F414030

General Info

Members Datasets Scaffolds Average Seq Length
339 146 678 151

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0962264|Ga0453684_0962264_228_785
Length 185
Sequence VARFGVLGQAQTYPPQIKSFYGKSWKLNNLFLEAKVEHSLVLVKPDGVQRGLVGEVIARLERRGLRLVGAKFLQVSQSLAEEHYAIHNGKPFYDGLIADITSGPVMAMVWEGPNAIAAIRQTMGATRPWEAAPGTIRHDFALEVGRNLTHASDSPENGEKESALWFKKEEVVTWSRDVDRWIFEK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
95 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 33.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0962264 3300044712 Bacteria 910
2 SwRhRL2b_contig_2936518 2162886007 Bacteria 6653
3 SwRhRL2b_contig_967995 2162886007 Bacteria 2673
4 JGI25406J46586_10008220 3300003203 Bacteria 4735
5 rootH2_10213621 3300003320 Bacteria 1340
6 rootH1_10300625 3300003323 Bacteria 2246
7 Ga0065704_10000294 3300005289 Bacteria 47445
8 Ga0065707_10000503 3300005295 Bacteria 28730
9 Ga0065707_10087080 3300005295 Bacteria 5158
10 Ga0065707_10087921 3300005295 Unclassified 4842
11 Ga0065707_10105608 3300005295 Bacteria 2636
12 Ga0065707_10233617 3300005295 Bacteria 1180
13 Ga0065707_10926269 3300005295 Bacteria 559
14 Ga0070683_101670115 3300005329 Bacteria 612
15 Ga0070689_100140104 3300005340 Unclassified 1945
16 Ga0070689_101286673 3300005340 Bacteria 658
17 Ga0070673_100148708 3300005364 Unclassified 1982
18 Ga0070709_10307555 3300005434 Unclassified 1159
19 Ga0070713_100398686 3300005436 Unclassified 1285
20 Ga0070710_10740092 3300005437 Unclassified 697
21 Ga0070705_100015469 3300005440 Bacteria 3947
22 Ga0070700_100071256 3300005441 Bacteria 2218
23 Ga0070700_100184793 3300005441 Unclassified 1453
24 Ga0070694_100137902 3300005444 Bacteria 1769
25 Ga0070694_100159714 3300005444 Bacteria 1653
26 Ga0070694_100634431 3300005444 Bacteria 863
27 Ga0070694_101466046 3300005444 Unclassified 577
28 Ga0070708_100032445 3300005445 Bacteria 4531
29 Ga0070706_100078564 3300005467 Unclassified 3055
30 Ga0070707_100056943 3300005468 Bacteria 3750
31 Ga0070707_102086131 3300005468 Unclassified 534
32 Ga0070698_100001683 3300005471 Bacteria 24667
33 Ga0070698_100050544 3300005471 Unclassified 4237
34 Ga0070698_100226511 3300005471 Bacteria 1803
35 Ga0070698_100530755 3300005471 Unclassified 1115
36 Ga0070699_100005511 3300005518 Bacteria 11090
37 Ga0070699_100006793 3300005518 Bacteria 9955
38 Ga0070699_100184776 3300005518 Unclassified 1851
39 Ga0070699_100211196 3300005518 Bacteria 1728
40 Ga0070699_100302356 3300005518 Bacteria 1435
41 Ga0070699_100482680 3300005518 Bacteria 1125
42 Ga0070697_100105557 3300005536 Bacteria 2343
43 Ga0070697_100139567 3300005536 Bacteria 2037
44 Ga0070696_100423311 3300005546 Bacteria 1046
45 Ga0070704_100018802 3300005549 Bacteria 4428
46 Ga0070704_100799822 3300005549 Unclassified 842
47 Ga0070704_101183578 3300005549 Unclassified 696
48 Ga0070702_100448080 3300005615 Unclassified 936
49 Ga0068859_100118535 3300005617 Bacteria 2712
50 Ga0068859_100438468 3300005617 Bacteria 1402
51 Ga0068864_100206963 3300005618 Archaea 1805
52 Ga0068861_100034522 3300005719 Unclassified 3741
53 Ga0068861_100659869 3300005719 Bacteria 967
54 Ga0068870_11242911 3300005840 Unclassified 541
55 Ga0068858_100556046 3300005842 Bacteria 1111
56 Ga0068862_100024920 3300005844 Bacteria 5020
57 Ga0081539_10002974 3300005985 Bacteria 22229
