F414211

General Info

Members Datasets Scaffolds Average Seq Length
340 217 680 213

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100616051|Ga0068869_1006160511
Length 227
Sequence MPSLKNEVIYPDWPVTDASAFVTTAPFGDAASDEGRAKLCSLVPGEPRWMHQVHGVRVIDADNTGTLVQADAAVARRPGSVCVVKVADCMPVFFAAQGVVGVAHAGWRGLCGGVLEATVDALQAAPGAVQAWLGPAIGRRVYEVGDEVRAAFAGHESAFTPTRPGHWLLDLYAVARARLEAKGVRRIHGGGFCTYSDAERFFSYRRDKTAARMAALIYRPSVESRPP

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.71
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100616051 3300005334 Bacteria 918
2 Ga0065707_10123270 3300005295 Bacteria 2069
3 Ga0070676_10035696 3300005328 Bacteria 2861
4 Ga0070690_100004536 3300005330 Bacteria 7720
5 Ga0070690_100027114 3300005330 Bacteria 3540
6 Ga0070690_100407178 3300005330 Bacteria 1000
7 Ga0068869_100001616 3300005334 Bacteria 13395
8 Ga0068869_100054613 3300005334 Bacteria 2909
9 Ga0068869_100314804 3300005334 Bacteria 1268
10 Ga0070680_100020901 3300005336 Bacteria 5197
11 Ga0068868_100000209 3300005338 Bacteria 39624
12 Ga0070689_100000614 3300005340 Bacteria 21600
13 Ga0070689_100035012 3300005340 Bacteria 3834
14 Ga0070689_100050366 3300005340 Bacteria 3218
15 Ga0070691_10001291 3300005341 Bacteria 10621
16 Ga0070691_10023649 3300005341 Bacteria 2854
17 Ga0070687_100000190 3300005343 Bacteria 21399
18 Ga0070687_100129166 3300005343 Bacteria 1457
19 Ga0070692_10003658 3300005345 Bacteria 6287
20 Ga0070692_10062195 3300005345 Bacteria 1969
21 Ga0070668_100552922 3300005347 Bacteria 1002
22 Ga0070669_100003300 3300005353 Bacteria 11600
23 Ga0070675_100218972 3300005354 Bacteria 1657
24 Ga0070674_100122355 3300005356 Bacteria 1928
25 Ga0070674_100180159 3300005356 Bacteria 1618
26 Ga0070673_100708027 3300005364 Bacteria 925
27 Ga0070703_10022770 3300005406 Bacteria 1841
28 Ga0070701_10006881 3300005438 Bacteria 4812
29 Ga0070705_100000320 3300005440 Bacteria 28430
30 Ga0070705_100038261 3300005440 Bacteria 2713
31 Ga0070705_100385329 3300005440 Bacteria 1033
32 Ga0070700_100000571 3300005441 Bacteria 18444
33 Ga0070700_100000733 3300005441 Bacteria 16216
34 Ga0070700_100649807 3300005441 Unclassified 833
35 Ga0070694_100000802 3300005444 Bacteria 17651
36 Ga0070694_100039772 3300005444 Bacteria 3133
37 Ga0070694_100112975 3300005444 Bacteria 1937
38 Ga0070694_100310184 3300005444 Bacteria 1211
39 Ga0070694_100338323 3300005444 Bacteria 1163
40 Ga0070708_100326606 3300005445 Bacteria 1445
41 Ga0070678_100622897 3300005456 Bacteria 965
42 Ga0070681_10000172 3300005458 Bacteria 49288
43 Ga0070681_10306967 3300005458 Bacteria 1496
44 Ga0068867_100000417 3300005459 Bacteria 28383
45 Ga0068867_100003986 3300005459 Bacteria 10387
46 Ga0070699_100006683 3300005518 Bacteria 10030
47 Ga0070699_100035105 3300005518 Bacteria 4334
48 Ga0070679_100002529 3300005530 Bacteria 16578
49 Ga0070679_100071211 3300005530 Bacteria 3467
50 Ga0070697_100003503 3300005536 Bacteria 12063
51 Ga0068853_100045594 3300005539 Bacteria 3756
52 Ga0070686_100000825 3300005544 Bacteria 17899
53 Ga0070695_100000457 3300005545 Bacteria 21293
54 Ga0070695_100007243 3300005545 Bacteria 6575
55 Ga0070695_100128588 3300005545 Bacteria 1743
56 Ga0070696_100002371 3300005546 Bacteria 12455
57 Ga0070696_100004412 3300005546 Bacteria 9390
58 Ga0070696_100180435 3300005546 Bacteria 1566
