F414068

General Info

Members Datasets Scaffolds Average Seq Length
339 241 336 255

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0000194|Ga0496106_0000194_14220_15029
Length 269
Sequence MAKQADQRRSLIMALLSVREETKRFGGLLANQSISFDVEEGELLAVIGPNGAGKTTLFNVISGFFPPTTGSIHFDGKEITGLSSHSVASAGLVRTYQLVQLFKHLTVAENVEIGSHRVTRGGVFSALFRPDWMRRQEKSVSEGARELLRFVGLENQADLQADKLPYGRQRLLEVARALAAKPRLLLLDEPAAGLNTQETEALAEVIKRIHQGGTTVILIEHDMSLVMKIAQRIVVLDFGKKIAEGTPDEIKVHPDVIAAYLGGTEMADA

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
3 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
120 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
130 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.58
Nodule 0
Rhizoplane 6.78
Rhizosphere 64.6
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10031835 3300003215 Bacteria 1768
2 Ga0055536_1001564 3300003781 Bacteria 13702
3 Ga0055540_1001963 3300003792 Bacteria 11495
4 Ga0055531_10002668 3300003794 Bacteria 11763
5 Ga0065712_10209309 3300005290 Bacteria 1078
6 Ga0070658_10007170 3300005327 Bacteria 9005
7 Ga0070658_10099564 3300005327 Bacteria 2402
8 Ga0070683_100104825 3300005329 Bacteria 2665
9 Ga0070670_100000846 3300005331 Bacteria 23930
10 Ga0070670_100436195 3300005331 Bacteria 1160
11 Ga0070670_100846316 3300005331 Bacteria 827
12 Ga0070677_10274541 3300005333 Bacteria 847
13 Ga0070666_10077511 3300005335 Bacteria 2269
14 Ga0070680_100012109 3300005336 Bacteria 6696
15 Ga0070660_100107853 3300005339 Bacteria 2213
16 Ga0070689_100365288 3300005340 Bacteria 1213
17 Ga0070661_100552075 3300005344 Bacteria 927
18 Ga0070673_100164822 3300005364 Bacteria 1887
19 Ga0070667_100427933 3300005367 Bacteria 1207
20 Ga0070714_100085934 3300005435 Bacteria 2748
21 Ga0070714_100490115 3300005435 Bacteria 1171
22 Ga0070711_100121746 3300005439 Bacteria 1931
23 Ga0070663_100020404 3300005455 Bacteria 4388
24 Ga0070678_100007301 3300005456 Bacteria 6545
25 Ga0070662_100017039 3300005457 Bacteria 4889
26 Ga0070681_10092343 3300005458 Bacteria 2976
27 Ga0070681_10211572 3300005458 Bacteria 1855
28 Ga0068867_100039516 3300005459 Bacteria 3440
29 Ga0070685_10183860 3300005466 Bacteria 1348
30 Ga0070679_100045095 3300005530 Bacteria 4393
31 Ga0068853_100053301 3300005539 Bacteria 3484
32 Ga0068853_100337435 3300005539 Bacteria 1400
33 Ga0068853_100361784 3300005539 Bacteria 1352
34 Ga0070672_100058785 3300005543 Bacteria 3023
35 Ga0068855_100022934 3300005563 Bacteria 7481
36 Ga0068855_100040604 3300005563 Bacteria 5522
37 Ga0068855_100070068 3300005563 Bacteria 4080
38 Ga0068854_100214792 3300005578 Bacteria 1519
39 Ga0068856_100054584 3300005614 Bacteria 3941
40 Ga0068852_100126266 3300005616 Bacteria 2350
41 Ga0068859_100343287 3300005617 Bacteria 1587
42 Ga0068864_100074386 3300005618 Bacteria 2964
43 Ga0068863_100127511 3300005841 Bacteria 2428
44 Ga0081455_10036491 3300005937 Bacteria 4376
45 Ga0081455_10295874 3300005937 Bacteria 1163
46 Ga0081538_10025684 3300005981 Bacteria 4144
47 Ga0081538_10139419 3300005981 Bacteria 1122
48 Ga0081540_1000081 3300005983 Bacteria 102423
49 Ga0081539_10014335 3300005985 Bacteria 5872
50 Ga0075365_10006281 3300006038 Bacteria 6520
51 Ga0075368_10121815 3300006042 Bacteria 1080
52 Ga0075364_10005042 3300006051 Bacteria 7654
53 Ga0075364_10369779 3300006051 Bacteria 978
54 Ga0075367_10003522 3300006178 Bacteria 7482
55 Ga0075367_10017733 3300006178 Bacteria 3914
56 Ga0075369_10005410 3300006186 Bacteria 4771
57 Ga0075369_10009334 3300006186 Bacteria 3808
58 Ga0075369_10019366 3300006186 Bacteria 2778
59 Ga0075366_10016451 3300006195 Bacteria 4252
60 Ga0068871_100244980 3300006358 Bacteria 1560
61 Ga0068865_100433934 3300006881 Bacteria 1083
62 Ga0097620_100343278 3300006931 Bacteria 1587
63 Ga0105240_10006964 3300009093 Bacteria 16514
64 Ga0105247_10131640 3300009101 Bacteria 1631
65 Ga0105241_10239482 3300009174 Bacteria 1533
66 Ga0105237_10213933 3300009545 Bacteria 1927
67 Ga0105238_10073016 3300009551 Bacteria 3426
68 Ga0157371_10028113 3300013102 Bacteria 4074
69 Ga0157371_10232745 3300013102 Bacteria 1324
70 Ga0157370_10021005 3300013104 Bacteria 6511
71 Ga0157369_10379724 3300013105 Bacteria 1467
72 Ga0157374_10398189 3300013296 Bacteria 1373
73 Ga0157372_10152984 3300013307 Bacteria 2663
74 Ga0157375_10060948 3300013308 Bacteria 3744
75 Ga0163163_10018121 3300014325 Bacteria 6581
76 Ga0163163_10071712 3300014325 Bacteria 3452
77 Ga0163163_10388784 3300014325 Bacteria 1453
78 Ga0213873_10054239 3300021358 Bacteria 1070
79 Ga0213875_10002881 3300021388 Bacteria 10056
80 Ga0213875_10099133 3300021388 Bacteria 1360
81 Ga0213871_10039588 3300021441 Bacteria 1262
82 Ga0209233_1005652 3300025261 Bacteria 4129
83 Ga0209676_1001163 3300025292 Bacteria 28546
84 Ga0209564_1010219 3300025295 Bacteria 4354
85 Ga0209758_1000573 3300025297 Bacteria 57583
86 Ga0209758_1002991 3300025297 Bacteria 16204
87 Ga0209758_1007293 3300025297 Bacteria 7584
88 Ga0209051_1002220 3300025303 Bacteria 14326
89 Ga0209257_1004548 3300025304 Bacteria 10621
90 Ga0207682_10000693 3300025893 Bacteria 15643
91 Ga0207692_10138780 3300025898 Bacteria 1381
92 Ga0207710_10053302 3300025900 Bacteria 1820
93 Ga0207680_10069042 3300025903 Bacteria 2182
94 Ga0207707_10110633 3300025912 Bacteria 2401
95 Ga0207693_10014192 3300025915 Bacteria 6412
96 Ga0207693_10065550 3300025915 Bacteria 2844
97 Ga0207663_10201584 3300025916 Bacteria 1436
98 Ga0207660_10049491 3300025917 Bacteria 2979
99 Ga0207657_10016310 3300025919 Bacteria 7168
100 Ga0207649_10359213 3300025920 Bacteria 1080
101 Ga0207652_10053776 3300025921 Bacteria 3459
102 Ga0207652_10067195 3300025921 Bacteria 3108
103 Ga0207694_10054220 3300025924 Bacteria 3110
104 Ga0207650_10044584 3300025925 Bacteria 3260
105 Ga0207650_10333556 3300025925 Bacteria 1244
106 Ga0207659_10010699 3300025926 Bacteria 5769
107 Ga0207644_10167739 3300025931 Bacteria 1712
108 Ga0207706_10010195 3300025933 Bacteria 8597
109 Ga0207709_10232239 3300025935 Bacteria 1337
110 Ga0207669_10031069 3300025937 Bacteria 2978
111 Ga0207704_10052697 3300025938 Bacteria 2468
112 Ga0207661_10054790 3300025944 Bacteria 3196
113 Ga0207661_10139351 3300025944 Bacteria 2086
114 Ga0207667_10033003 3300025949 Bacteria 5571
115 Ga0207667_10050210 3300025949 Bacteria 4402
116 Ga0207667_10381449 3300025949 Bacteria 1436
117 Ga0207668_10071901 3300025972 Bacteria 2473
118 Ga0207658_10064155 3300025986 Bacteria 2755
119 Ga0207639_10274409 3300026041 Bacteria 1480
120 Ga0207678_10030766 3300026067 Bacteria 4686
121 Ga0207648_10016647 3300026089 Bacteria 6712
122 Ga0207676_10102461 3300026095 Bacteria 2376
123 Ga0207676_10337097 3300026095 Bacteria 1390
124 Ga0207674_10167550 3300026116 Bacteria 2150
125 Ga0207683_10045024 3300026121 Bacteria 3858
126 Ga0207698_10573144 3300026142 Bacteria 1109
127 Ga0209813_10079111 3300027866 Bacteria 1083
128 Ga0268265_10542270 3300028380 Bacteria 1103
129 Ga0265318_10020279 3300028577 Bacteria 2684
130 Ga0307517_10000035 3300028786 Bacteria 172762
131 Ga0265338_10235499 3300028800 Bacteria 1359
132 Ga0265338_10328285 3300028800 Bacteria 1106
133 Ga0265330_10017906 3300031235 Bacteria 3258
134 Ga0265332_10008376 3300031238 Bacteria 4648
135 Ga0265332_10055653 3300031238 Bacteria 1696
136 Ga0265320_10024485 3300031240 Bacteria 3192
137 Ga0265325_10011345 3300031241 Bacteria 5121
138 Ga0265329_10008281 3300031242 Bacteria 3950
139 Ga0265329_10015952 3300031242 Bacteria 2614
140 Ga0265340_10074412 3300031247 Bacteria 1606
141 Ga0265339_10004516 3300031249 Bacteria 9476
142 Ga0265339_10105914 3300031249 Bacteria 1459
143 Ga0265331_10036680 3300031250 Bacteria 2405
144 Ga0265331_10079051 3300031250 Bacteria 1530
145 Ga0265316_10056839 3300031344 Bacteria 3053
146 Ga0265316_10286147 3300031344 Bacteria 1204
147 Ga0265313_10049696 3300031595 Bacteria 2016
148 Ga0265314_10052367 3300031711 Bacteria 2838
149 Ga0265314_10107454 3300031711 Bacteria 1780
150 Ga0265342_10001995 3300031712 Bacteria 18185
151 Ga0316212_1023211 3300033547 Bacteria 869
152 Ga0373950_0014075 3300034818 Bacteria 1343
153 Ga0373947_0149693 3300035725 Bacteria 1502
154 Ga0373925_0132190 3300037068 Bacteria 1947
155 Ga0436364_0364569 3300037853 Bacteria 9723
156 Ga0436364_0880334 3300037853 Bacteria 1068
157 Ga0436365_0722300 3300039437 Bacteria 1841
158 Ga0436365_1178809 3300039437 Bacteria 2477
159 Ga0436360_0392957 3300039438 Bacteria 1438
160 Ga0436360_1007790 3300039438 Bacteria 4611
161 Ga0436360_1244528 3300039438 Bacteria 1032
162 Ga0436361_0861024 3300039447 Bacteria 1978
163 Ga0436363_0480585 3300039450 Bacteria 1551
164 Ga0436363_1353614 3300039450 Bacteria 4664
165 Ga0436362_0486585 3300039453 Bacteria 997
166 Ga0439453_0002041 3300041408 Bacteria 2721
167 Ga0439443_002271 3300042003 Bacteria 2278
168 Ga0439435_0009729 3300042436 Bacteria 2262
169 Ga0439460_0115182 3300042461 Bacteria 875
170 Ga0466963_0133239 3300044694 Bacteria 1718
171 Ga0466967_0286437 3300045976 Bacteria 1582
172 Ga0495638_0000558 3300046460 Bacteria 42376
173 Ga0495638_0007155 3300046460 Bacteria 8040
174 Ga0495638_0038755 3300046460 Bacteria 3027
175 Ga0495638_0066229 3300046460 Bacteria 2221
176 Ga0495651_0171189 3300046462 Bacteria 1546
177 Ga0495651_0338333 3300046462 Bacteria 998
178 Ga0495650_0009511 3300046471 Bacteria 5521
179 Ga0495664_0119529 3300046477 Bacteria 1594
180 Ga0495584_0153864 3300046491 Bacteria 1168
181 Ga0495607_0004389 3300046501 Bacteria 10395
182 Ga0495610_0003810 3300046512 Bacteria 11500
183 Ga0495616_0072881 3300046513 Bacteria 1658
184 Ga0495628_0185487 3300046516 Bacteria 1572
185 Ga0495630_0299960 3300046517 Bacteria 1228
186 Ga0495631_0054203 3300046518 Bacteria 1749
187 Ga0495637_0080324 3300046520 Bacteria 1301
188 Ga0495643_0015126 3300046522 Bacteria 4572
189 Ga0495648_0045114 3300046524 Bacteria 2745
190 Ga0495654_0007875 3300046530 Bacteria 5925
191 Ga0495640_0043700 3300046533 Bacteria 3119
192 Ga0495621_0054940 3300046539 Bacteria 1432
193 Ga0495656_0056469 3300046615 Bacteria 1697
194 Ga0495656_0063384 3300046615 Bacteria 1620
195 Ga0495668_0062321 3300046616 Bacteria 2055
196 Ga0495668_0107919 3300046616 Bacteria 1523
197 Ga0495625_0053796 3300046660 Bacteria 2878
198 Ga0495599_0242032 3300046678 Bacteria 1100
199 Ga0495613_0256054 3300046689 Bacteria 1220
200 Ga0495600_0158083 3300046809 Bacteria 1466
201 Ga0495674_0024736 3300047319 Bacteria 5513
202 Ga0495680_0168383 3300047322 Bacteria 1587
203 Ga0495683_0114870 3300047323 Bacteria 1282
204 Ga0495686_0006696 3300047472 Bacteria 8767
205 Ga0496101_0145762 3300048904 Bacteria 1808
206 Ga0496102_0080748 3300048905 Bacteria 2996
207 Ga0496103_0041887 3300048906 Bacteria 2816
208 Ga0496104_0000538 3300048907 Bacteria 32550
209 Ga0496104_0001834 3300048907 Bacteria 18376
210 Ga0496104_0009162 3300048907 Bacteria 8803
211 Ga0496105_0008017 3300048908 Bacteria 8205
212 Ga0496105_0020622 3300048908 Bacteria 5327
213 Ga0496105_0402926 3300048908 Bacteria 1086
214 Ga0496106_0000194 3300048909 Bacteria 42793
215 Ga0496106_0060980 3300048909 Bacteria 2860
216 Ga0496108_0000373 3300048911 Bacteria 37319
217 Ga0496109_0001363 3300048912 Bacteria 20247
218 Ga0496110_0003079 3300048913 Bacteria 12645
219 Ga0496110_0393594 3300048913 Bacteria 1263
220 Ga0496111_0078890 3300048914 Bacteria 2401
221 Ga0496112_0011923 3300048915 Bacteria 7963
222 Ga0496112_0020633 3300048915 Bacteria 6248
223 Ga0496113_0000161 3300048916 Bacteria 29564
224 Ga0496115_0018878 3300048918 Bacteria 5302
225 Ga0496115_0286812 3300048918 Bacteria 1351
226 Ga0496115_0319041 3300048918 Bacteria 1271
227 Ga0496116_0003806 3300048919 Bacteria 14746
228 Ga0496117_0002577 3300048920 Bacteria 22566
229 Ga0496117_0017448 3300048920 Bacteria 5993
230 Ga0496118_0007352 3300048921 Bacteria 11712
231 Ga0496118_0024724 3300048921 Bacteria 5174
232 Ga0496119_0075604 3300048922 Bacteria 1957
233 Ga0496120_0026304 3300048923 Bacteria 3595
234 Ga0496120_0111725 3300048923 Bacteria 1427
235 Ga0496121_0000643 3300048924 Bacteria 65217
236 Ga0496121_0004299 3300048924 Bacteria 19303
237 Ga0496122_0174011 3300048925 Bacteria 1293
238 Ga0496123_0002639 3300048926 Bacteria 21715
239 Ga0496124_0167774 3300048927 Bacteria 1704
240 Ga0496125_0000756 3300048928 Bacteria 52960
241 Ga0496125_0001227 3300048928 Bacteria 38397
242 Ga0496125_0003979 3300048928 Bacteria 17384
243 Ga0496125_0114071 3300048928 Bacteria 1947
244 Ga0496126_0027842 3300048929 Bacteria 5391
245 Ga0496126_0113140 3300048929 Bacteria 2363
246 Ga0496126_0121306 3300048929 Bacteria 2266
247 Ga0496126_0147063 3300048929 Bacteria 2023
248 Ga0496126_0202942 3300048929 Bacteria 1673
249 Ga0501031_0104460 3300049568 Bacteria 1849
250 Ga0501032_0182395 3300049569 Bacteria 1374
251 Ga0501033_0306974 3300049570 Bacteria 1116
252 Ga0501034_0182058 3300049571 Bacteria 2066
253 Ga0501034_0216393 3300049571 Bacteria 1869
254 Ga0501034_0350998 3300049571 Bacteria 1403
255 Ga0501038_0060996 3300049574 Bacteria 3226
256 Ga0501038_0109394 3300049574 Bacteria 2290
257 Ga0501039_0041299 3300049575 Bacteria 3562
258 Ga0501040_0065223 3300049576 Bacteria 2508
259 Ga0501040_0261779 3300049576 Bacteria 1234
260 Ga0501042_0062628 3300049578 Bacteria 2658
261 Ga0501048_0152167 3300049582 Bacteria 1637
262 Ga0501069_0100849 3300049585 Bacteria 1639
263 Ga0501069_0142486 3300049585 Bacteria 1375
264 Ga0501071_0163441 3300049587 Bacteria 1665
265 Ga0501072_0002644 3300049588 Bacteria 13431
266 Ga0501072_0138923 3300049588 Bacteria 1937
267 Ga0501072_0163681 3300049588 Bacteria 1775
268 Ga0501072_0301973 3300049588 Bacteria 1273
269 Ga0501073_0124885 3300049589 Bacteria 1784
270 Ga0501073_0197476 3300049589 Bacteria 1391
271 Ga0501073_0370097 3300049589 Bacteria 990
272 Ga0501075_0148463 3300049591 Bacteria 1787
273 Ga0501075_0243847 3300049591 Bacteria 1370
274 Ga0501076_0326665 3300049592 Bacteria 1258
275 Ga0501077_0253120 3300049593 Bacteria 1120
276 Ga0501079_0221100 3300049741 Bacteria 1480
277 Ga0501080_0074331 3300049742 Bacteria 3161
278 Ga0501083_0007960 3300049744 Bacteria 7504
279 Ga0501083_0082723 3300049744 Bacteria 2127
280 Ga0501083_0271227 3300049744 Bacteria 1104
281 Ga0501035_0000505 3300049822 Bacteria 44014
282 Ga0501035_0610513 3300049822 Bacteria 888
283 Ga0501044_0097953 3300049823 Bacteria 2953
284 Ga0501044_0528630 3300049823 Bacteria 1078
285 nmdc:mga00v17_25686_c1 3300050491 Bacteria 3426
286 nmdc:mga00v17_297766_c1 3300050491 Bacteria 1048
287 nmdc:mga0yw44_10260_c1 3300050492 Bacteria 4777
288 nmdc:mga06z11_129662_c1 3300050494 Bacteria 1415
289 nmdc:mga06z11_2892_c1 3300050494 Bacteria 6605
290 nmdc:mga04h51_101835_c1 3300050495 Bacteria 1047
291 nmdc:mga04h51_86994_c1 3300050495 Bacteria 1119
292 nmdc:mga07m45_305810_c1 3300050496 Bacteria 924
293 nmdc:mga05p37_1023982_c1 3300050507 Bacteria 874
294 nmdc:mga0sz30_11074_c1 3300050516 Bacteria 3470
295 Ga0495601_0005106 3300053077 Bacteria 7625
296 Ga0495601_0035381 3300053077 Bacteria 3117
297 Ga0495612_0016750 3300053078 Bacteria 2936
298 Ga0495595_0013025 3300053084 Bacteria 3509
299 Ga0495619_0047955 3300053085 Bacteria 2814
300 Ga0500578_0059891 3300053086 Bacteria 2433
301 Ga0500643_002411 3300053087 Bacteria 9688
302 Ga0500644_0009081 3300053088 Bacteria 2647
303 Ga0500651_0018522 3300053093 Bacteria 4311
304 Ga0500641_0006226 3300053096 Bacteria 4234
305 Ga0500641_0015301 3300053096 Bacteria 2844
306 Ga0500650_0000159 3300053098 Bacteria 17834
307 Ga0500650_0171482 3300053098 Bacteria 997
308 Ga0500556_0000003 3300053104 Bacteria 679379
309 Ga0500562_027051 3300053108 Bacteria 1504
310 Ga0500569_017418 3300053109 Bacteria 1836
311 Ga0500595_003585 3300053119 Bacteria 7215
312 Ga0500595_003700 3300053119 Bacteria 7055
313 Ga0500595_008393 3300053119 Bacteria 4220
314 Ga0500642_0020105 3300053130 Bacteria 2618
315 Ga0500652_000051 3300053131 Bacteria 54844
316 Ga0500658_0011637 3300053134 Bacteria 3242
317 Ga0500568_0000226 3300053139 Bacteria 48324
318 Ga0500568_0001594 3300053139 Bacteria 14345
319 Ga0500604_0000208 3300053151 Bacteria 16819
320 Ga0500604_0021492 3300053151 Bacteria 1824
321 Ga0500604_0060880 3300053151 Bacteria 1185
322 Ga0500616_0000114 3300053153 Bacteria 148574
323 Ga0500616_0087969 3300053153 Bacteria 1545
324 Ga0500622_0048970 3300053156 Bacteria 2179
325 Ga0500627_0026806 3300053158 Bacteria 2382
326 Ga0500633_0012571 3300053160 Bacteria 2344
327 Ga0500633_0013120 3300053160 Bacteria 2311
328 Ga0500636_0004993 3300053177 Bacteria 7528
329 Ga0500636_0089722 3300053177 Bacteria 1762
330 Ga0500645_055606 3300053730 Bacteria 1149
331 Ga0501084_0024022 3300054114 Bacteria 5084
332 Ga0501082_0000006 3300060353 Bacteria 127786
333 Ga0501082_0054902 3300060353 Bacteria 3433
334 Ga0501082_0277532 3300060353 Bacteria 1459
335 Ga0530510_0074951 3300061734 Bacteria 2457
336 Ga0530510_0460271 3300061734 Bacteria 962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10036491 Ga0081455_100364914 221
2 3300005981 Ga0081538_10025684 Ga0081538_100256845 221
3 3300006358 Ga0068871_100244980 Ga0068871_1002449801 221
4 3300049591 Ga0501075_0243847 Ga0501075_0243847_622_1341 224
5 3300039453 Ga0436362_0486585 Ga0436362_0486585_69_869 227
6 3300054114 Ga0501084_0024022 Ga0501084_0024022_2327_3097 232
7 3300049588 Ga0501072_0002644 Ga0501072_0002644_4969_5739 234
8 3300060353 Ga0501082_0000006 Ga0501082_0000006_270_1040 235
9 3300005457 Ga0070662_100017039 Ga0070662_1000170394 239
10 3300025933 Ga0207706_10010195 Ga0207706_100101957 239
11 3300031247 Ga0265340_10074412 Ga0265340_100744122 241
12 3300049576 Ga0501040_0065223 Ga0501040_0065223_343_1116 241
13 3300049592 Ga0501076_0326665 Ga0501076_0326665_133_906 241
14 3300025893 Ga0207682_10000693 Ga0207682_100006936 243
15 3300005290 Ga0065712_10209309 Ga0065712_102093092 244
16 3300005333 Ga0070677_10274541 Ga0070677_102745411 244
17 3300005543 Ga0070672_100058785 Ga0070672_1000587854 244
18 3300005331 Ga0070670_100846316 Ga0070670_1008463161 245
19 3300005335 Ga0070666_10077511 Ga0070666_100775112 245
20 3300005364 Ga0070673_100164822 Ga0070673_1001648222 245
21 3300005456 Ga0070678_100007301 Ga0070678_1000073015 245
22 3300005466 Ga0070685_10183860 Ga0070685_101838602 245
23 3300006881 Ga0068865_100433934 Ga0068865_1004339341 245
24 3300013296 Ga0157374_10398189 Ga0157374_103981892 245
25 3300025903 Ga0207680_10069042 Ga0207680_100690422 245
26 3300025926 Ga0207659_10010699 Ga0207659_100106996 245
27 3300025937 Ga0207669_10031069 Ga0207669_100310694 245
28 3300025938 Ga0207704_10052697 Ga0207704_100526972 245
29 3300025972 Ga0207668_10071901 Ga0207668_100719012 245
30 3300026121 Ga0207683_10045024 Ga0207683_100450243 245
31 3300046539 Ga0495621_0054940 Ga0495621_0054940_569_1339 245
32 3300046615 Ga0495656_0056469 Ga0495656_0056469_572_1342 245
33 3300003781 Ga0055536_1001564 Ga0055536_100156411 246
34 3300003792 Ga0055540_1001963 Ga0055540_100196311 246
35 3300003794 Ga0055531_10002668 Ga0055531_1000266810 246
36 3300005459 Ga0068867_100039516 Ga0068867_1000395162 246
37 3300026089 Ga0207648_10016647 Ga0207648_100166475 246
38 3300037853 Ga0436364_0880334 Ga0436364_0880334_289_1035 247
39 3300048929 Ga0496126_0113140 Ga0496126_0113140_1024_1773 249
40 3300034818 Ga0373950_0014075 Ga0373950_0014075_333_1100 251
41 3300049744 Ga0501083_0082723 Ga0501083_0082723_1314_2072 251
42 iso_pu_bacteria 2919171160 2919173955 252
43 3300005331 Ga0070670_100000846 Ga0070670_10000084617 253
44 3300005983 Ga0081540_1000081 Ga0081540_100008171 253
45 3300014325 Ga0163163_10071712 Ga0163163_100717125 253
46 3300025925 Ga0207650_10044584 Ga0207650_100445844 253
47 3300048905 Ga0496102_0080748 Ga0496102_0080748_968_1732 253