58 Ga0081539_10003149 3300005985 Bacteria 20948
59 Ga0081539_10033907 3300005985 Bacteria 3099
60 Ga0070717_10096340 3300006028 Bacteria 2506
61 Ga0070717_10535622 3300006028 Bacteria 1060
62 Ga0075428_100044777 3300006844 Unclassified 4862
63 Ga0075428_101285881 3300006844 Bacteria 770
64 Ga0075430_100080659 3300006846 Bacteria 2726
65 Ga0075431_100143926 3300006847 Bacteria 2457
66 Ga0075431_100289861 3300006847 Bacteria 1656
67 Ga0075431_100583430 3300006847 Bacteria 1103
68 Ga0075431_101613978 3300006847 Unclassified 606
69 Ga0075433_10022155 3300006852 Bacteria 5333
70 Ga0075433_10654988 3300006852 Bacteria 921
71 Ga0075429_100008042 3300006880 Bacteria 9166
72 Ga0075429_100008593 3300006880 Bacteria 8883
73 Ga0075429_100074970 3300006880 Bacteria 2947
74 Ga0075429_100092382 3300006880 Bacteria 2639
75 Ga0097620_100118538 3300006931 Bacteria 2712
76 Ga0097620_100438479 3300006931 Bacteria 1402
77 Ga0097620_101759948 3300006931 Bacteria 684
78 Ga0111539_10027445 3300009094 Bacteria 6955
79 Ga0111539_10745786 3300009094 Unclassified 1140
80 Ga0105247_10148413 3300009101 Bacteria 1543
81 Ga0114129_10000808 3300009147 Bacteria 40249
82 Ga0114129_10012378 3300009147 Bacteria 12144
83 Ga0114129_10061809 3300009147 Bacteria 5234
84 Ga0114129_10076056 3300009147 Unclassified 4674
85 Ga0114129_10341018 3300009147 Unclassified 1988
86 Ga0114129_11080721 3300009147 Bacteria 1005
87 Ga0105243_10096717 3300009148 Bacteria 2443
88 Ga0105243_10841545 3300009148 Unclassified 908
89 Ga0105243_11386605 3300009148 Bacteria 723
90 Ga0105238_10000409 3300009551 Bacteria 45597
91 Ga0105249_10059200 3300009553 Unclassified 3513
92 Ga0105249_10061289 3300009553 Bacteria 3452
93 Ga0105249_11481603 3300009553 Unclassified 751
94 Ga0105246_10004946 3300011119 Bacteria 8112
95 Ga0163163_10661180 3300014325 Unclassified 1108
96 Ga0157380_10101142 3300014326 Unclassified 2401
97 Ga0157380_10212110 3300014326 Bacteria 1726
98 Ga0157380_10441877 3300014326 Unclassified 1247
99 Ga0157380_12475732 3300014326 Unclassified 585
100 Ga0206349_1315609 3300020075 Bacteria 7465
101 Ga0206351_10709822 3300020077 Viruses 1007
102 Ga0206352_10359197 3300020078 Bacteria 7346
103 Ga0206350_10808866 3300020080 Bacteria 7413
104 Ga0213874_10000583 3300021377 Bacteria 7322
105 Ga0213874_10001283 3300021377 Bacteria 5200
106 Ga0213876_10701367 3300021384 Unclassified 538
107 Ga0224712_10015342 3300022467 Unclassified 2491
108 Ga0207653_10017443 3300025885 Bacteria 2260
109 Ga0207684_10369918 3300025910 Unclassified 1233
110 Ga0207660_10634116 3300025917 Unclassified 871
111 Ga0207646_10006028 3300025922 Bacteria 12627
112 Ga0207646_10293327 3300025922 Unclassified 1469
113 Ga0207646_11012783 3300025922 Unclassified 734
114 Ga0207694_10000228 3300025924 Bacteria 54410
115 Ga0207700_10394098 3300025928 Unclassified 1213
116 Ga0207709_10030300 3300025935 Bacteria 3146
117 Ga0207670_10104592 3300025936 Bacteria 2028
118 Ga0207651_10152698 3300025960 Unclassified 1800
119 Ga0207712_10085466 3300025961 Bacteria 2309
120 Ga0207712_10689540 3300025961 Unclassified 891
121 Ga0207708_10128941 3300026075 Unclassified 1976
122 Ga0207708_10920215 3300026075 Unclassified 757
123 Ga0207676_11297283 3300026095 Archaea 723
124 Ga0207674_11504261 3300026116 Unclassified 642
125 Ga0207675_100238479 3300026118 Unclassified 1757
126 Ga0207428_10193533 3300027907 Bacteria 1532
127 Ga0268265_10065697 3300028380 Bacteria 2801
128 Ga0268265_10351987 3300028380 Bacteria 1345
129 Ga0268265_12062547 3300028380 Bacteria 577
130 Ga0268264_12427197 3300028381 Unclassified 530
131 Ga0265318_10009676 3300028577 Bacteria 4229
132 Ga0265318_10204727 3300028577 Bacteria 721
133 Ga0265323_10177117 3300028653 Bacteria 676
134 Ga0265338_11082029 3300028800 Bacteria 540
135 Ga0265324_10050516 3300029957 Bacteria 1429
136 Ga0265330_10128912 3300031235 Archaea 1077
137 Ga0265328_10054658 3300031239 Archaea 1465
138 Ga0265320_10026928 3300031240 Bacteria 3004
139 Ga0265320_10046963 3300031240 Archaea 2113
140 Ga0265329_10195986 3300031242 Unclassified 664
141 Ga0265340_10015788 3300031247 Unclassified 3918
142 Ga0265340_10296920 3300031247 Bacteria 717
143 Ga0265331_10016736 3300031250 Unclassified 3843
144 Ga0307408_100353995 3300031548 Bacteria 1247
145 Ga0316575_10047405 3300031665 Unclassified 1708
146 Ga0316575_10049749 3300031665 Bacteria 1668
147 Ga0316575_10511369 3300031665 Unclassified 522
148 Ga0316579_10027836 3300031691 Unclassified 2569
149 Ga0316579_10036415 3300031691 Unclassified 2270
150 Ga0316576_10137751 3300031727 Bacteria 1837
151 Ga0316576_10272219 3300031727 Bacteria 1269
152 Ga0316576_10425170 3300031727 Bacteria 983
153 Ga0316578_10102057 3300031728 Bacteria 1720
154 Ga0316578_10219689 3300031728 Unclassified 1142
155 Ga0316578_10226221 3300031728 Bacteria 1124
156 Ga0316578_10293190 3300031728 Unclassified 973
157 Ga0316578_10611577 3300031728 Unclassified 638
158 Ga0316577_10003761 3300031733 Bacteria 7724
159 Ga0316577_10004436 3300031733 Bacteria 7243
160 Ga0316577_10041310 3300031733 Bacteria 2580
161 Ga0307413_10286677 3300031824 Unclassified 1241
162 Ga0307407_10050692 3300031903 Unclassified 2376
163 Ga0307407_10927660 3300031903 Unclassified 669
164 Ga0307409_100064390 3300031995 Bacteria 2880
165 Ga0307416_100525843 3300032002 Bacteria 1252
166 Ga0307416_102102047 3300032002 Archaea 667
167 Ga0307415_100490342 3300032126 Bacteria 1072
168 Ga0316585_10097717 3300032137 Unclassified 962
169 Ga0316585_10152068 3300032137 Unclassified 764
170 Ga0316596_1093290 3300033541 Unclassified 812
171 Ga0316596_1219641 3300033541 Bacteria 532
172 Ga0373928_0055346 3300035084 Bacteria 947
173 Ga0316574_0017776 3300035398 Unclassified 4168
174 Ga0316574_0031011 3300035398 Unclassified 3241
175 Ga0316574_0067827 3300035398 Unclassified 2249
176 Ga0373933_0246682 3300035724 Bacteria 1149
177 Ga0316582_0030636 3300036647 Bacteria 3279
178 Ga0316582_0065626 3300036647 Unclassified 2337
179 Ga0316582_0133771 3300036647 Unclassified 1668
180 Ga0316582_0278275 3300036647 Unclassified 1148
181 Ga0316582_0740851 3300036647 Unclassified 674
182 Ga0316582_0850368 3300036647 Unclassified 625
183 Ga0316582_0968222 3300036647 Unclassified 581
184 Ga0316584_0001774 3300036712 Bacteria 13279
185 Ga0316584_0016599 3300036712 Bacteria 5280
186 Ga0316584_0081322 3300036712 Unclassified 2426
187 Ga0316584_0084315 3300036712 Bacteria 2380
188 Ga0316584_0168756 3300036712 Bacteria 1624
189 Ga0316584_0290794 3300036712 Unclassified 1185
190 Ga0316584_0308608 3300036712 Unclassified 1144
191 Ga0316584_0312893 3300036712 Bacteria 1135
192 Ga0316584_0402218 3300036712 Unclassified 975
193 Ga0316584_0517956 3300036712 Unclassified 836
194 Ga0316581_0038080 3300037588 Bacteria 1462
195 Ga0316581_0099747 3300037588 Unclassified 894
196 Ga0316581_0144971 3300037588 Unclassified 732
197 Ga0436365_0729732 3300039437 Bacteria 2057
198 Ga0436363_0581981 3300039450 Bacteria 17398
199 Ga0436363_0862917 3300039450 Bacteria 21835
200 Ga0436363_1253050 3300039450 Bacteria 12479
201 Ga0436362_0617045 3300039453 Unclassified 3772
202 Ga0439433_0042325 3300041999 Unclassified 1062
203 Ga0451577_0004261 3300042876 Bacteria 15215
204 Ga0451577_0008585 3300042876 Bacteria 9933
205 Ga0451577_0062402 3300042876 Bacteria 3324
206 Ga0451577_0109875 3300042876 Unclassified 2466
207 Ga0451577_0237150 3300042876 Bacteria 1650
208 Ga0451577_0328254 3300042876 Bacteria 1388
209 Ga0451577_0620794 3300042876 Bacteria 981
210 Ga0451577_1252807 3300042876 Bacteria 661
211 Ga0451577_1257437 3300042876 Bacteria 659
212 Ga0451577_1600598 3300042876 Bacteria 575
213 Ga0451577_1613775 3300042876 Unclassified 572
214 Ga0466969_0000163 3300044656 Bacteria 36233
215 Ga0466969_0058449 3300044656 Bacteria 1877
216 Ga0466972_0124586 3300044658 Unclassified 1214
217 Ga0453683_0001884 3300044673 Bacteria 17187
218 Ga0453683_0011995 3300044673 Bacteria 5692
219 Ga0453683_0033464 3300044673 Bacteria 3241
220 Ga0453683_0039800 3300044673 Unclassified 2953
221 Ga0453683_0043070 3300044673 Bacteria 2833
222 Ga0453683_0053962 3300044673 Bacteria 2515
223 Ga0453683_0077370 3300044673 Unclassified 2083
224 Ga0453683_0219756 3300044673 Bacteria 1208
225 Ga0453683_0348605 3300044673 Unclassified 951
226 Ga0466965_0235259 3300044683 Bacteria 979
227 Ga0466966_0000603 3300044684 Bacteria 22756
228 Ga0466966_0020763 3300044684 Bacteria 4317
229 Ga0466961_0049570 3300044693 Bacteria 2683
230 Ga0466963_0307672 3300044694 Unclassified 1115
231 Ga0466964_0000372 3300044706 Bacteria 13578
232 Ga0453684_0000095 3300044712 Bacteria 378681
233 Ga0453684_0000106 3300044712 Bacteria 364365
234 Ga0453684_0000640 3300044712 Bacteria 126342
235 Ga0453684_0001556 3300044712 Bacteria 64039
236 Ga0453684_0007888 3300044712 Bacteria 19338
237 Ga0453684_0014142 3300044712 Bacteria 12824
238 Ga0453684_0018903 3300044712 Bacteria 10539
239 Ga0453684_0024799 3300044712 Bacteria 8741
240 Ga0453684_0036111 3300044712 Bacteria 6816
241 Ga0453684_0039107 3300044712 Bacteria 6470
242 Ga0453684_0041581 3300044712 Bacteria 6213
243 Ga0453684_0058000 3300044712 Bacteria 5004
244 Ga0453684_0058584 3300044712 Bacteria 4973
245 Ga0453684_0135672 3300044712 Bacteria 2947
246 Ga0453684_0142455 3300044712 Unclassified 2860
247 Ga0453684_0165222 3300044712 Bacteria 2613
248 Ga0453684_0166618 3300044712 Bacteria 2600
249 Ga0453684_0170459 3300044712 Bacteria 2565
250 Ga0453684_0246535 3300044712 Bacteria 2054
251 Ga0453684_0265511 3300044712 Unclassified 1964
252 Ga0453684_0287930 3300044712 Unclassified 1871
253 Ga0453684_0290567 3300044712 Bacteria 1862
254 Ga0453684_0304256 3300044712 Bacteria 1811
255 Ga0453684_0309954 3300044712 Bacteria 1791
256 Ga0453684_0338200 3300044712 Bacteria 1700
257 Ga0453684_0358859 3300044712 Bacteria 1641
258 Ga0453684_0384676 3300044712 Bacteria 1575
259 Ga0453684_0421614 3300044712 Unclassified 1490
260 Ga0453684_0452627 3300044712 Bacteria 1429
261 Ga0453684_0487667 3300044712 Bacteria 1367
262 Ga0453684_0491942 3300044712 Unclassified 1359
263 Ga0453684_0524121 3300044712 Unclassified 1309
264 Ga0453684_0591546 3300044712 Bacteria 1217
265 Ga0453684_0615031 3300044712 Unclassified 1189
266 Ga0453684_0705932 3300044712 Unclassified 1096
267 Ga0453684_0759686 3300044712 Bacteria 1049
268 Ga0453684_0819138 3300044712 Bacteria 1003
269 Ga0453684_0866969 3300044712 Unclassified 969
270 Ga0453684_1299611 3300044712 Unclassified 759
271 Ga0453684_1477412 3300044712 Bacteria 702
272 Ga0453684_1626764 3300044712 Bacteria 662
273 Ga0466971_0041154 3300044719 Bacteria 2075
274 Ga0466968_0000004 3300044735 Bacteria 83927
275 Ga0466970_0000269 3300044765 Bacteria 25428
276 Ga0466957_0236890 3300044842 Bacteria 1210
277 Ga0466957_0589818 3300044842 Unclassified 777
278 Ga0466959_0011931 3300045049 Bacteria 6264
279 Ga0466959_0015073 3300045049 Bacteria 5631
280 Ga0466959_0114716 3300045049 Bacteria 1919
281 Ga0466959_0518539 3300045049 Bacteria 805
282 Ga0451576_0000454 3300045051 Bacteria 93047
283 Ga0451576_0003853 3300045051 Bacteria 20127
284 Ga0451576_0034965 3300045051 Bacteria 5333
285 Ga0451576_0053610 3300045051 Bacteria 4223
286 Ga0451576_0071985 3300045051 Bacteria 3598
287 Ga0451576_0074231 3300045051 Bacteria 3539
288 Ga0451576_0995899 3300045051 Bacteria 878
289 Ga0466958_0074059 3300045836 Bacteria 2086
290 Ga0466967_0550296 3300045976 Unclassified 1136
291 Ga0501031_0131172 3300049568 Archaea 1637
292 Ga0501037_0004540 3300049573 Bacteria 10094
293 Ga0501040_0000037 3300049576 Archaea 60035
294 Ga0501046_0344909 3300049580 Bacteria 1082
295 Ga0501047_0048166 3300049581 Unclassified 4116
296 Ga0501071_0848447 3300049587 Unclassified 704
297 Ga0501071_1015627 3300049587 Unclassified 641
298 Ga0501073_0085401 3300049589 Bacteria 2196
299 Ga0501073_0160310 3300049589 Bacteria 1559
300 Ga0501075_0607840 3300049591 Unclassified 834
301 Ga0501075_0904459 3300049591 Unclassified 671
302 Ga0501076_0195089 3300049592 Bacteria 1653
303 Ga0501076_0275219 3300049592 Bacteria 1379
304 Ga0501079_0472166 3300049741 Unclassified 986
305 Ga0501080_0369664 3300049742 Bacteria 1293
306 Ga0501080_1647618 3300049742 Unclassified 542
307 Ga0501081_0344511 3300049743 Unclassified 1098
308 Ga0501044_0001884 3300049823 Bacteria 24300
309 Ga0501045_0261130 3300049824 Bacteria 1289
310 Ga0501045_0594097 3300049824 Bacteria 820
311 Ga0501045_1050364 3300049824 Bacteria 597
312 nmdc:mga05p37_120648_c1 3300050507 Bacteria 3221
313 nmdc:mga05p37_16261_c1 3300050507 Bacteria 8958
314 nmdc:mga05p37_23530_c1 3300050507 Bacteria 7475
315 nmdc:mga05p37_422163_c1 3300050507 Bacteria 1552
316 nmdc:mga05p37_43702_c1 3300050507 Bacteria 5513
317 nmdc:mga05p37_661_c1 3300050507 Bacteria 38042
318 nmdc:mga05p37_886496_c1 3300050507 Bacteria 964
319 nmdc:mga09592_1463698_c1 3300050508 Bacteria 557
320 nmdc:mga09592_361141_c1 3300050508 Bacteria 1257
321 nmdc:mga09592_383776_c1 3300050508 Bacteria 1215
322 nmdc:mga09592_46429_c1 3300050508 Unclassified 3659
323 nmdc:mga09592_49000_c1 3300050508 Unclassified 3562
324 nmdc:mga09592_5873_c1 3300050508 Bacteria 10018
325 nmdc:mga0qj67_358318_c1 3300050509 Bacteria 1179
326 nmdc:mga06r32_146764_c1 3300050510 Unclassified 2336
327 nmdc:mga06r32_3507_c1 3300050510 Bacteria 14004
328 nmdc:mga06r32_48420_c1 3300050510 Bacteria 4062
329 nmdc:mga06r32_508057_c1 3300050510 Unclassified 1182
330 nmdc:mga08y16_76033_c1 3300050511 Bacteria 3500
331 nmdc:mga0a205_19140_c1 3300050515 Bacteria 6453
332 nmdc:mga0a205_240752_c1 3300050515 Bacteria 1690
333 nmdc:mga0a205_401527_c1 3300050515 Bacteria 1234
334 Ga0500637_0249838 3300053178 Bacteria 990
335 Ga0501084_0001985 3300054114 Bacteria 16338
336 Ga0501082_0521424 3300060353 Bacteria 1039
337 Ga0501082_1316522 3300060353 Unclassified 631
338 Ga0501082_1752393 3300060353 Unclassified 542
339 Ga0530510_0424383 3300061734 Unclassified 1004
340 Ga0453684_0962264
341 SwRhRL2b_contig_2936518
342 SwRhRL2b_contig_967995
343 JGI25406J46586_10008220
344 rootH2_10213621
345 rootH1_10300625
346 Ga0065704_10000294
347 Ga0065707_10000503
348 Ga0065707_10087080
349 Ga0065707_10087921
350 Ga0065707_10105608
351 Ga0065707_10233617
352 Ga0065707_10926269
353 Ga0070683_101670115
354 Ga0070689_100140104
355 Ga0070689_101286673
356 Ga0070673_100148708
357 Ga0070709_10307555
358 Ga0070713_100398686
359 Ga0070710_10740092
360 Ga0070705_100015469
361 Ga0070700_100071256
362 Ga0070700_100184793
363 Ga0070694_100137902
364 Ga0070694_100159714
365 Ga0070694_100634431
366 Ga0070694_101466046
367 Ga0070708_100032445
368 Ga0070706_100078564
369 Ga0070707_100056943
370 Ga0070707_102086131
371 Ga0070698_100001683
372 Ga0070698_100050544
373 Ga0070698_100226511
374 Ga0070698_100530755
375 Ga0070699_100005511
376 Ga0070699_100006793
377 Ga0070699_100184776
378 Ga0070699_100211196
379 Ga0070699_100302356
380 Ga0070699_100482680
381 Ga0070697_100105557
382 Ga0070697_100139567
383 Ga0070696_100423311
384 Ga0070704_100018802
385 Ga0070704_100799822
386 Ga0070704_101183578
387 Ga0070702_100448080
388 Ga0068859_100118535
389 Ga0068859_100438468
390 Ga0068864_100206963
391 Ga0068861_100034522
392 Ga0068861_100659869
393 Ga0068870_11242911
394 Ga0068858_100556046
395 Ga0068862_100024920
396 Ga0081539_10002974
397 Ga0081539_10003149
398 Ga0081539_10033907
399 Ga0070717_10096340
400 Ga0070717_10535622
401 Ga0075428_100044777
402 Ga0075428_101285881
403 Ga0075430_100080659
404 Ga0075431_100143926
405 Ga0075431_100289861
406 Ga0075431_100583430
407 Ga0075431_101613978
408 Ga0075433_10022155
409 Ga0075433_10654988
410 Ga0075429_100008042
411 Ga0075429_100008593
412 Ga0075429_100074970
413 Ga0075429_100092382
414 Ga0097620_100118538
415 Ga0097620_100438479
416 Ga0097620_101759948
417 Ga0111539_10027445
418 Ga0111539_10745786
419 Ga0105247_10148413
420 Ga0114129_10000808
421 Ga0114129_10012378
422 Ga0114129_10061809
423 Ga0114129_10076056
424 Ga0114129_10341018
425 Ga0114129_11080721
426 Ga0105243_10096717
427 Ga0105243_10841545
428 Ga0105243_11386605
429 Ga0105238_10000409
430 Ga0105249_10059200
431 Ga0105249_10061289
432 Ga0105249_11481603
433 Ga0105246_10004946
434 Ga0163163_10661180
435 Ga0157380_10101142
436 Ga0157380_10212110
437 Ga0157380_10441877
438 Ga0157380_12475732
439 Ga0206349_1315609
440 Ga0206351_10709822
441 Ga0206352_10359197
442 Ga0206350_10808866
443 Ga0213874_10000583
444 Ga0213874_10001283
445 Ga0213876_10701367
446 Ga0224712_10015342
447 Ga0207653_10017443
448 Ga0207684_10369918
449 Ga0207660_10634116
450 Ga0207646_10006028
451 Ga0207646_10293327
452 Ga0207646_11012783
453 Ga0207694_10000228
454 Ga0207700_10394098
455 Ga0207709_10030300
456 Ga0207670_10104592
457 Ga0207651_10152698
458 Ga0207712_10085466
459 Ga0207712_10689540
460 Ga0207708_10128941
461 Ga0207708_10920215
462 Ga0207676_11297283