59 Ga0070696_100239467 3300005546 Bacteria 1368
60 Ga0070693_100001007 3300005547 Bacteria 12571
61 Ga0070693_100168655 3300005547 Bacteria 1400
62 Ga0070704_100003235 3300005549 Bacteria 9308
63 Ga0070704_100433538 3300005549 Bacteria 1128
64 Ga0068855_100009634 3300005563 Bacteria 11654
65 Ga0068855_100333516 3300005563 Unclassified 1674
66 Ga0068854_100002076 3300005578 Bacteria 12287
67 Ga0068856_100003781 3300005614 Bacteria 15160
68 Ga0068856_100143560 3300005614 Bacteria 2395
69 Ga0070702_100000050 3300005615 Bacteria 32860
70 Ga0070702_100562160 3300005615 Bacteria 849
71 Ga0068852_100453995 3300005616 Bacteria 1269
72 Ga0068859_100000332 3300005617 Bacteria 47130
73 Ga0068864_100050916 3300005618 Bacteria 3566
74 Ga0068866_10000489 3300005718 Bacteria 18218
75 Ga0068861_100004686 3300005719 Bacteria 9191
76 Ga0068861_100008854 3300005719 Bacteria 6937
77 Ga0068870_10043184 3300005840 Bacteria 2350
78 Ga0068870_10078628 3300005840 Bacteria 1817
79 Ga0068858_100004862 3300005842 Bacteria 13176
80 Ga0068860_100011672 3300005843 Bacteria 8661
81 Ga0068862_100003390 3300005844 Bacteria 13741
82 Ga0068862_100017352 3300005844 Bacteria 5994
83 Ga0068862_100036184 3300005844 Bacteria 4184
84 Ga0068862_100219140 3300005844 Bacteria 1722
85 Ga0081539_10003343 3300005985 Bacteria 19933
86 Ga0097621_100000676 3300006237 Bacteria 23878
87 Ga0068871_100002899 3300006358 Bacteria 11767
88 Ga0068871_100667678 3300006358 Bacteria 950
89 Ga0075428_100173980 3300006844 Bacteria 2332
90 Ga0075428_101007113 3300006844 Bacteria 882
91 Ga0075430_100009032 3300006846 Bacteria 8424
92 Ga0075430_100186365 3300006846 Bacteria 1725
93 Ga0075431_100006336 3300006847 Bacteria 11754
94 Ga0075431_100051269 3300006847 Bacteria 4256
95 Ga0075431_100092120 3300006847 Bacteria 3128
96 Ga0075431_100780628 3300006847 Bacteria 929
97 Ga0075433_10001341 3300006852 Bacteria 18019
98 Ga0075433_10333137 3300006852 Bacteria 1342
99 Ga0075433_10601602 3300006852 Unclassified 965
100 Ga0075434_100000211 3300006871 Bacteria 39638
101 Ga0075434_100001149 3300006871 Bacteria 21878
102 Ga0075434_100006290 3300006871 Bacteria 10880
103 Ga0075434_101321854 3300006871 Bacteria 732
104 Ga0075429_100072952 3300006880 Bacteria 2989
105 Ga0075429_100324893 3300006880 Bacteria 1346
106 Ga0068865_100005124 3300006881 Bacteria 7932
107 Ga0068865_100021004 3300006881 Bacteria 4243
108 Ga0075436_100002524 3300006914 Bacteria 12594
109 Ga0075436_100002652 3300006914 Bacteria 12295
110 Ga0075436_100003794 3300006914 Bacteria 10365
111 Ga0075436_100014215 3300006914 Bacteria 5450
112 Ga0097620_100000332 3300006931 Bacteria 47130
113 Ga0075435_100000938 3300007076 Bacteria 18379
114 Ga0075435_100006459 3300007076 Bacteria 8292
115 Ga0075435_100189364 3300007076 Bacteria 1741
116 Ga0075435_100747389 3300007076 Bacteria 851
117 Ga0099794_10004828 3300007265 Bacteria 5350
118 Ga0111539_10022702 3300009094 Bacteria 7707
119 Ga0111539_10024409 3300009094 Bacteria 7420
120 Ga0111539_10070882 3300009094 Bacteria 4113
121 Ga0111539_10210458 3300009094 Bacteria 2266
122 Ga0111539_10765178 3300009094 Bacteria 1124
123 Ga0105245_10000115 3300009098 Bacteria 77632
124 Ga0114129_10400649 3300009147 Bacteria 1808
125 Ga0114129_10663823 3300009147 Bacteria 1344
126 Ga0105243_10001566 3300009148 Bacteria 19983
127 Ga0105243_10039112 3300009148 Bacteria 3696
128 Ga0105241_10067425 3300009174 Bacteria 2770
129 Ga0105242_10029486 3300009176 Bacteria 4377
130 Ga0105237_10436999 3300009545 Bacteria 1314
131 Ga0105249_10001691 3300009553 Bacteria 19321
132 Ga0105249_10001995 3300009553 Bacteria 17726
133 Ga0105239_10173174 3300010375 Bacteria 2414
134 Ga0105246_10206438 3300011119 Bacteria 1531
135 Ga0157378_10001030 3300013297 Bacteria 25495
136 Ga0163162_10741058 3300013306 Bacteria 1102
137 Ga0157375_10388600 3300013308 Bacteria 1562
138 Ga0157380_10038738 3300014326 Bacteria 3703
139 Ga0157380_10123338 3300014326 Bacteria 2198
140 Ga0157379_10126438 3300014968 Bacteria 2300
141 Ga0157376_10002960 3300014969 Bacteria 11654
142 Ga0207653_10029938 3300025885 Bacteria 1755
143 Ga0207642_10000757 3300025899 Bacteria 9989
144 Ga0207688_10175704 3300025901 Bacteria 1275
145 Ga0207645_10056850 3300025907 Bacteria 2498
146 Ga0207643_10063660 3300025908 Bacteria 2110
147 Ga0207643_10261930 3300025908 Bacteria 1068
148 Ga0207707_10003624 3300025912 Bacteria 13691
149 Ga0207707_10052310 3300025912 Bacteria 3556
150 Ga0207671_10847736 3300025914 Bacteria 724
151 Ga0207660_10016500 3300025917 Bacteria 4889
152 Ga0207662_10000333 3300025918 Bacteria 21392
153 Ga0207652_10008519 3300025921 Bacteria 8252
154 Ga0207652_10014649 3300025921 Bacteria 6355
155 Ga0207659_10068127 3300025926 Bacteria 2588
156 Ga0207687_10011184 3300025927 Bacteria 5861
157 Ga0207644_10145025 3300025931 Bacteria 1832
158 Ga0207686_10003182 3300025934 Bacteria 8833
159 Ga0207709_10000917 3300025935 Bacteria 22229
160 Ga0207670_10003240 3300025936 Bacteria 8630
161 Ga0207670_10062918 3300025936 Bacteria 2537
162 Ga0207669_10137559 3300025937 Bacteria 1690
163 Ga0207704_10000141 3300025938 Bacteria 38563
164 Ga0207691_10426110 3300025940 Bacteria 1130
165 Ga0207689_10001663 3300025942 Bacteria 21091
166 Ga0207689_10074410 3300025942 Bacteria 2791
167 Ga0207689_10288610 3300025942 Bacteria 1359
168 Ga0207667_10007911 3300025949 Bacteria 12694
169 Ga0207667_10449396 3300025949 Unclassified 1310
170 Ga0207712_10000763 3300025961 Bacteria 24183
171 Ga0207712_10001549 3300025961 Bacteria 15507
172 Ga0207668_10612794 3300025972 Bacteria 949
173 Ga0207640_10003474 3300025981 Bacteria 8488
174 Ga0207677_10001911 3300026023 Bacteria 11006
175 Ga0207703_10001682 3300026035 Bacteria 19893
176 Ga0207639_10011475 3300026041 Bacteria 6156
177 Ga0207708_10000114 3300026075 Bacteria 61971
178 Ga0207708_10031813 3300026075 Bacteria 4006
179 Ga0207708_10467731 3300026075 Bacteria 1052
180 Ga0207702_10266781 3300026078 Bacteria 1614
181 Ga0207648_10000113 3300026089 Bacteria 78626
182 Ga0207648_10010664 3300026089 Bacteria 8687
183 Ga0207676_10228043 3300026095 Unclassified 1663
184 Ga0207675_100010262 3300026118 Bacteria 8777
185 Ga0207675_100044764 3300026118 Bacteria 4136
186 Ga0207683_10680586 3300026121 Bacteria 953
187 Ga0207698_10621628 3300026142 Bacteria 1067
188 Ga0209983_1024862 3300027665 Unclassified 1263
189 Ga0209974_10012839 3300027876 Bacteria 2797
190 Ga0207428_10020083 3300027907 Bacteria 5683
191 Ga0207428_10068524 3300027907 Bacteria 2790
192 Ga0207428_10087673 3300027907 Bacteria 2421
193 Ga0268265_10021267 3300028380 Bacteria 4541
194 Ga0268265_10067410 3300028380 Bacteria 2770
195 Ga0268265_10322159 3300028380 Bacteria 1400
196 Ga0268264_10002945 3300028381 Bacteria 14789
197 Ga0307408_100230023 3300031548 Bacteria 1518
198 Ga0307408_100234643 3300031548 Bacteria 1504
199 Ga0307416_100165500 3300032002 Bacteria 2050
200 Ga0307416_100409164 3300032002 Bacteria 1397
201 Ga0307411_10027477 3300032005 Bacteria 3444
202 Ga0307415_100180949 3300032126 Bacteria 1654
203 Ga0373938_0035096 3300034957 Bacteria 1092
204 Ga0373928_0053221 3300035084 Bacteria 961
205 Ga0373944_0007253 3300035089 Bacteria 2964
206 Ga0373949_0039864 3300035090 Bacteria 1151
207 Ga0373952_0025970 3300035092 Bacteria 1269
208 Ga0373952_0064677 3300035092 Unclassified 902
209 Ga0373923_0033703 3300035111 Bacteria 2075
210 Ga0373932_0004367 3300035112 Bacteria 3352
211 Ga0373936_0022324 3300035113 Bacteria 2464
212 Ga0373939_0130750 3300035114 Bacteria 896
213 Ga0373954_0000001 3300035118 Bacteria 158201
214 Ga0373943_0039938 3300035170 Bacteria 2263
215 Ga0373943_0121057 3300035170 Unclassified 1390
216 Ga0373946_0011551 3300035171 Bacteria 3297
217 Ga0373942_0016242 3300035207 Bacteria 1823
218 Ga0373961_0019023 3300035241 Bacteria 1800
219 Ga0316574_0001268 3300035398 Bacteria 11785
220 Ga0373924_0173465 3300035410 Bacteria 948
221 Ga0373935_0037672 3300035692 Bacteria 3026
222 Ga0373935_0473453 3300035692 Bacteria 907
223 Ga0373927_0021393 3300035695 Bacteria 4239
224 Ga0373933_0007378 3300035724 Bacteria 5996
225 Ga0373933_0047953 3300035724 Bacteria 2542
226 Ga0373947_0009399 3300035725 Bacteria 5615
227 Ga0373947_0205319 3300035725 Unclassified 1290
228 Ga0373937_0000524 3300036401 Bacteria 34277
229 Ga0373925_0168594 3300037068 Bacteria 1728
230 Ga0373925_0356864 3300037068 Bacteria 1188
231 Ga0451802_0923812 3300041460 Bacteria 728
232 Ga0439443_002193 3300042003 Bacteria 2303
233 Ga0439435_0009080 3300042436 Unclassified 2325
234 Ga0451577_0017865 3300042876 Bacteria 6544
235 Ga0466964_0047494 3300044706 Bacteria 1752
236 Ga0451576_0000220 3300045051 Bacteria 141261
237 Ga0451576_0202793 3300045051 Bacteria 2071
238 Ga0451576_0361650 3300045051 Bacteria 1520
239 Ga0466967_0007734 3300045976 Bacteria 7792
240 Ga0495592_0000330 3300046454 Bacteria 39376
241 Ga0495603_0014314 3300046455 Bacteria 4797
242 Ga0495653_0258286 3300046463 Bacteria 1153
243 Ga0495580_0136841 3300046472 Bacteria 1698
244 Ga0495582_0067401 3300046473 Bacteria 1978
245 Ga0495639_0011632 3300046475 Bacteria 3796
246 Ga0495662_0001576 3300046476 Bacteria 11341
247 Ga0495594_0024901 3300046499 Bacteria 3216
248 Ga0495618_0162877 3300046514 Bacteria 1421
249 Ga0495628_0017743 3300046516 Bacteria 5911
250 Ga0495630_0002124 3300046517 Bacteria 13785
251 Ga0495666_0013793 3300046526 Bacteria 4028
252 Ga0495666_0063982 3300046526 Bacteria 1756
253 Ga0495642_0074839 3300046528 Bacteria 1420
254 Ga0495652_0118914 3300046529 Bacteria 2111
255 Ga0495665_0048086 3300046531 Bacteria 2262
256 Ga0495640_0000361 3300046533 Bacteria 31989
257 Ga0495640_0046844 3300046533 Bacteria 2994
258 Ga0495586_0002047 3300046535 Bacteria 10948
259 Ga0495586_0002540 3300046535 Bacteria 9883
260 Ga0495587_0036546 3300046536 Bacteria 2954
261 Ga0495598_0070370 3300046537 Unclassified 1100
262 Ga0495621_0075633 3300046539 Bacteria 1248
263 Ga0495621_0086855 3300046539 Bacteria 1174
264 Ga0495667_0007566 3300046559 Bacteria 7369
265 Ga0495656_0089713 3300046615 Bacteria 1404
266 Ga0495634_0004040 3300046642 Bacteria 11641
267 Ga0495635_0051430 3300046663 Bacteria 2839
268 Ga0495659_0262445 3300046664 Bacteria 722
269 Ga0495588_0004794 3300046674 Bacteria 5985
270 Ga0495657_0149011 3300046675 Bacteria 1454
271 Ga0495599_0001009 3300046678 Bacteria 15822
272 Ga0495647_0000474 3300046681 Bacteria 11658
273 Ga0495658_0003242 3300046683 Bacteria 8101
274 Ga0495658_0005980 3300046683 Bacteria 5976
275 Ga0495669_0004326 3300046684 Bacteria 5860
276 Ga0495613_0006712 3300046689 Bacteria 8592
277 Ga0495624_0101581 3300046690 Bacteria 1770
278 Ga0495624_0168428 3300046690 Bacteria 1337
279 Ga0495600_0041628 3300046809 Bacteria 2994
280 Ga0495581_0087731 3300047315 Bacteria 1804
281 Ga0495581_0099265 3300047315 Bacteria 1691
282 Ga0495636_0003589 3300047318 Bacteria 6013
283 Ga0495676_0015658 3300047321 Bacteria 6744
284 Ga0495680_0004397 3300047322 Bacteria 13490
285 Ga0495677_0047519 3300047445 Bacteria 1576
286 Ga0501298_009832 3300049521 Bacteria 1634
287 Ga0501036_0283822 3300049572 Bacteria 1385
288 Ga0501038_0284011 3300049574 Bacteria 1302
289 Ga0501039_0271721 3300049575 Bacteria 1332
290 Ga0501039_0424581 3300049575 Bacteria 1044
291 Ga0501041_0055780 3300049577 Bacteria 2413
292 Ga0501042_0025340 3300049578 Bacteria 4165
293 Ga0501042_0425092 3300049578 Bacteria 963
294 Ga0501046_0165715 3300049580 Bacteria 1660
295 Ga0501069_0069361 3300049585 Bacteria 1974
296 Ga0501071_0061293 3300049587 Bacteria 2724
297 Ga0501071_0128206 3300049587 Bacteria 1884
298 Ga0501072_0034113 3300049588 Bacteria 3988
299 Ga0501072_0152537 3300049588 Bacteria 1842
300 Ga0501074_0277532 3300049590 Bacteria 1191
301 Ga0501075_0078589 3300049591 Bacteria 2497
302 Ga0501076_0142719 3300049592 Bacteria 1946
303 Ga0501077_0149703 3300049593 Bacteria 1481
304 Ga0501079_0019251 3300049741 Bacteria 5214
305 Ga0501083_0175824 3300049744 Bacteria 1399
306 Ga0501045_0006184 3300049824 Bacteria 8289
307 Ga0501045_0245368 3300049824 Bacteria 1333
308 nmdc:mga05p37_540796_c1 3300050507 Bacteria 1328
309 nmdc:mga05p37_785507_c1 3300050507 Bacteria 1044
310 nmdc:mga09592_12086_c1 3300050508 Bacteria 7026
311 nmdc:mga09592_195589_c1 3300050508 Bacteria 1751
312 nmdc:mga09592_515577_c1 3300050508 Bacteria 1029
313 nmdc:mga0qj67_198660_c1 3300050509 Bacteria 1630
314 nmdc:mga06r32_180474_c1 3300050510 Bacteria 2097
315 nmdc:mga06r32_303408_c1 3300050510 Bacteria 1583
316 nmdc:mga06r32_42840_c1 3300050510 Bacteria 4306
317 nmdc:mga06r32_592811_c1 3300050510 Bacteria 1080
318 nmdc:mga08y16_15480_c1 3300050511 Bacteria 8021
319 nmdc:mga08y16_19806_c1 3300050511 Bacteria 7094
320 nmdc:mga08y16_72232_c1 3300050511 Bacteria 3596
321 nmdc:mga0n895_1134_c1 3300050512 Bacteria 19498
322 nmdc:mga0n895_1424_c1 3300050512 Bacteria 17895
323 nmdc:mga0n895_25390_c1 3300050512 Bacteria 5597
324 nmdc:mga0rr50_241022_c1 3300050513 Bacteria 1499
325 nmdc:mga0rr50_4637_c1 3300050513 Bacteria 8098
326 nmdc:mga0rr50_561990_c1 3300050513 Bacteria 972
327 nmdc:mga0rr50_607_c1 3300050513 Bacteria 19255
328 nmdc:mga08x19_140122_c1 3300050514 Bacteria 1633
329 nmdc:mga08x19_1409_c1 3300050514 Bacteria 14868
330 nmdc:mga08x19_176583_c1 3300050514 Bacteria 1457
331 nmdc:mga08x19_225291_c1 3300050514 Bacteria 1289
332 nmdc:mga08x19_51011_c1 3300050514 Bacteria 2657
333 nmdc:mga0a205_230504_c1 3300050515 Bacteria 1735
