 45 |
| 300 | 3300045976 | Ga0466967_1194413 | Ga0466967_1194413_173_310 | 45 |
| 301 | 3300045976 | Ga0466967_1586484 | Ga0466967_1586484_30_179 | 45 |
| 302 | 3300045976 | Ga0466967_1850955 | Ga0466967_1850955_214_351 | 45 |
| 303 | 3300045976 | Ga0466967_1912755 | Ga0466967_1912755_186_323 | 45 |
| 304 | 3300045976 | Ga0466967_2506663 | Ga0466967_2506663_242_379 | 45 |
| 305 | 3300046477 | Ga0495664_0222435 | Ga0495664_0222435_283_429 | 45 |
| 306 | 3300046500 | Ga0495596_0395032 | Ga0495596_0395032_85_222 | 45 |
| 307 | 3300046516 | Ga0495628_0729374 | Ga0495628_0729374_344_481 | 45 |
| 308 | 3300046533 | Ga0495640_0733151 | Ga0495640_0733151_399_536 | 45 |
| 309 | 3300046616 | Ga0495668_0444982 | Ga0495668_0444982_544_681 | 45 |
| 310 | 3300047319 | Ga0495674_0224962 | Ga0495674_0224962_1332_1478 | 45 |
| 311 | 3300048903 | Ga0496100_0000226 | Ga0496100_0000226_11469_11618 | 45 |
| 312 | 3300048904 | Ga0496101_0000492 | Ga0496101_0000492_3979_4128 | 45 |
| 313 | 3300048905 | Ga0496102_0221639 | Ga0496102_0221639_279_416 | 45 |
| 314 | 3300048909 | Ga0496106_0035731 | Ga0496106_0035731_914_1051 | 45 |
| 315 | 3300048910 | Ga0496107_1333656 | Ga0496107_1333656_22_159 | 45 |
| 316 | 3300048911 | Ga0496108_0233472 | Ga0496108_0233472_585_722 | 45 |
| 317 | 3300048911 | Ga0496108_0636401 | Ga0496108_0636401_603_740 | 45 |
| 318 | 3300048912 | Ga0496109_0002320 | Ga0496109_0002320_2852_3001 | 45 |
| 319 | 3300048912 | Ga0496109_0136090 | Ga0496109_0136090_1431_1568 | 45 |
| 320 | 3300048913 | Ga0496110_0218354 | Ga0496110_0218354_50_187 | 45 |
| 321 | 3300048913 | Ga0496110_0565107 | Ga0496110_0565107_521_670 | 45 |
| 322 | 3300048913 | Ga0496110_1022254 | Ga0496110_1022254_454_591 | 45 |
| 323 | 3300048914 | Ga0496111_0046310 | Ga0496111_0046310_1149_1298 | 45 |
| 324 | 3300048914 | Ga0496111_0303137 | Ga0496111_0303137_267_404 | 45 |
| 325 | 3300049576 | Ga0501040_0494192 | Ga0501040_0494192_716_853 | 45 |
| 326 | 3300049583 | Ga0501067_0491901 | Ga0501067_0491901_285_422 | 45 |
| 327 | 3300049741 | Ga0501079_1558690 | Ga0501079_1558690_323_460 | 45 |
| 328 | 3300050507 | nmdc:mga05p37_1911004_c1 | nmdc:mga05p37_1911004_c1_154_291 | 45 |
| 329 | 3300050508 | nmdc:mga09592_98323_c1 | nmdc:mga09592_98323_c1_1001_1150 | 45 |
| 330 | 3300050510 | nmdc:mga06r32_1410263_c1 | nmdc:mga06r32_1410263_c1_110_247 | 45 |
| 331 | 3300050511 | nmdc:mga08y16_1377212_c1 | nmdc:mga08y16_1377212_c1_484_621 | 45 |
| 332 | 3300050515 | nmdc:mga0a205_1389911_c1 | nmdc:mga0a205_1389911_c1_46_195 | 45 |
| 333 | 3300053083 | Ga0495655_0164238 | Ga0495655_0164238_247_384 | 45 |
| 334 | 3300053085 | Ga0495619_0136456 | Ga0495619_0136456_697_837 | 45 |
| 335 | 3300054114 | Ga0501084_0488267 | Ga0501084_0488267_642_779 | 45 |
| 336 | 3300061719 | Ga0466962_0051266 | Ga0466962_0051266_1136_1273 | 45 |
| 337 | 3300061719 | Ga0466962_0083275 | Ga0466962_0083275_340_477 | 45 |
| 338 | 3300061719 | Ga0466962_0119449 | Ga0466962_0119449_1011_1148 | 45 |
| 339 | 3300061719 | Ga0466962_0317793 | Ga0466962_0317793_545_682 | 45 |
| 340 | 3300061719 | Ga0466962_0656051 | Ga0466962_0656051_21_170 | 45 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bzl-assembly1.cif.gz_G | human 20s proteasome in complex with peptide activator peptide blm42 | 0.9393 | 23 | 44 |
| 5ley-assembly1.cif.gz_U | human 20s proteasome complex with oprozomib at 1.9 angstrom | 0.9369 | 23 | 44 |
| 6r70-assembly1.cif.gz_U | endogeneous native human 20s proteasome | 0.9341 | 23 | 44 |
| 6muw-assembly1.cif.gz_G | the structure of the plasmodium falciparum 20s proteasome. | 0.9338 | 21 | 44 |
| 8bzl-assembly1.cif.gz_U | human 20s proteasome in complex with peptide activator peptide blm42 | 0.9332 | 23 | 44 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LJI3_116_648_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.9644 | 28 | 42 | 2.60.40.150 |
| 4hc9A01 | Alpha Beta;2-Layer Sandwich;Erythroid Transcription Factor GATA-1; Chain A;Erythroid Transcription Factor GATA-1, subunit A | 0.9601 | 30 | 45 | 3.30.50.10 |
| af_O77396_1_252_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9286 | 25 | 44 | 3.60.20.10 |
| af_Q8IAR3_1_260_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9247 | 22 | 44 | 3.60.20.10 |
| af_Q54M79_16_215_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.9213 | 26 | 43 | 3.30.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Z2H615-F1-model_v4 | Uncharacterized protein | 0.6652 | 9 | 45 |
|
| AF-A0A4Z2H615-F1-model_v4 | Uncharacterized protein | 0.5489 | 9 | 45 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar