F414026

General Info

Members Datasets Scaffolds Average Seq Length
339 187 678 181

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0001506|Ga0466961_0001506_2255_2824
Length 180
Sequence VTLKPAIVQDSSTGRVLMLAWMDEEAERRTRETNEAWFWSRSRGRLWRKGETSGNTLAVDEIRDDCDGDALLLRVTPAGPTCHTGSTTCFAPELWRTISERALQRPAGSYTTELLRAGVGACARKVGEEAVELAVASLDEADLVYHLYVLLAARGLDVAAVEDKLRSRRARPASPTPPPG

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 1.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.62
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0001506 3300044693 Bacteria 14458
2 Ga0070658_10123482 3300005327 Unclassified 2153
3 Ga0070683_100180574 3300005329 Bacteria 2003
4 Ga0070680_100006937 3300005336 Bacteria 8632
5 Ga0070682_100237857 3300005337 Bacteria 1306
6 Ga0070682_100821037 3300005337 Bacteria 757
7 Ga0070660_100006017 3300005339 Bacteria 8390
8 Ga0070660_100009337 3300005339 Bacteria 6893
9 Ga0070660_100210163 3300005339 Bacteria 1580
10 Ga0070660_100375438 3300005339 Bacteria 1173
11 Ga0070660_100375928 3300005339 Bacteria 1173
12 Ga0070660_100518597 3300005339 Bacteria 992
13 Ga0070661_100137571 3300005344 Bacteria 1839
14 Ga0070671_100090605 3300005355 Bacteria 2560
15 Ga0070671_101134626 3300005355 Bacteria 687
16 Ga0070659_100009546 3300005366 Bacteria 7131
17 Ga0070659_100295079 3300005366 Bacteria 1350
18 Ga0070714_100171485 3300005435 Bacteria 1969
19 Ga0070710_10041458 3300005437 Bacteria 2542
20 Ga0070708_101103628 3300005445 Bacteria 743
21 Ga0070678_100163454 3300005456 Bacteria 1806
22 Ga0070681_10009436 3300005458 Bacteria 9603
23 Ga0070681_10011289 3300005458 Bacteria 8836
24 Ga0070681_10051676 3300005458 Bacteria 4099
25 Ga0070681_10183739 3300005458 Bacteria 2012
26 Ga0070706_100328154 3300005467 Bacteria 1427
27 Ga0070679_100004535 3300005530 Bacteria 12827
28 Ga0070679_100010543 3300005530 Bacteria 8768
29 Ga0070679_100150103 3300005530 Bacteria 2307
30 Ga0070679_100266778 3300005530 Bacteria 1667
31 Ga0070684_100029402 3300005535 Bacteria 4657
32 Ga0070684_100083671 3300005535 Bacteria 2828
33 Ga0070684_100241112 3300005535 Bacteria 1652
34 Ga0070684_100489401 3300005535 Bacteria 1139
35 Ga0068853_100206128 3300005539 Bacteria 1791
36 Ga0068853_100417982 3300005539 Bacteria 1257
37 Ga0068853_100657385 3300005539 Bacteria 998
38 Ga0068853_101304700 3300005539 Bacteria 702
39 Ga0070696_100036587 3300005546 Bacteria 3385
40 Ga0070665_100005864 3300005548 Bacteria 12595
41 Ga0070665_100444894 3300005548 Bacteria 1305
42 Ga0068855_100026874 3300005563 Bacteria 6886
43 Ga0068855_100035570 3300005563 Bacteria 5932
44 Ga0068855_100073254 3300005563 Bacteria 3980
45 Ga0068855_100155282 3300005563 Bacteria 2600
46 Ga0068855_100178000 3300005563 Bacteria 2405
47 Ga0068857_100026411 3300005577 Bacteria 5119
48 Ga0068857_100241322 3300005577 Bacteria 1654
49 Ga0068854_100131017 3300005578 Bacteria 1915
50 Ga0068854_100430017 3300005578 Bacteria 1098
51 Ga0068856_100256840 3300005614 Bacteria 1762
52 Ga0068852_100205942 3300005616 Bacteria 1864
53 Ga0068852_100559634 3300005616 Bacteria 1144
54 Ga0068858_101063297 3300005842 Bacteria 794
55 Ga0070717_10280126 3300006028 Bacteria 1479
56 Ga0070717_10509493 3300006028 Bacteria 1088
57 Ga0070715_10212962 3300006163 Bacteria 989
58 Ga0070712_100778121 3300006175 Bacteria 820
59 Ga0068871_100516959 3300006358 Bacteria 1078
60 Ga0075428_100015743 3300006844 Bacteria 8378
61 Ga0075434_100588953 3300006871 Bacteria 1131
62 Ga0075429_100018748 3300006880 Bacteria 5992
63 Ga0075436_100076053 3300006914 Bacteria 2325
64 Ga0075436_100232054 3300006914 Bacteria 1311
65 Ga0075435_100186901 3300007076 Bacteria 1752
66 Ga0105240_10113711 3300009093 Bacteria 3271
67 Ga0105240_10350372 3300009093 Bacteria 1675
68 Ga0105240_10533360 3300009093 Bacteria 1301
69 Ga0105240_10585969 3300009093 Bacteria 1230
70 Ga0105245_10269867 3300009098 Bacteria 1659
71 Ga0114129_10005809 3300009147 Bacteria 17471
72 Ga0105243_11856745 3300009148 Bacteria 635
73 Ga0105241_10308338 3300009174 Bacteria 1361
74 Ga0105242_10240127 3300009176 Bacteria 1628
75 Ga0105248_10645975 3300009177 Bacteria 1194
76 Ga0105237_10032655 3300009545 Bacteria 5270
77 Ga0105237_10512884 3300009545 Bacteria 1206
78 Ga0105238_10010084 3300009551 Bacteria 9476
79 Ga0105238_10035188 3300009551 Bacteria 5093
80 Ga0157373_10174571 3300013100 Bacteria 1512
81 Ga0157370_10028558 3300013104 Bacteria 5485
82 Ga0157370_10093587 3300013104 Bacteria 2820
83 Ga0157370_10105633 3300013104 Bacteria 2635
84 Ga0157370_10296974 3300013104 Bacteria 1492
85 Ga0157370_10318610 3300013104 Bacteria 1434
86 Ga0157369_10013853 3300013105 Bacteria 9110
87 Ga0157369_10091173 3300013105 Bacteria 3254
88 Ga0157369_10111892 3300013105 Bacteria 2902
89 Ga0157374_10911097 3300013296 Bacteria 897
90 Ga0157374_11225592 3300013296 Bacteria 772
91 Ga0157372_10108905 3300013307 Bacteria 3172
92 Ga0157372_10262753 3300013307 Bacteria 2005
93 Ga0157372_10983184 3300013307 Bacteria 978
94 Ga0157375_10068460 3300013308 Bacteria 3552
95 Ga0157377_10134498 3300014745 Bacteria 1513
96 Ga0197907_10403100 3300020069 Bacteria 1288
97 Ga0197907_11229077 3300020069 Bacteria 1708
98 Ga0206353_10161838 3300020082 Bacteria 2896
99 Ga0206353_10397491 3300020082 Bacteria 2904
100 Ga0206353_10648074 3300020082 Bacteria 991
101 Ga0206353_11485421 3300020082 Bacteria 1373
102 Ga0213876_10464006 3300021384 Bacteria 674
103 Ga0207692_10428672 3300025898 Bacteria 829
104 Ga0207685_10200185 3300025905 Bacteria 938
105 Ga0207705_10132300 3300025909 Bacteria 1857
106 Ga0207705_10164039 3300025909 Bacteria 1670
107 Ga0207705_10402346 3300025909 Unclassified 1059
108 Ga0207705_10734867 3300025909 Bacteria 767
109 Ga0207684_10303669 3300025910 Bacteria 1376
110 Ga0207707_10006008 3300025912 Bacteria 10625
111 Ga0207707_10085793 3300025912 Bacteria 2751
112 Ga0207707_10107720 3300025912 Bacteria 2436
113 Ga0207707_10213780 3300025912 Bacteria 1679
114 Ga0207707_10355477 3300025912 Bacteria 1262
115 Ga0207695_10527857 3300025913 Bacteria 1062
116 Ga0207671_10055374 3300025914 Bacteria 2938
117 Ga0207693_10224894 3300025915 Bacteria 1474
118 Ga0207663_10289923 3300025916 Bacteria 1219
119 Ga0207660_10005845 3300025917 Bacteria 7984
120 Ga0207660_10076311 3300025917 Bacteria 2450
121 Ga0207660_10597206 3300025917 Unclassified 899
122 Ga0207657_10006121 3300025919 Bacteria 12509
123 Ga0207657_10009747 3300025919 Bacteria 9629
124 Ga0207657_10024163 3300025919 Bacteria 5639
125 Ga0207657_10177609 3300025919 Bacteria 1723
126 Ga0207649_10308842 3300025920 Bacteria 1158
127 Ga0207649_10863707 3300025920 Bacteria 708
128 Ga0207652_10018625 3300025921 Bacteria 5697
129 Ga0207652_10219646 3300025921 Bacteria 1712
130 Ga0207652_10591982 3300025921 Bacteria 995
131 Ga0207694_10028269 3300025924 Bacteria 4275
132 Ga0207694_11252074 3300025924 Bacteria 628
133 Ga0207687_10197298 3300025927 Bacteria 1570
134 Ga0207700_10716261 3300025928 Bacteria 894
135 Ga0207664_10167993 3300025929 Bacteria 1876
136 Ga0207690_10189175 3300025932 Bacteria 1556
137 Ga0207686_10047987 3300025934 Bacteria 2643
138 Ga0207665_10618108 3300025939 Bacteria 847
139 Ga0207711_10243980 3300025941 Bacteria 1648
140 Ga0207661_10278161 3300025944 Bacteria 1495
141 Ga0207661_10354111 3300025944 Bacteria 1325
142 Ga0207679_10822728 3300025945 Unclassified 847
143 Ga0207667_10073524 3300025949 Bacteria 3552
144 Ga0207667_10135122 3300025949 Bacteria 2540
145 Ga0207667_10143795 3300025949 Bacteria 2455
146 Ga0207639_10737605 3300026041 Unclassified 915
147 Ga0207639_10796041 3300026041 Bacteria 881
148 Ga0207639_10838622 3300026041 Unclassified 858
149 Ga0207702_10115409 3300026078 Bacteria 2395
150 Ga0207674_10005033 3300026116 Bacteria 15783
151 Ga0207674_10019535 3300026116 Bacteria 7338
152 Ga0207698_10192667 3300026142 Bacteria 1818
153 Ga0265319_1098911 3300028563 Bacteria 917
154 Ga0265320_10353815 3300031240 Bacteria 649
155 Ga0265340_10332438 3300031247 Bacteria 672
156 Ga0265316_10185407 3300031344 Bacteria 1548
157 Ga0265314_10276094 3300031711 Bacteria 953
158 Ga0307405_10129327 3300031731 Bacteria 1742
159 Ga0307416_100020345 3300032002 Bacteria 4733
160 Ga0307415_100017706 3300032126 Bacteria 4278
161 Ga0373926_0088493 3300035083 Unclassified 1150
162 Ga0373926_0190647 3300035083 Bacteria 787
163 Ga0373944_0017315 3300035089 Bacteria 2044
164 Ga0373944_0135270 3300035089 Unclassified 859
165 Ga0373936_0015094 3300035113 Bacteria 2959
166 Ga0373945_0014521 3300035116 Bacteria 2640
167 Ga0373943_0000954 3300035170 Bacteria 12814
168 Ga0373946_0008272 3300035171 Bacteria 3818
169 Ga0373935_0040726 3300035692 Bacteria 2916
170 Ga0373947_0001682 3300035725 Bacteria 13546
171 Ga0373947_0131769 3300035725 Bacteria 1596
172 Ga0373925_0011183 3300037068 Bacteria 6510
173 Ga0373925_0014425 3300037068 Bacteria 5712
174 Ga0395899_0074547 3300037312 Bacteria 2479
175 Ga0395899_0282891 3300037312 Bacteria 1128
176 Ga0395900_0050411 3300037418 Bacteria 4288
177 Ga0395900_0055069 3300037418 Bacteria 4095
178 Ga0395900_0265444 3300037418 Bacteria 1713
179 Ga0395900_0966652 3300037418 Bacteria 773
180 Ga0395900_1420064 3300037418 Bacteria 607
181 Ga0395898_0031195 3300037466 Bacteria 5328
182 Ga0395898_0233583 3300037466 Bacteria 1754
183 Ga0395898_0630304 3300037466 Bacteria 1015
184 Ga0395898_0700195 3300037466 Bacteria 955
185 Ga0395898_1135608 3300037466 Unclassified 714
186 Ga0395905_0152031 3300037471 Bacteria 2177
187 Ga0395901_0031190 3300038443 Bacteria 5495
188 Ga0395901_0032631 3300038443 Bacteria 5371
189 Ga0395901_0146482 3300038443 Bacteria 2481
190 Ga0395901_0159324 3300038443 Bacteria 2370
191 Ga0395901_0349018 3300038443 Bacteria 1527
192 Ga0395901_0609655 3300038443 Bacteria 1100
193 Ga0395901_0768706 3300038443 Bacteria 955
194 Ga0436365_0642853 3300039437 Bacteria 1001
195 Ga0436365_0724822 3300039437 Bacteria 890
196 Ga0436363_1363910 3300039450 Bacteria 2282
197 Ga0439448_0042298 3300042005 Bacteria 1477
198 Ga0439448_0087783 3300042005 Unclassified 1049
199 Ga0466965_0004348 3300044683 Bacteria 6297
200 Ga0466966_0031586 3300044684 Bacteria 3433
201 Ga0466961_0059250 3300044693 Bacteria 2435
202 Ga0466961_0281872 3300044693 Bacteria 1017
203 Ga0466963_0001089 3300044694 Bacteria 14160
204 Ga0466963_0043795 3300044694 Bacteria 2945
205 Ga0466963_0185810 3300044694 Bacteria 1452
206 Ga0466963_0478783 3300044694 Bacteria 879
207 Ga0466964_0002955 3300044706 Bacteria 6142
208 Ga0466971_0001983 3300044719 Bacteria 8660
209 Ga0466968_0011736 3300044735 Bacteria 3417
210 Ga0466970_0050725 3300044765 Bacteria 2214
211 Ga0466970_0191138 3300044765 Bacteria 1137
212 Ga0466957_0000702 3300044842 Bacteria 17095
213 Ga0466957_0308820 3300044842 Bacteria 1064
214 Ga0466957_0370433 3300044842 Bacteria 975
215 Ga0466959_0003421 3300045049 Bacteria 10378
216 Ga0466959_0086777 3300045049 Bacteria 2251
217 Ga0466959_0087743 3300045049 Bacteria 2237
218 Ga0466959_0527036 3300045049 Bacteria 798
219 Ga0451576_0883832 3300045051 Bacteria 938
220 Ga0466958_0058730 3300045836 Bacteria 2339
221 Ga0466958_0110792 3300045836 Bacteria 1713
222 Ga0466958_0115891 3300045836 Bacteria 1674
223 Ga0466967_0015186 3300045976 Bacteria 6029
224 Ga0466967_0034277 3300045976 Bacteria 4307
225 Ga0466967_0046063 3300045976 Bacteria 3794
226 Ga0466967_0083102 3300045976 Bacteria 2895
227 Ga0466967_0230527 3300045976 Bacteria 1763
228 Ga0466967_0278575 3300045976 Bacteria 1604
229 Ga0466967_0319690 3300045976 Bacteria 1496
230 Ga0466967_0693938 3300045976 Archaea 1008
231 Ga0466967_0694636 3300045976 Bacteria 1007
232 Ga0466967_1231476 3300045976 Bacteria 745
233 Ga0495629_0075929 3300046459 Bacteria 2346
234 Ga0495629_0215285 3300046459 Bacteria 1326
235 Ga0495641_0000681 3300046461 Bacteria 28646
236 Ga0495641_0034633 3300046461 Bacteria 2386
237 Ga0495641_0183656 3300046461 Bacteria 936
238 Ga0495651_0354117 3300046462 Bacteria 969
239 Ga0495653_0111581 3300046463 Bacteria 1964
240 Ga0495639_0002049 3300046475 Bacteria 8922
241 Ga0495662_0001214 3300046476 Bacteria 12678
242 Ga0495594_0018374 3300046499 Bacteria 3702
243 Ga0495618_0081798 3300046514 Bacteria 2063
244 Ga0495628_0151871 3300046516 Bacteria 1763
245 Ga0495630_0008652 3300046517 Bacteria 7306
246 Ga0495666_0007898 3300046526 Bacteria 5329
247 Ga0495640_0038677 3300046533 Bacteria 3354
248 Ga0495586_0374321 3300046535 Bacteria 819
249 Ga0495587_0016961 3300046536 Bacteria 4529
250 Ga0495645_0054102 3300046543 Bacteria 2917
251 Ga0495667_0027898 3300046559 Bacteria 3801
252 Ga0495634_0013032 3300046642 Bacteria 6014
253 Ga0495635_0040065 3300046663 Bacteria 3238
254 Ga0495635_0842889 3300046663 Bacteria 589
255 Ga0495588_0112851 3300046674 Bacteria 1432
256 Ga0495658_0000432 3300046683 Bacteria 23385
257 Ga0495658_0036210 3300046683 Bacteria 2721
258 Ga0495613_0135993 3300046689 Bacteria 1758
259 Ga0495624_0016847 3300046690 Bacteria 4917
260 Ga0495581_0002893 3300047315 Bacteria 9823
261 Ga0495674_0206956 3300047319 Bacteria 1626
262 Ga0495676_0001661 3300047321 Bacteria 19426
263 Ga0495676_0043680 3300047321 Bacteria 3664
264 Ga0495680_0005808 3300047322 Bacteria 11550
265 Ga0495684_0009819 3300047471 Bacteria 7386
266 Ga0495593_0001102 3300047673 Bacteria 15762
267 Ga0495602_0208431 3300048088 Bacteria 1486
268 Ga0495614_0062553 3300048089 Bacteria 1599
269 Ga0496100_0005780 3300048903 Bacteria 6692
270 Ga0496100_0009132 3300048903 Bacteria 5562
271 Ga0496100_0421531 3300048903 Bacteria 1019
272 Ga0496100_0573858 3300048903 Bacteria 874
273 Ga0496101_0042419 3300048904 Bacteria 3247
274 Ga0496101_0086958 3300048904 Bacteria 2319
275 Ga0496102_0035304 3300048905 Bacteria 4500
276 Ga0496103_0263528 3300048906 Bacteria 1109
277 Ga0496103_0531020 3300048906 Bacteria 752
278 Ga0496104_0204125 3300048907 Bacteria 1888
279 Ga0496104_0399525 3300048907 Bacteria 1287
280 Ga0496105_0050279 3300048908 Bacteria 3443
281 Ga0496105_0097816 3300048908 Bacteria 2424
282 Ga0496105_0146736 3300048908 Bacteria 1940
283 Ga0496106_0016680 3300048909 Bacteria 5433
284 Ga0496106_0033709 3300048909 Bacteria 3821
285 Ga0496107_0031195 3300048910 Bacteria 3801
286 Ga0496108_0155154 3300048911 Bacteria 1977
287 Ga0496108_0860383 3300048911 Bacteria 780
288 Ga0496108_0918696 3300048911 Bacteria 751
289 Ga0496109_0176795 3300048912 Bacteria 2004
290 Ga0496109_0620694 3300048912 Bacteria 1018
291 Ga0496110_0235715 3300048913 Bacteria 1665
292 Ga0496111_0447391 3300048914 Bacteria 953
293 Ga0496112_0001575 3300048915 Bacteria 17627
294 Ga0496112_0023506 3300048915 Bacteria 5890
295 Ga0496112_0026761 3300048915 Bacteria 5556
296 Ga0496112_0229071 3300048915 Bacteria 1813
297 Ga0496112_1388485 3300048915 Bacteria 617
298 Ga0496113_0592564 3300048916 Bacteria 888
299 Ga0496114_0080922 3300048917 Bacteria 2743
300 Ga0496114_0131669 3300048917 Bacteria 2160
301 Ga0496114_0274011 3300048917 Bacteria 1487
302 Ga0496115_0017260 3300048918 Bacteria 5512
303 Ga0496115_0097708 3300048918 Bacteria 2405
304 Ga0496115_0657649 3300048918 Bacteria 828
305 Ga0501034_0213211 3300049571 Bacteria 1885
306 Ga0501046_0607252 3300049580 Unclassified 776
307 Ga0501047_0028514 3300049581 Bacteria 5383
308 Ga0501047_0030138 3300049581 Bacteria 5231
309 Ga0501047_0070857 3300049581 Bacteria 3356
310 Ga0501048_0645941 3300049582 Bacteria 760
311 Ga0501067_0066236 3300049583 Bacteria 1999
312 Ga0501067_0101288 3300049583 Bacteria 1600
313 Ga0501068_0045083 3300049584 Bacteria 2656
314 Ga0501069_0105101 3300049585 Bacteria 1604
315 Ga0501069_0185527 3300049585 Bacteria 1203
316 Ga0501069_0200974 3300049585 Bacteria 1155
317 Ga0501069_0441340 3300049585 Bacteria 773
318 Ga0501070_0000112 3300049586 Bacteria 71632
319 Ga0501070_0017481 3300049586 Bacteria 6020
320 Ga0501070_0085605 3300049586 Bacteria 2610
321 Ga0501070_0113152 3300049586 Bacteria 2243
322 Ga0501070_0277025 3300049586 Bacteria 1369
323 Ga0501079_0431919 3300049741 Bacteria 1034
324 Ga0501079_0480633 3300049741 Bacteria 976
325 Ga0501080_0255382 3300049742 Bacteria 1598
326 Ga0501035_0535746 3300049822 Bacteria 960
327 nmdc:mga05p37_9311_c1 3300050507 Bacteria 11618
328 nmdc:mga09592_10254_c1 3300050508 Bacteria 7626
329 nmdc:mga0qj67_55263_c1 3300050509 Bacteria 3145
330 nmdc:mga06r32_1136931_c1 3300050510 Bacteria 729
331 nmdc:mga0rr50_76671_c1 3300050513 Bacteria 2567
332 nmdc:mga0a205_67438_c1 3300050515 Bacteria 3457
333 Ga0495601_0098488 3300053077 Bacteria 1887
334 Ga0495601_0205249 3300053077 Bacteria 1287
335 Ga0495601_0465230 3300053077 Bacteria 817
336 Ga0495612_0016956 3300053078 Bacteria 2918
337 Ga0495655_0041564 3300053083 Bacteria 1176
338 Ga0495595_0078343 3300053084 Bacteria 1571
339 Ga0466962_0000121 3300061719 Bacteria 31836
340 Ga0466961_0001506
341 Ga0070658_10123482
342 Ga0070683_100180574
343 Ga0070680_100006937
344 Ga0070682_100237857
345 Ga0070682_100821037
346 Ga0070660_100006017
347 Ga0070660_100009337
348 Ga0070660_100210163
349 Ga0070660_100375438
350 Ga0070660_100375928
351 Ga0070660_100518597
352 Ga0070661_100137571
353 Ga0070671_100090605
354 Ga0070671_101134626
355 Ga0070659_100009546
356 Ga0070659_100295079
357 Ga0070714_100171485
358 Ga0070710_10041458
359 Ga0070708_101103628
360 Ga0070678_100163454
361 Ga0070681_10009436
362 Ga0070681_10011289
363 Ga0070681_10051676
364 Ga0070681_10183739
365 Ga0070706_100328154
366 Ga0070679_100004535
367 Ga0070679_100010543
368 Ga0070679_100150103
369 Ga0070679_100266778
370 Ga0070684_100029402
371 Ga0070684_100083671
372 Ga0070684_100241112
373 Ga0070684_100489401
374 Ga0068853_100206128
375 Ga0068853_100417982
376 Ga0068853_100657385
377 Ga0068853_101304700
378 Ga0070696_100036587
379 Ga0070665_100005864
380 Ga0070665_100444894
381 Ga0068855_100026874
382 Ga0068855_100035570
383 Ga0068855_100073254
384 Ga0068855_100155282
385 Ga0068855_100178000
386 Ga0068857_100026411
387 Ga0068857_100241322
388 Ga0068854_100131017
389 Ga0068854_100430017
390 Ga0068856_100256840
391 Ga0068852_100205942
392 Ga0068852_100559634
393 Ga0068858_101063297
394 Ga0070717_10280126
395 Ga0070717_10509493
396 Ga0070715_10212962
397 Ga0070712_100778121
398 Ga0068871_100516959
399 Ga0075428_100015743
400 Ga0075434_100588953
401 Ga0075429_100018748
402 Ga0075436_100076053
403 Ga0075436_100232054
404 Ga0075435_100186901
405 Ga0105240_10113711
406 Ga0105240_10350372
407 Ga0105240_10533360
408 Ga0105240_10585969
409 Ga0105245_10269867
410 Ga0114129_10005809
411 Ga0105243_11856745
412 Ga0105241_10308338
413 Ga0105242_10240127
414 Ga0105248_10645975
415 Ga0105237_10032655
416 Ga0105237_10512884
417 Ga0105238_10010084
418 Ga0105238_10035188
419 Ga0157373_10174571
420 Ga0157370_10028558
421 Ga0157370_10093587
422 Ga0157370_10105633
423 Ga0157370_10296974
424 Ga0157370_10318610
425 Ga0157369_10013853
426 Ga0157369_10091173
427 Ga0157369_10111892
428 Ga0157374_10911097
429 Ga0157374_11225592
430 Ga0157372_10108905
431 Ga0157372_10262753
432 Ga0157372_10983184
433 Ga0157375_10068460
434 Ga0157377_10134498
435 Ga0197907_10403100
436 Ga0197907_11229077
437 Ga0206353_10161838
438 Ga0206353_10397491
439 Ga0206353_10648074
440 Ga0206353_11485421
441 Ga0213876_10464006
442 Ga0207692_10428672
443 Ga0207685_10200185
444 Ga0207705_10132300
445 Ga0207705_10164039
446 Ga0207705_10402346
447 Ga0207705_10734867
448 Ga0207684_10303669
449 Ga0207707_10006008
450 Ga0207707_10085793
451 Ga0207707_10107720
452 Ga0207707_10213780
453 Ga0207707_10355477
454 Ga0207695_10527857
455 Ga0207671_10055374
456 Ga0207693_10224894
457 Ga0207663_10289923