334 nmdc:mga0a205_31375_c1 3300050515 Bacteria 5091
335 nmdc:mga0a205_672_c1 3300050515 Bacteria 27265
336 Ga0495601_0003708 3300053077 Bacteria 8793
337 Ga0495601_0342861 3300053077 Bacteria 972
338 Ga0495619_0276450 3300053085 Unclassified 1163
339 Ga0501084_0040860 3300054114 Bacteria 3881
340 Ga0530510_0355545 3300061734 Bacteria 1100
341 Ga0068869_100616051
342 Ga0065707_10123270
343 Ga0070676_10035696
344 Ga0070690_100004536
345 Ga0070690_100027114
346 Ga0070690_100407178
347 Ga0068869_100001616
348 Ga0068869_100054613
349 Ga0068869_100314804
350 Ga0070680_100020901
351 Ga0068868_100000209
352 Ga0070689_100000614
353 Ga0070689_100035012
354 Ga0070689_100050366
355 Ga0070691_10001291
356 Ga0070691_10023649
357 Ga0070687_100000190
358 Ga0070687_100129166
359 Ga0070692_10003658
360 Ga0070692_10062195
361 Ga0070668_100552922
362 Ga0070669_100003300
363 Ga0070675_100218972
364 Ga0070674_100122355
365 Ga0070674_100180159
366 Ga0070673_100708027
367 Ga0070703_10022770
368 Ga0070701_10006881
369 Ga0070705_100000320
370 Ga0070705_100038261
371 Ga0070705_100385329
372 Ga0070700_100000571
373 Ga0070700_100000733
374 Ga0070700_100649807
375 Ga0070694_100000802
376 Ga0070694_100039772
377 Ga0070694_100112975
378 Ga0070694_100310184
379 Ga0070694_100338323
380 Ga0070708_100326606
381 Ga0070678_100622897
382 Ga0070681_10000172
383 Ga0070681_10306967
384 Ga0068867_100000417
385 Ga0068867_100003986
386 Ga0070699_100006683
387 Ga0070699_100035105
388 Ga0070679_100002529
389 Ga0070679_100071211
390 Ga0070697_100003503
391 Ga0068853_100045594
392 Ga0070686_100000825
393 Ga0070695_100000457
394 Ga0070695_100007243
395 Ga0070695_100128588
396 Ga0070696_100002371
397 Ga0070696_100004412
398 Ga0070696_100180435
399 Ga0070696_100239467
400 Ga0070693_100001007
401 Ga0070693_100168655
402 Ga0070704_100003235
403 Ga0070704_100433538
404 Ga0068855_100009634
405 Ga0068855_100333516
406 Ga0068854_100002076
407 Ga0068856_100003781
408 Ga0068856_100143560
409 Ga0070702_100000050
410 Ga0070702_100562160
411 Ga0068852_100453995
412 Ga0068859_100000332
413 Ga0068864_100050916
414 Ga0068866_10000489
415 Ga0068861_100004686
416 Ga0068861_100008854
417 Ga0068870_10043184
418 Ga0068870_10078628
419 Ga0068858_100004862
420 Ga0068860_100011672
421 Ga0068862_100003390
422 Ga0068862_100017352
423 Ga0068862_100036184
424 Ga0068862_100219140
425 Ga0081539_10003343
426 Ga0097621_100000676
427 Ga0068871_100002899
428 Ga0068871_100667678
429 Ga0075428_100173980
430 Ga0075428_101007113
431 Ga0075430_100009032
432 Ga0075430_100186365
433 Ga0075431_100006336
434 Ga0075431_100051269
435 Ga0075431_100092120
436 Ga0075431_100780628
437 Ga0075433_10001341
438 Ga0075433_10333137
439 Ga0075433_10601602
440 Ga0075434_100000211
441 Ga0075434_100001149
442 Ga0075434_100006290
443 Ga0075434_101321854
444 Ga0075429_100072952
445 Ga0075429_100324893
446 Ga0068865_100005124
447 Ga0068865_100021004
448 Ga0075436_100002524
449 Ga0075436_100002652
450 Ga0075436_100003794
451 Ga0075436_100014215
452 Ga0097620_100000332
453 Ga0075435_100000938
454 Ga0075435_100006459
455 Ga0075435_100189364
456 Ga0075435_100747389
457 Ga0099794_10004828
458 Ga0111539_10022702
459 Ga0111539_10024409
460 Ga0111539_10070882
461 Ga0111539_10210458
462 Ga0111539_10765178
463 Ga0105245_10000115
464 Ga0114129_10400649
465 Ga0114129_10663823