48 3300048906 Ga0496103_0041887 Ga0496103_0041887_1700_2464 253
49 3300048907 Ga0496104_0009162 Ga0496104_0009162_5780_6544 253
50 3300048908 Ga0496105_0008017 Ga0496105_0008017_1174_1938 253
51 3300048909 Ga0496106_0060980 Ga0496106_0060980_113_877 253
52 3300048911 Ga0496108_0000373 Ga0496108_0000373_11061_11825 253
53 3300048912 Ga0496109_0001363 Ga0496109_0001363_10328_11092 253
54 3300048913 Ga0496110_0003079 Ga0496110_0003079_2244_3008 253
55 3300048914 Ga0496111_0078890 Ga0496111_0078890_817_1581 253
56 3300048915 Ga0496112_0011923 Ga0496112_0011923_4475_5239 253
57 3300048916 Ga0496113_0000161 Ga0496113_0000161_12027_12791 253
58 3300048918 Ga0496115_0319041 Ga0496115_0319041_381_1145 253
59 iso_pu_bacteria 2602042107 2603857606 253
60 iso_pu_bacteria 2919073203 2919076607 253
61 3300006186 Ga0075369_10009334 Ga0075369_100093343 254
62 3300021358 Ga0213873_10054239 Ga0213873_100542392 254
63 3300021388 Ga0213875_10002881 Ga0213875_1000288110 254
64 3300021388 Ga0213875_10099133 Ga0213875_100991332 254
65 3300037853 Ga0436364_0364569 Ga0436364_0364569_7677_8480 254
66 3300039438 Ga0436360_0392957 Ga0436360_0392957_196_999 254
67 3300039438 Ga0436360_1244528 Ga0436360_1244528_133_939 254
68 3300039450 Ga0436363_1353614 Ga0436363_1353614_2112_2936 254
69 3300046471 Ga0495650_0009511 Ga0495650_0009511_3463_4230 254
70 3300050516 nmdc:mga0sz30_11074_c1 nmdc:mga0sz30_11074_c1_326_1093 254
71 3300053153 Ga0500616_0087969 Ga0500616_0087969_158_925 254
72 3300005327 Ga0070658_10007170 Ga0070658_100071706 255
73 3300005329 Ga0070683_100104825 Ga0070683_1001048253 255
74 3300005331 Ga0070670_100436195 Ga0070670_1004361952 255
75 3300005336 Ga0070680_100012109 Ga0070680_1000121094 255
76 3300005339 Ga0070660_100107853 Ga0070660_1001078532 255
77 3300005340 Ga0070689_100365288 Ga0070689_1003652882 255
78 3300005344 Ga0070661_100552075 Ga0070661_1005520751 255
79 3300005367 Ga0070667_100427933 Ga0070667_1004279332 255
80 3300005435 Ga0070714_100085934 Ga0070714_1000859342 255
81 3300005435 Ga0070714_100490115 Ga0070714_1004901152 255
82 3300005439 Ga0070711_100121746 Ga0070711_1001217462 255
83 3300005455 Ga0070663_100020404 Ga0070663_1000204045 255
84 3300005458 Ga0070681_10092343 Ga0070681_100923434 255
85 3300005458 Ga0070681_10211572 Ga0070681_102115722 255
86 3300005530 Ga0070679_100045095 Ga0070679_1000450952 255
87 3300005539 Ga0068853_100053301 Ga0068853_1000533014 255
88 3300005539 Ga0068853_100337435 Ga0068853_1003374351 255
89 3300005539 Ga0068853_100361784 Ga0068853_1003617842 255
90 3300005563 Ga0068855_100022934 Ga0068855_1000229343 255
91 3300005563 Ga0068855_100040604 Ga0068855_1000406044 255
92 3300005563 Ga0068855_100070068 Ga0068855_1000700682 255
93 3300005578 Ga0068854_100214792 Ga0068854_1002147922 255
94 3300005614 Ga0068856_100054584 Ga0068856_1000545842 255
95 3300005616 Ga0068852_100126266 Ga0068852_1001262662 255
96 3300005617 Ga0068859_100343287 Ga0068859_1003432872 255
97 3300005618 Ga0068864_100074386 Ga0068864_1000743863 255
98 3300005841 Ga0068863_100127511 Ga0068863_1001275113 255
99 3300005937 Ga0081455_10295874 Ga0081455_102958741 255
100 3300005985 Ga0081539_10014335 Ga0081539_100143352 255
101 3300006931 Ga0097620_100343278 Ga0097620_1003432782 255
102 3300009093 Ga0105240_10006964 Ga0105240_1000696412 255
103 3300009101 Ga0105247_10131640 Ga0105247_101316402 255
104 3300009174 Ga0105241_10239482 Ga0105241_102394822 255
105 3300009545 Ga0105237_10213933 Ga0105237_102139332 255
106 3300009551 Ga0105238_10073016 Ga0105238_100730163 255
107 3300013102 Ga0157371_10028113 Ga0157371_100281132 255
108 3300013102 Ga0157371_10232745 Ga0157371_102327452 255
109 3300013104 Ga0157370_10021005 Ga0157370_100210053 255
110 3300013105 Ga0157369_10379724 Ga0157369_103797242 255
111 3300013307 Ga0157372_10152984 Ga0157372_101529843 255
112 3300013308 Ga0157375_10060948 Ga0157375_100609484 255
113 3300014325 Ga0163163_10018121 Ga0163163_100181213 255
114 3300014325 Ga0163163_10388784 Ga0163163_103887842 255
115 3300025292 Ga0209676_1001163 Ga0209676_100116310 255
116 3300025297 Ga0209758_1000573 Ga0209758_100057347 255
117 3300025297 Ga0209758_1007293 Ga0209758_10072936 255
118 3300025303 Ga0209051_1002220 Ga0209051_100222010 255
119 3300025304 Ga0209257_1004548 Ga0209257_100454810 255
120 3300025898 Ga0207692_10138780 Ga0207692_101387801 255
121 3300025900 Ga0207710_10053302 Ga0207710_100533021 255
122 3300025912 Ga0207707_10110633 Ga0207707_101106332 255
123 3300025915 Ga0207693_10014192 Ga0207693_100141924 255
124 3300025915 Ga0207693_10065550 Ga0207693_100655503 255
125 3300025916 Ga0207663_10201584 Ga0207663_102015842 255
126 3300025917 Ga0207660_10049491 Ga0207660_100494912 255
127 3300025919 Ga0207657_10016310 Ga0207657_100163106 255
128 3300025920 Ga0207649_10359213 Ga0207649_103592132 255
129 3300025921 Ga0207652_10053776 Ga0207652_100537762 255
130 3300025921 Ga0207652_10067195 Ga0207652_100671954 255
131 3300025924 Ga0207694_10054220 Ga0207694_100542202 255
132 3300025925 Ga0207650_10333556 Ga0207650_103335562 255
133 3300025931 Ga0207644_10167739 Ga0207644_101677393 255
134 3300025935 Ga0207709_10232239 Ga0207709_102322392 255
135 3300025944 Ga0207661_10054790 Ga0207661_100547903 255
136 3300025944 Ga0207661_10139351 Ga0207661_101393512 255
137 3300025949 Ga0207667_10033003 Ga0207667_100330036 255
138 3300025949 Ga0207667_10050210 Ga0207667_100502103 255
139 3300025949 Ga0207667_10381449 Ga0207667_103814492 255
140 3300025986 Ga0207658_10064155 Ga0207658_100641552 255
141 3300026041 Ga0207639_10274409 Ga0207639_102744092 255
142 3300026067 Ga0207678_10030766 Ga0207678_100307665 255
143 3300026095 Ga0207676_10102461 Ga0207676_101024612 255
144 3300026116 Ga0207674_10167550 Ga0207674_101675502 255
145 3300026142 Ga0207698_10573144 Ga0207698_105731441 255
146 3300028380 Ga0268265_10542270 Ga0268265_105422702 255
147 3300028577 Ga0265318_10020279 Ga0265318_100202792 255
148 3300028786 Ga0307517_10000035 Ga0307517_10000035122 255
149 3300028800 Ga0265338_10235499 Ga0265338_102354992 255
150 3300028800 Ga0265338_10328285 Ga0265338_103282851 255
151 3300031235 Ga0265330_10017906 Ga0265330_100179063 255
152 3300031238 Ga0265332_10008376 Ga0265332_100083763 255
153 3300031238 Ga0265332_10055653 Ga0265332_100556532 255
154 3300031240 Ga0265320_10024485 Ga0265320_100244852 255
155 3300031241 Ga0265325_10011345 Ga0265325_100113452 255
156 3300031242 Ga0265329_10008281 Ga0265329_100082813 255
157 3300031242 Ga0265329_10015952 Ga0265329_100159523 255
158 3300031249 Ga0265339_10004516 Ga0265339_100045164 255
159 3300031249 Ga0265339_10105914 Ga0265339_101059142 255
160 3300031250 Ga0265331_10036680 Ga0265331_100366802 255
161 3300031250 Ga0265331_10079051 Ga0265331_100790512 255
162 3300031344 Ga0265316_10056839 Ga0265316_100568392 255
163 3300031344 Ga0265316_10286147 Ga0265316_102861472 255
164 3300031595 Ga0265313_10049696 Ga0265313_100496962 255
165 3300031711 Ga0265314_10052367 Ga0265314_100523673 255
166 3300031711 Ga0265314_10107454 Ga0265314_101074542 255
167 3300031712 Ga0265342_10001995 Ga0265342_1000199510 255
168 3300033547 Ga0316212_1023211 Ga0316212_10232111 255
169 3300039437 Ga0436365_0722300 Ga0436365_0722300_170_940 255
170 3300041408 Ga0439453_0002041 Ga0439453_0002041_429_1196 255
171 3300042003 Ga0439443_002271 Ga0439443_002271_559_1326 255
172 3300042436 Ga0439435_0009729 Ga0439435_0009729_670_1437 255
173 3300044694 Ga0466963_0133239 Ga0466963_0133239_792_1562 255
174 3300045976 Ga0466967_0286437 Ga0466967_0286437_403_1173 255
175 3300046462 Ga0495651_0171189 Ga0495651_0171189_293_1063 255
176 3300046678 Ga0495599_0242032 Ga0495599_0242032_25_795 255
177 3300046809 Ga0495600_0158083 Ga0495600_0158083_17_787 255
178 3300048909 Ga0496106_0000194 Ga0496106_0000194_14220_15029 255
179 3300048918 Ga0496115_0018878 Ga0496115_0018878_3673_4443 255
180 3300048922 Ga0496119_0075604 Ga0496119_0075604_161_931 255
181 3300048925 Ga0496122_0174011 Ga0496122_0174011_311_1081 255
182 3300048928 Ga0496125_0000756 Ga0496125_0000756_44450_45220 255
183 3300048928 Ga0496125_0003979 Ga0496125_0003979_1999_2769 255
184 3300048929 Ga0496126_0121306 Ga0496126_0121306_766_1536 255
185 3300049569 Ga0501032_0182395 Ga0501032_0182395_447_1220 255
186 3300049570 Ga0501033_0306974 Ga0501033_0306974_294_1064 255
187 3300049571 Ga0501034_0216393 Ga0501034_0216393_864_1637 255
188 3300049574 Ga0501038_0109394 Ga0501038_0109394_346_1119 255
189 3300049575 Ga0501039_0041299 Ga0501039_0041299_1644_2417 255
190 3300049582 Ga0501048_0152167 Ga0501048_0152167_852_1625 255
191 3300049585 Ga0501069_0142486 Ga0501069_0142486_256_1026 255
192 3300049587 Ga0501071_0163441 Ga0501071_0163441_389_1159 255
193 3300049588 Ga0501072_0138923 Ga0501072_0138923_344_1114 255
194 3300049589 Ga0501073_0124885 Ga0501073_0124885_184_957 255
195 3300049589 Ga0501073_0197476 Ga0501073_0197476_608_1378 255
196 3300049589 Ga0501073_0370097 Ga0501073_0370097_122_892 255
197 3300049741 Ga0501079_0221100 Ga0501079_0221100_104_874 255
198 3300049742 Ga0501080_0074331 Ga0501080_0074331_1852_2625 255
199 3300049822 Ga0501035_0000505 Ga0501035_0000505_30444_31214 255
200 3300049822 Ga0501035_0610513 Ga0501035_0610513_15_785 255
201 3300049823 Ga0501044_0528630 Ga0501044_0528630_224_997 255
202 3300050507 nmdc:mga05p37_1023982_c1 nmdc:mga05p37_1023982_c1_46_849 255
203 3300053139 Ga0500568_0000226 Ga0500568_0000226_9756_10565 255
204 3300053151 Ga0500604_0021492 Ga0500604_0021492_940_1749 255
205 3300053151 Ga0500604_0060880 Ga0500604_0060880_41_811 255
206 3300053156 Ga0500622_0048970 Ga0500622_0048970_835_1608 255
207 3300053160 Ga0500633_0013120 Ga0500633_0013120_206_1015 255
208 3300053177 Ga0500636_0004993 Ga0500636_0004993_2222_2995 255
209 3300060353 Ga0501082_0277532 Ga0501082_0277532_404_1177 255
210 3300003215 JGI25153J46596_10031835 JGI25153J46596_100318352 256
211 3300005327 Ga0070658_10099564 Ga0070658_100995642 256
212 3300005981 Ga0081538_10139419 Ga0081538_101394192 256
213 3300006038 Ga0075365_10006281 Ga0075365_100062814 256
214 3300006042 Ga0075368_10121815 Ga0075368_101218152 256
215 3300006051 Ga0075364_10005042 Ga0075364_100050428 256
216 3300006051 Ga0075364_10369779 Ga0075364_103697792 256
217 3300006178 Ga0075367_10003522 Ga0075367_100035225 256
218 3300006178 Ga0075367_10017733 Ga0075367_100177333 256
219 3300006186 Ga0075369_10005410 Ga0075369_100054104 256
220 3300006186 Ga0075369_10019366 Ga0075369_100193662 256
221 3300006195 Ga0075366_10016451 Ga0075366_100164513 256
222 3300021441 Ga0213871_10039588 Ga0213871_100395882 256
223 3300025261 Ga0209233_1005652 Ga0209233_10056525 256
224 3300025295 Ga0209564_1010219 Ga0209564_10102193 256
225 3300025297 Ga0209758_1002991 Ga0209758_100299116 256
226 3300026095 Ga0207676_10337097 Ga0207676_103370972 256
227 3300027866 Ga0209813_10079111 Ga0209813_100791112 256
228 3300035725 Ga0373947_0149693 Ga0373947_0149693_97_870 256
229 3300037068 Ga0373925_0132190 Ga0373925_0132190_709_1482 256
230 3300039437 Ga0436365_1178809 Ga0436365_1178809_796_1569 256
231 3300039438 Ga0436360_1007790 Ga0436360_1007790_13_786 256
232 3300039447 Ga0436361_0861024 Ga0436361_0861024_734_1507 256
233 3300039450 Ga0436363_0480585 Ga0436363_0480585_623_1396 256
234 3300042461 Ga0439460_0115182 Ga0439460_0115182_75_854 256
235 3300046460 Ga0495638_0000558 Ga0495638_0000558_32754_33527 256
236 3300046460 Ga0495638_0007155 Ga0495638_0007155_190_963 256
237 3300046460 Ga0495638_0038755 Ga0495638_0038755_1170_1943 256
238 3300046460 Ga0495638_0066229 Ga0495638_0066229_1077_1850 256
239 3300046462 Ga0495651_0338333 Ga0495651_0338333_19_792 256
240 3300046477 Ga0495664_0119529 Ga0495664_0119529_605_1378 256
241 3300046491 Ga0495584_0153864 Ga0495584_0153864_273_1046 256
242 3300046501 Ga0495607_0004389 Ga0495607_0004389_900_1673 256
243 3300046512 Ga0495610_0003810 Ga0495610_0003810_96_869 256
244 3300046513 Ga0495616_0072881 Ga0495616_0072881_446_1219 256
245 3300046516 Ga0495628_0185487 Ga0495628_0185487_588_1361 256
246 3300046517 Ga0495630_0299960 Ga0495630_0299960_57_830 256
247 3300046518 Ga0495631_0054203 Ga0495631_0054203_908_1681 256
248 3300046520 Ga0495637_0080324 Ga0495637_0080324_163_936 256
249 3300046522 Ga0495643_0015126 Ga0495643_0015126_2560_3333 256
250 3300046524 Ga0495648_0045114 Ga0495648_0045114_399_1172 256
251 3300046530 Ga0495654_0007875 Ga0495654_0007875_4627_5400 256
252 3300046533 Ga0495640_0043700 Ga0495640_0043700_389_1162 256
253 3300046615 Ga0495656_0063384 Ga0495656_0063384_563_1336 256
254 3300046616 Ga0495668_0062321 Ga0495668_0062321_1122_1895 256
255 3300046616 Ga0495668_0107919 Ga0495668_0107919_594_1367 256
256 3300046660 Ga0495625_0053796 Ga0495625_0053796_1209_1982 256
257 3300046689 Ga0495613_0256054 Ga0495613_0256054_132_905 256
258 3300047319 Ga0495674_0024736 Ga0495674_0024736_2322_3095 256
259 3300047322 Ga0495680_0168383 Ga0495680_0168383_117_890 256
260 3300047323 Ga0495683_0114870 Ga0495683_0114870_39_812 256
261 3300047472 Ga0495686_0006696 Ga0495686_0006696_5046_5819 256
262 3300048904 Ga0496101_0145762 Ga0496101_0145762_594_1379 256
263 3300048907 Ga0496104_0000538 Ga0496104_0000538_28398_29183 256
264 3300048907 Ga0496104_0001834 Ga0496104_0001834_681_1454 256
265 3300048908 Ga0496105_0020622 Ga0496105_0020622_3915_4700 256
266 3300048908 Ga0496105_0402926 Ga0496105_0402926_90_863 256
267 3300048913 Ga0496110_0393594 Ga0496110_0393594_127_900 256
268 3300048915 Ga0496112_0020633 Ga0496112_0020633_3621_4394 256
269 3300048918 Ga0496115_0286812 Ga0496115_0286812_402_1187 256
270 3300048919 Ga0496116_0003806 Ga0496116_0003806_2263_3036 256
271 3300048920 Ga0496117_0002577 Ga0496117_0002577_16680_17453 256
272 3300048920 Ga0496117_0017448 Ga0496117_0017448_2280_3053 256
273 3300048921 Ga0496118_0007352 Ga0496118_0007352_5218_5991 256
274 3300048921 Ga0496118_0024724 Ga0496118_0024724_1063_1836 256
275 3300048923 Ga0496120_0026304 Ga0496120_0026304_2101_2874 256
276 3300048923 Ga0496120_0111725 Ga0496120_0111725_504_1277 256
277 3300048924 Ga0496121_0000643 Ga0496121_0000643_52238_53011 256
278 3300048924 Ga0496121_0004299 Ga0496121_0004299_15174_15947 256
279 3300048926 Ga0496123_0002639 Ga0496123_0002639_8102_8875 256
280 3300048927 Ga0496124_0167774 Ga0496124_0167774_499_1272 256
281 3300048928 Ga0496125_0001227 Ga0496125_0001227_2387_3160 256
282 3300048928 Ga0496125_0114071 Ga0496125_0114071_516_1289 256
283 3300048929 Ga0496126_0027842 Ga0496126_0027842_2504_3277 256
284 3300048929 Ga0496126_0147063 Ga0496126_0147063_792_1565 256
285 3300048929 Ga0496126_0202942 Ga0496126_0202942_141_914 256
286 3300049568 Ga0501031_0104460 Ga0501031_0104460_375_1148 256
287 3300049571 Ga0501034_0182058 Ga0501034_0182058_67_840 256
288 3300049571 Ga0501034_0350998 Ga0501034_0350998_38_811 256
289 3300049574 Ga0501038_0060996 Ga0501038_0060996_466_1239 256
290 3300049576 Ga0501040_0261779 Ga0501040_0261779_144_917 256
291 3300049578 Ga0501042_0062628 Ga0501042_0062628_794_1567 256
292 3300049585 Ga0501069_0100849 Ga0501069_0100849_263_1036 256
293 3300049588 Ga0501072_0163681 Ga0501072_0163681_650_1423 256
294 3300049588 Ga0501072_0301973 Ga0501072_0301973_101_874 256
295 3300049591 Ga0501075_0148463 Ga0501075_0148463_75_848 256
296 3300049593 Ga0501077_0253120 Ga0501077_0253120_178_951 256
297 3300049744 Ga0501083_0007960 Ga0501083_0007960_1955_2728 256
298 3300049744 Ga0501083_0271227 Ga0501083_0271227_195_986 256
299 3300049823 Ga0501044_0097953 Ga0501044_0097953_1375_2148 256
300 3300050491 nmdc:mga00v17_25686_c1 nmdc:mga00v17_25686_c1_2110_2883 256
301 3300050491 nmdc:mga00v17_297766_c1 nmdc:mga00v17_297766_c1_19_792 256
302 3300050492 nmdc:mga0yw44_10260_c1 nmdc:mga0yw44_10260_c1_2110_2883 256
303 3300050494 nmdc:mga06z11_129662_c1 nmdc:mga06z11_129662_c1_595_1368 256
304 3300050494 nmdc:mga06z11_2892_c1 nmdc:mga06z11_2892_c1_3016_3789 256
305 3300050495 nmdc:mga04h51_101835_c1 nmdc:mga04h51_101835_c1_13_786 256
306 3300050495 nmdc:mga04h51_86994_c1 nmdc:mga04h51_86994_c1_94_867 256
307 3300050496 nmdc:mga07m45_305810_c1 nmdc:mga07m45_305810_c1_26_799 256
308 3300053077 Ga0495601_0005106 Ga0495601_0005106_6818_7591 256
309 3300053077 Ga0495601_0035381 Ga0495601_0035381_838_1611 256
310 3300053078 Ga0495612_0016750 Ga0495612_0016750_2093_2866 256
311 3300053084 Ga0495595_0013025 Ga0495595_0013025_1742_2515 256
312 3300053085 Ga0495619_0047955 Ga0495619_0047955_959_1732 256
313 3300053086 Ga0500578_0059891 Ga0500578_0059891_744_1517 256
314 3300053087 Ga0500643_002411 Ga0500643_002411_2301_3074 256
315 3300053088 Ga0500644_0009081 Ga0500644_0009081_1216_1989 256
316 3300053093 Ga0500651_0018522 Ga0500651_0018522_1365_2138 256
317 3300053096 Ga0500641_0006226 Ga0500641_0006226_2525_3298 256
318 3300053096 Ga0500641_0015301 Ga0500641_0015301_466_1239 256
319 3300053098 Ga0500650_0000159 Ga0500650_0000159_1176_1949 256
320 3300053098 Ga0500650_0171482 Ga0500650_0171482_16_789 256
321 3300053104 Ga0500556_0000003 Ga0500556_0000003_457240_458013 256
322 3300053108 Ga0500562_027051 Ga0500562_027051_201_974 256
323 3300053109 Ga0500569_017418 Ga0500569_017418_356_1129 256
324 3300053119 Ga0500595_003585 Ga0500595_003585_2385_3155 256
325 3300053119 Ga0500595_003700 Ga0500595_003700_2987_3760 256
326 3300053119 Ga0500595_008393 Ga0500595_008393_255_1028 256
327 3300053130 Ga0500642_0020105 Ga0500642_0020105_1197_1970 256
328 3300053131 Ga0500652_000051 Ga0500652_000051_747_1520 256
329 3300053134 Ga0500658_0011637 Ga0500658_0011637_1104_1877 256
330 3300053139 Ga0500568_0001594 Ga0500568_0001594_9341_10114 256
331 3300053151 Ga0500604_0000208 Ga0500604_0000208_6600_7373 256
332 3300053153 Ga0500616_0000114 Ga0500616_0000114_52016_52789 256
333 3300053158 Ga0500627_0026806 Ga0500627_0026806_1262_2035 256
334 3300053160 Ga0500633_0012571 Ga0500633_0012571_571_1344 256
335 3300053177 Ga0500636_0089722 Ga0500636_0089722_129_902 256
336 3300053730 Ga0500645_055606 Ga0500645_055606_70_843 256
337 3300060353 Ga0501082_0054902 Ga0501082_0054902_2505_3278 256
338 3300061734 Ga0530510_0074951 Ga0530510_0074951_151_924 256
339 3300061734 Ga0530510_0460271 Ga0530510_0460271_61_834 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

240

265

0.95

PF00005

ABC_tran

ABC transporter

31

192

0.91

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

92

227

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.9271 1 249
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.9249 3 249
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9229 3 237
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9215 3 247
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9212 3 237
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.971 1 249 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 1 249 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 2 238 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9319 2 233 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9248 2 238 3.40.50.300
ID Description Score Start End GO Terms
AF-F3NR75-F1-model_v4 Putative branched-chain amino acid ABC transporter ATP-binding protein 0.9686 2 249 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A5C9B0E5-F1-model_v4 deleted 0.9644 2 223
AF-A0A0F2NA46-F1-model_v4 ABC transporter 0.9643 3 249 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C3YY79-F1-model_v4 ABC transporter ATP-binding protein 0.9616 2 252 GO:0005524
GO:0005886
GO:0016887
AF-A0A1F9D4K1-F1-model_v4 ABC transporter ATP-binding protein 0.9616 3 249 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map