463 Ga0207674_11504261
464 Ga0207675_100238479
465 Ga0207428_10193533
466 Ga0268265_10065697
467 Ga0268265_10351987
468 Ga0268265_12062547
469 Ga0268264_12427197
470 Ga0265318_10009676
471 Ga0265318_10204727
472 Ga0265323_10177117
473 Ga0265338_11082029
474 Ga0265324_10050516
475 Ga0265330_10128912
476 Ga0265328_10054658
477 Ga0265320_10026928
478 Ga0265320_10046963
479 Ga0265329_10195986
480 Ga0265340_10015788
481 Ga0265340_10296920
482 Ga0265331_10016736
483 Ga0307408_100353995
484 Ga0316575_10047405
485 Ga0316575_10049749
486 Ga0316575_10511369
487 Ga0316579_10027836
488 Ga0316579_10036415
489 Ga0316576_10137751
490 Ga0316576_10272219
491 Ga0316576_10425170
492 Ga0316578_10102057
493 Ga0316578_10219689
494 Ga0316578_10226221
495 Ga0316578_10293190
496 Ga0316578_10611577
497 Ga0316577_10003761
498 Ga0316577_10004436
499 Ga0316577_10041310
500 Ga0307413_10286677
501 Ga0307407_10050692
502 Ga0307407_10927660
503 Ga0307409_100064390
504 Ga0307416_100525843
505 Ga0307416_102102047
506 Ga0307415_100490342
507 Ga0316585_10097717
508 Ga0316585_10152068
509 Ga0316596_1093290
510 Ga0316596_1219641
511 Ga0373928_0055346
512 Ga0316574_0017776
513 Ga0316574_0031011
514 Ga0316574_0067827
515 Ga0373933_0246682
516 Ga0316582_0030636
517 Ga0316582_0065626
518 Ga0316582_0133771
519 Ga0316582_0278275
520 Ga0316582_0740851
521 Ga0316582_0850368
522 Ga0316582_0968222
523 Ga0316584_0001774
524 Ga0316584_0016599
525 Ga0316584_0081322
526 Ga0316584_0084315
527 Ga0316584_0168756
528 Ga0316584_0290794
529 Ga0316584_0308608
530 Ga0316584_0312893
531 Ga0316584_0402218
532 Ga0316584_0517956
533 Ga0316581_0038080
534 Ga0316581_0099747
535 Ga0316581_0144971
536 Ga0436365_0729732
537 Ga0436363_0581981
538 Ga0436363_0862917
539 Ga0436363_1253050
540 Ga0436362_0617045
541 Ga0439433_0042325
542 Ga0451577_0004261
543 Ga0451577_0008585
544 Ga0451577_0062402
545 Ga0451577_0109875
546 Ga0451577_0237150
547 Ga0451577_0328254
548 Ga0451577_0620794
549 Ga0451577_1252807
550 Ga0451577_1257437
551 Ga0451577_1600598
552 Ga0451577_1613775
553 Ga0466969_0000163
554 Ga0466969_0058449
555 Ga0466972_0124586
556 Ga0453683_0001884
557 Ga0453683_0011995
558 Ga0453683_0033464
559 Ga0453683_0039800
560 Ga0453683_0043070
561 Ga0453683_0053962
562 Ga0453683_0077370
563 Ga0453683_0219756
564 Ga0453683_0348605
565 Ga0466965_0235259
566 Ga0466966_0000603
567 Ga0466966_0020763
568 Ga0466961_0049570
569 Ga0466963_0307672
570 Ga0466964_0000372
571 Ga0453684_0000095
572 Ga0453684_0000106
573 Ga0453684_0000640
574 Ga0453684_0001556
575 Ga0453684_0007888
576 Ga0453684_0014142
577 Ga0453684_0018903
578 Ga0453684_0024799
579 Ga0453684_0036111
580 Ga0453684_0039107
581 Ga0453684_0041581
582 Ga0453684_0058000
583 Ga0453684_0058584
584 Ga0453684_0135672
585 Ga0453684_0142455
586 Ga0453684_0165222
587 Ga0453684_0166618
588 Ga0453684_0170459
589 Ga0453684_0246535
590 Ga0453684_0265511
591 Ga0453684_0287930
592 Ga0453684_0290567
593 Ga0453684_0304256
594 Ga0453684_0309954
595 Ga0453684_0338200
596 Ga0453684_0358859
597 Ga0453684_0384676
598 Ga0453684_0421614
599 Ga0453684_0452627
600 Ga0453684_0487667
601 Ga0453684_0491942
602 Ga0453684_0524121
603 Ga0453684_0591546
604 Ga0453684_0615031
605 Ga0453684_0705932
606 Ga0453684_0759686
607 Ga0453684_0819138
608 Ga0453684_0866969
609 Ga0453684_1299611
610 Ga0453684_1477412
611 Ga0453684_1626764