466 Ga0105243_10001566
467 Ga0105243_10039112
468 Ga0105241_10067425
469 Ga0105242_10029486
470 Ga0105237_10436999
471 Ga0105249_10001691
472 Ga0105249_10001995
473 Ga0105239_10173174
474 Ga0105246_10206438
475 Ga0157378_10001030
476 Ga0163162_10741058
477 Ga0157375_10388600
478 Ga0157380_10038738
479 Ga0157380_10123338
480 Ga0157379_10126438
481 Ga0157376_10002960
482 Ga0207653_10029938
483 Ga0207642_10000757
484 Ga0207688_10175704
485 Ga0207645_10056850
486 Ga0207643_10063660
487 Ga0207643_10261930
488 Ga0207707_10003624
489 Ga0207707_10052310
490 Ga0207671_10847736
491 Ga0207660_10016500
492 Ga0207662_10000333
493 Ga0207652_10008519
494 Ga0207652_10014649
495 Ga0207659_10068127
496 Ga0207687_10011184
497 Ga0207644_10145025
498 Ga0207686_10003182
499 Ga0207709_10000917
500 Ga0207670_10003240
501 Ga0207670_10062918
502 Ga0207669_10137559
503 Ga0207704_10000141
504 Ga0207691_10426110
505 Ga0207689_10001663
506 Ga0207689_10074410
507 Ga0207689_10288610
508 Ga0207667_10007911
509 Ga0207667_10449396
510 Ga0207712_10000763
511 Ga0207712_10001549
512 Ga0207668_10612794
513 Ga0207640_10003474
514 Ga0207677_10001911
515 Ga0207703_10001682
516 Ga0207639_10011475
517 Ga0207708_10000114
518 Ga0207708_10031813
519 Ga0207708_10467731
520 Ga0207702_10266781
521 Ga0207648_10000113
522 Ga0207648_10010664
523 Ga0207676_10228043
524 Ga0207675_100010262
525 Ga0207675_100044764
526 Ga0207683_10680586
527 Ga0207698_10621628
528 Ga0209983_1024862
529 Ga0209974_10012839
530 Ga0207428_10020083
531 Ga0207428_10068524
532 Ga0207428_10087673
533 Ga0268265_10021267
534 Ga0268265_10067410
535 Ga0268265_10322159
536 Ga0268264_10002945
537 Ga0307408_100230023
538 Ga0307408_100234643
539 Ga0307416_100165500
540 Ga0307416_100409164
541 Ga0307411_10027477
542 Ga0307415_100180949
543 Ga0373938_0035096
544 Ga0373928_0053221
545 Ga0373944_0007253
546 Ga0373949_0039864
547 Ga0373952_0025970
548 Ga0373952_0064677
549 Ga0373923_0033703
550 Ga0373932_0004367
551 Ga0373936_0022324
552 Ga0373939_0130750
553 Ga0373954_0000001
554 Ga0373943_0039938
555 Ga0373943_0121057
556 Ga0373946_0011551
557 Ga0373942_0016242
558 Ga0373961_0019023
559 Ga0316574_0001268
560 Ga0373924_0173465
561 Ga0373935_0037672
562 Ga0373935_0473453
563 Ga0373927_0021393
564 Ga0373933_0007378
565 Ga0373933_0047953
566 Ga0373947_0009399
567 Ga0373947_0205319
568 Ga0373937_0000524
569 Ga0373925_0168594
570 Ga0373925_0356864
571 Ga0451802_0923812
572 Ga0439443_002193
573 Ga0439435_0009080
574 Ga0451577_0017865
575 Ga0466964_0047494
576 Ga0451576_0000220
577 Ga0451576_0202793
578 Ga0451576_0361650
579 Ga0466967_0007734
580 Ga0495592_0000330
581 Ga0495603_0014314
582 Ga0495653_0258286
583 Ga0495580_0136841
584 Ga0495582_0067401
585 Ga0495639_0011632
586 Ga0495662_0001576
587 Ga0495594_0024901
588 Ga0495618_0162877
589 Ga0495628_0017743
590 Ga0495630_0002124
591 Ga0495666_0013793
592 Ga0495666_0063982
593 Ga0495642_0074839
594 Ga0495652_0118914
595 Ga0495665_0048086
596 Ga0495640_0000361
597 Ga0495640_0046844
598 Ga0495586_0002047
599 Ga0495586_0002540
600 Ga0495587_0036546
601 Ga0495598_0070370
602 Ga0495621_0075633
603 Ga0495621_0086855
604 Ga0495667_0007566
605 Ga0495656_0089713
606 Ga0495634_0004040
607 Ga0495635_0051430
608 Ga0495659_0262445
609 Ga0495588_0004794
610 Ga0495657_0149011
611 Ga0495599_0001009
612 Ga0495647_0000474
613 Ga0495658_0003242