458 Ga0207660_10005845
459 Ga0207660_10076311
460 Ga0207660_10597206
461 Ga0207657_10006121
462 Ga0207657_10009747
463 Ga0207657_10024163
464 Ga0207657_10177609
465 Ga0207649_10308842
466 Ga0207649_10863707
467 Ga0207652_10018625
468 Ga0207652_10219646
469 Ga0207652_10591982
470 Ga0207694_10028269
471 Ga0207694_11252074
472 Ga0207687_10197298
473 Ga0207700_10716261
474 Ga0207664_10167993
475 Ga0207690_10189175
476 Ga0207686_10047987
477 Ga0207665_10618108
478 Ga0207711_10243980
479 Ga0207661_10278161
480 Ga0207661_10354111
481 Ga0207679_10822728
482 Ga0207667_10073524
483 Ga0207667_10135122
484 Ga0207667_10143795
485 Ga0207639_10737605
486 Ga0207639_10796041
487 Ga0207639_10838622
488 Ga0207702_10115409
489 Ga0207674_10005033
490 Ga0207674_10019535
491 Ga0207698_10192667
492 Ga0265319_1098911
493 Ga0265320_10353815
494 Ga0265340_10332438
495 Ga0265316_10185407
496 Ga0265314_10276094
497 Ga0307405_10129327
498 Ga0307416_100020345
499 Ga0307415_100017706
500 Ga0373926_0088493
501 Ga0373926_0190647
502 Ga0373944_0017315
503 Ga0373944_0135270
504 Ga0373936_0015094
505 Ga0373945_0014521
506 Ga0373943_0000954
507 Ga0373946_0008272
508 Ga0373935_0040726
509 Ga0373947_0001682
510 Ga0373947_0131769
511 Ga0373925_0011183
512 Ga0373925_0014425
513 Ga0395899_0074547
514 Ga0395899_0282891
515 Ga0395900_0050411
516 Ga0395900_0055069
517 Ga0395900_0265444
518 Ga0395900_0966652
519 Ga0395900_1420064
520 Ga0395898_0031195
521 Ga0395898_0233583
522 Ga0395898_0630304
523 Ga0395898_0700195
524 Ga0395898_1135608
525 Ga0395905_0152031
526 Ga0395901_0031190
527 Ga0395901_0032631
528 Ga0395901_0146482
529 Ga0395901_0159324
530 Ga0395901_0349018
531 Ga0395901_0609655
532 Ga0395901_0768706
533 Ga0436365_0642853
534 Ga0436365_0724822
535 Ga0436363_1363910
536 Ga0439448_0042298
537 Ga0439448_0087783
538 Ga0466965_0004348
539 Ga0466966_0031586
540 Ga0466961_0059250
541 Ga0466961_0281872
542 Ga0466963_0001089
543 Ga0466963_0043795
544 Ga0466963_0185810
545 Ga0466963_0478783
546 Ga0466964_0002955
547 Ga0466971_0001983
548 Ga0466968_0011736
549 Ga0466970_0050725
550 Ga0466970_0191138
551 Ga0466957_0000702
552 Ga0466957_0308820
553 Ga0466957_0370433
554 Ga0466959_0003421
555 Ga0466959_0086777
556 Ga0466959_0087743
557 Ga0466959_0527036
558 Ga0451576_0883832
559 Ga0466958_0058730
560 Ga0466958_0110792
561 Ga0466958_0115891
562 Ga0466967_0015186
563 Ga0466967_0034277
564 Ga0466967_0046063
565 Ga0466967_0083102
566 Ga0466967_0230527
567 Ga0466967_0278575
568 Ga0466967_0319690
569 Ga0466967_0693938
570 Ga0466967_0694636
571 Ga0466967_1231476
572 Ga0495629_0075929
573 Ga0495629_0215285
574 Ga0495641_0000681
575 Ga0495641_0034633
576 Ga0495641_0183656
577 Ga0495651_0354117
578 Ga0495653_0111581
579 Ga0495639_0002049
580 Ga0495662_0001214
581 Ga0495594_0018374
582 Ga0495618_0081798
583 Ga0495628_0151871
584 Ga0495630_0008652
585 Ga0495666_0007898
586 Ga0495640_0038677
587 Ga0495586_0374321
588 Ga0495587_0016961
589 Ga0495645_0054102
590 Ga0495667_0027898
591 Ga0495634_0013032
592 Ga0495635_0040065
593 Ga0495635_0842889
594 Ga0495588_0112851
595 Ga0495658_0000432
596 Ga0495658_0036210
597 Ga0495613_0135993
598 Ga0495624_0016847
599 Ga0495581_0002893
600 Ga0495674_0206956
601 Ga0495676_0001661
602 Ga0495676_0043680