612 Ga0466971_0041154
613 Ga0466968_0000004
614 Ga0466970_0000269
615 Ga0466957_0236890
616 Ga0466957_0589818
617 Ga0466959_0011931
618 Ga0466959_0015073
619 Ga0466959_0114716
620 Ga0466959_0518539
621 Ga0451576_0000454
622 Ga0451576_0003853
623 Ga0451576_0034965
624 Ga0451576_0053610
625 Ga0451576_0071985
626 Ga0451576_0074231
627 Ga0451576_0995899
628 Ga0466958_0074059
629 Ga0466967_0550296
630 Ga0501031_0131172
631 Ga0501037_0004540
632 Ga0501040_0000037
633 Ga0501046_0344909
634 Ga0501047_0048166
635 Ga0501071_0848447
636 Ga0501071_1015627
637 Ga0501073_0085401
638 Ga0501073_0160310
639 Ga0501075_0607840
640 Ga0501075_0904459
641 Ga0501076_0195089
642 Ga0501076_0275219
643 Ga0501079_0472166
644 Ga0501080_0369664
645 Ga0501080_1647618
646 Ga0501081_0344511
647 Ga0501044_0001884
648 Ga0501045_0261130
649 Ga0501045_0594097
650 Ga0501045_1050364
651 nmdc:mga05p37_120648_c1
652 nmdc:mga05p37_16261_c1
653 nmdc:mga05p37_23530_c1
654 nmdc:mga05p37_422163_c1
655 nmdc:mga05p37_43702_c1
656 nmdc:mga05p37_661_c1
657 nmdc:mga05p37_886496_c1
658 nmdc:mga09592_1463698_c1
659 nmdc:mga09592_361141_c1
660 nmdc:mga09592_383776_c1
661 nmdc:mga09592_46429_c1
662 nmdc:mga09592_49000_c1
663 nmdc:mga09592_5873_c1
664 nmdc:mga0qj67_358318_c1
665 nmdc:mga06r32_146764_c1
666 nmdc:mga06r32_3507_c1
667 nmdc:mga06r32_48420_c1
668 nmdc:mga06r32_508057_c1
669 nmdc:mga08y16_76033_c1
670 nmdc:mga0a205_19140_c1
671 nmdc:mga0a205_240752_c1
672 nmdc:mga0a205_401527_c1
673 Ga0500637_0249838
674 Ga0501084_0001985
675 Ga0501082_0521424
676 Ga0501082_1316522
677 Ga0501082_1752393
678 Ga0530510_0424383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

37

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4anc-assembly1.cif.gz_A crystal form i of the d93n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis 0.9802 1 131
3vvu-assembly1.cif.gz_A crystal structure of reconstructed bacterial ancestral ndk, bac1 0.9801 1 139
4kpc-assembly1.cif.gz_A crystal structure of the nucleoside diphosphate kinase b from leishmania braziliensis 0.9797 2 140
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9789 2 139
1k44-assembly1.cif.gz_A mycobacterium tuberculosis nucleoside diphosphate kinase 0.9783 1 133
ID Description Score Start End Superfamily
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9814 2 77 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9783 1 133 3.30.70.141
5caaB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9782 2 137 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9693 1 148 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9664 2 141 3.30.70.141
ID Description Score Start End GO Terms
AF-M4AB32-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9878 2 142 GO:0001726
GO:0004550
GO:0005524
GO:0005634
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0030027
AF-A0A401I5H2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9875 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-K9CZ98-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9872 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A6P0Z9W0-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9869 1 130 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-A0A3M7KZG6-F1-model_v4 nucleoside-diphosphate kinase (EC 2.7.4.6) 0.9868 2 141 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241

Map