614 Ga0495658_0005980
615 Ga0495669_0004326
616 Ga0495613_0006712
617 Ga0495624_0101581
618 Ga0495624_0168428
619 Ga0495600_0041628
620 Ga0495581_0087731
621 Ga0495581_0099265
622 Ga0495636_0003589
623 Ga0495676_0015658
624 Ga0495680_0004397
625 Ga0495677_0047519
626 Ga0501298_009832
627 Ga0501036_0283822
628 Ga0501038_0284011
629 Ga0501039_0271721
630 Ga0501039_0424581
631 Ga0501041_0055780
632 Ga0501042_0025340
633 Ga0501042_0425092
634 Ga0501046_0165715
635 Ga0501069_0069361
636 Ga0501071_0061293
637 Ga0501071_0128206
638 Ga0501072_0034113
639 Ga0501072_0152537
640 Ga0501074_0277532
641 Ga0501075_0078589
642 Ga0501076_0142719
643 Ga0501077_0149703
644 Ga0501079_0019251
645 Ga0501083_0175824
646 Ga0501045_0006184
647 Ga0501045_0245368
648 nmdc:mga05p37_540796_c1
649 nmdc:mga05p37_785507_c1
650 nmdc:mga09592_12086_c1
651 nmdc:mga09592_195589_c1
652 nmdc:mga09592_515577_c1
653 nmdc:mga0qj67_198660_c1
654 nmdc:mga06r32_180474_c1
655 nmdc:mga06r32_303408_c1
656 nmdc:mga06r32_42840_c1
657 nmdc:mga06r32_592811_c1
658 nmdc:mga08y16_15480_c1
659 nmdc:mga08y16_19806_c1
660 nmdc:mga08y16_72232_c1
661 nmdc:mga0n895_1134_c1
662 nmdc:mga0n895_1424_c1
663 nmdc:mga0n895_25390_c1
664 nmdc:mga0rr50_241022_c1
665 nmdc:mga0rr50_4637_c1
666 nmdc:mga0rr50_561990_c1
667 nmdc:mga0rr50_607_c1
668 nmdc:mga08x19_140122_c1
669 nmdc:mga08x19_1409_c1
670 nmdc:mga08x19_176583_c1
671 nmdc:mga08x19_225291_c1
672 nmdc:mga08x19_51011_c1
673 nmdc:mga0a205_230504_c1
674 nmdc:mga0a205_31375_c1
675 nmdc:mga0a205_672_c1
676 Ga0495601_0003708
677 Ga0495601_0342861
678 Ga0495619_0276450
679 Ga0501084_0040860
680 Ga0530510_0355545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

28

218

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xaf-assembly1.cif.gz_B crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t 0.9434 2 213
1rw0-assembly1.cif.gz_B crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 0.943 2 213
1z9t-assembly1.cif.gz_A crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution 0.9355 2 213
1xaf-assembly1.cif.gz_B crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t 0.9349 2 213
7f3v-assembly3.cif.gz_C crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac 0.9346 2 213
ID Description Score Start End Superfamily
1rv9A00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9338 2 213 3.60.140.10
af_Q2FZ88_1_221_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9266 30 213 3.60.140.10
1rv9A00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9253 2 213 3.60.140.10
1xafA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9177 2 213 3.60.140.10
1xafA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9094 2 213 3.60.140.10
ID Description Score Start End GO Terms
AF-A0A7C3H6A5-F1-model_v4 Purine nucleoside phosphorylase 0.9804 62 213 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A536STT6-F1-model_v4 Purine nucleoside phosphorylase 0.9792 22 213 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A536Y3S5-F1-model_v4 Purine nucleoside phosphorylase 0.9775 24 213 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A5C5U704-F1-model_v4 Purine nucleoside phosphorylase 0.9761 62 213 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A1G0DUB2-F1-model_v4 Purine nucleoside phosphorylase 0.9704 33 212 GO:0004000
GO:0005507
GO:0017061
GO:0046936

Map