603 Ga0495680_0005808
604 Ga0495684_0009819
605 Ga0495593_0001102
606 Ga0495602_0208431
607 Ga0495614_0062553
608 Ga0496100_0005780
609 Ga0496100_0009132
610 Ga0496100_0421531
611 Ga0496100_0573858
612 Ga0496101_0042419
613 Ga0496101_0086958
614 Ga0496102_0035304
615 Ga0496103_0263528
616 Ga0496103_0531020
617 Ga0496104_0204125
618 Ga0496104_0399525
619 Ga0496105_0050279
620 Ga0496105_0097816
621 Ga0496105_0146736
622 Ga0496106_0016680
623 Ga0496106_0033709
624 Ga0496107_0031195
625 Ga0496108_0155154
626 Ga0496108_0860383
627 Ga0496108_0918696
628 Ga0496109_0176795
629 Ga0496109_0620694
630 Ga0496110_0235715
631 Ga0496111_0447391
632 Ga0496112_0001575
633 Ga0496112_0023506
634 Ga0496112_0026761
635 Ga0496112_0229071
636 Ga0496112_1388485
637 Ga0496113_0592564
638 Ga0496114_0080922
639 Ga0496114_0131669
640 Ga0496114_0274011
641 Ga0496115_0017260
642 Ga0496115_0097708
643 Ga0496115_0657649
644 Ga0501034_0213211
645 Ga0501046_0607252
646 Ga0501047_0028514
647 Ga0501047_0030138
648 Ga0501047_0070857
649 Ga0501048_0645941
650 Ga0501067_0066236
651 Ga0501067_0101288
652 Ga0501068_0045083
653 Ga0501069_0105101
654 Ga0501069_0185527
655 Ga0501069_0200974
656 Ga0501069_0441340
657 Ga0501070_0000112
658 Ga0501070_0017481
659 Ga0501070_0085605
660 Ga0501070_0113152
661 Ga0501070_0277025
662 Ga0501079_0431919
663 Ga0501079_0480633
664 Ga0501080_0255382
665 Ga0501035_0535746
666 nmdc:mga05p37_9311_c1
667 nmdc:mga09592_10254_c1
668 nmdc:mga0qj67_55263_c1
669 nmdc:mga06r32_1136931_c1
670 nmdc:mga0rr50_76671_c1
671 nmdc:mga0a205_67438_c1
672 Ga0495601_0098488
673 Ga0495601_0205249
674 Ga0495601_0465230
675 Ga0495612_0016956
676 Ga0495655_0041564
677 Ga0495595_0078343
678 Ga0466962_0000121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

18

91

0.99

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

91

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9767 97 176
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9728 1 93
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9479 97 180
7aoi-assembly1.cif.gz_XF trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.9285 122 165
7t8u-assembly1.cif.gz_A structure of psmbeta2 nanotubes 0.9162 127 163
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9861 6 85 3.10.20.810
af_P9WMM9_1_93_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9818 97 176 1.10.287.1080
3c90C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9779 97 175 1.10.287.1080
3c90A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9766 97 176 1.10.287.1080
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9757 5 85 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A494WC72-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9966 5 93 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-Q89IW3-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9949 5 93 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A0E9MQB6-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9937 5 93 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A0S6V0H0-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.993 5 93 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7W1N7W9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9928 6 73 GO:0000105
GO:0004635

Map