F413992

General Info

Members Datasets Scaffolds Average Seq Length
339 195 678 294

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100177030|Ga0307416_1001770302
Length 326
Sequence MRMDNELWSLSFFVGCRMSESAELPMNFGGITEERYSNPEDARVLVWPISYEGTVSYGTGTGKGSMAIVDASRNMELYEEETSAEVYKIGIHTLDEFQPIPSPKAMMDALYERTRALLDKDKFICMIGGEHSVSAPVIRAHAEKFHNLSVLQIDAHADLRDTYDGTPHSHASIMARVVKDLRIPSVQVGIRSISGDEARSLAAGLPTKIFWAKDIVGRTDWIGPAIDALTENVYLTIDIDGLDPSLVPTTGTPEPGGLGWYETLALIRQLAERKRIVGMDLVEFSKTDNSDAPAFLCAKLIYKSLAYIFQGETPKIMRLAGEKYFI

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
179 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.29
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 16.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100177030 3300032002 Bacteria 1994
2 MBSR1b_contig_5367938 2162886012 Bacteria 5349
3 LJQas_1000873 3300000549 Unclassified 4696
4 JGI24034J14986_100090 3300001432 Bacteria 3770
5 JGI24748J21848_1000039 3300002074 Bacteria 67539
6 JGI24034J26672_10000042 3300002239 Bacteria 67592
7 JGI24034J26672_10000043 3300002239 Bacteria 67568
8 Ga0065712_10088701 3300005290 Unclassified 2506
9 Ga0065715_10102590 3300005293 Bacteria 3101
10 Ga0065707_10083202 3300005295 Bacteria 10022
11 Ga0070658_10013151 3300005327 Bacteria 6640
12 Ga0070683_100398629 3300005329 Bacteria 1312
13 Ga0070690_100016309 3300005330 Bacteria 4447
14 Ga0070670_100054968 3300005331 Bacteria 3417
15 Ga0070677_10007806 3300005333 Bacteria 3582
16 Ga0070677_10044427 3300005333 Bacteria 1768
17 Ga0068869_100100638 3300005334 Bacteria 2186
18 Ga0070680_100040832 3300005336 Unclassified 3759
19 Ga0070680_100170715 3300005336 Bacteria 1830
20 Ga0070680_100260197 3300005336 Bacteria 1468
21 Ga0070682_100000104 3300005337 Bacteria 76111
22 Ga0070682_100474652 3300005337 Bacteria 963
23 Ga0070660_100298408 3300005339 Bacteria 1321
24 Ga0070689_100108178 3300005340 Unclassified 2208
25 Ga0070687_100056656 3300005343 Bacteria 2051
26 Ga0070687_100123540 3300005343 Unclassified 1484
27 Ga0070661_100207802 3300005344 Bacteria 1498
28 Ga0070661_100315815 3300005344 Bacteria 1219
29 Ga0070692_10143062 3300005345 Bacteria 1355
30 Ga0070668_100011371 3300005347 Bacteria 6630
31 Ga0070669_100111873 3300005353 Bacteria 2073
32 Ga0070669_100403143 3300005353 Bacteria 1119
33 Ga0070675_100020846 3300005354 Bacteria 5232
34 Ga0070675_100170016 3300005354 Unclassified 1879
35 Ga0070671_100040244 3300005355 Bacteria 3881
36 Ga0070671_100056381 3300005355 Bacteria 3269
37 Ga0070674_100008747 3300005356 Bacteria 6040
38 Ga0070688_100097919 3300005365 Unclassified 1929
39 Ga0070703_10000244 3300005406 Bacteria 26442
40 Ga0070703_10027180 3300005406 Bacteria 1704
41 Ga0070705_100104827 3300005440 Bacteria 1794
42 Ga0070705_100233013 3300005440 Bacteria 1282
43 Ga0070700_100016746 3300005441 Unclassified 4179
44 Ga0070694_100007185 3300005444 Bacteria 6780
45 Ga0070694_100009781 3300005444 Bacteria 5890
46 Ga0070694_100113048 3300005444 Unclassified 1937
47 Ga0070678_100207248 3300005456 Unclassified 1622
48 Ga0070662_100147258 3300005457 Unclassified 1830
49 Ga0070662_100554285 3300005457 Bacteria 963
50 Ga0070681_10013031 3300005458 Bacteria 8257
51 Ga0068867_100038648 3300005459 Bacteria 3475
52 Ga0070685_10010643 3300005466 Bacteria 4786
53 Ga0070706_100069432 3300005467 Bacteria 3258
54 Ga0070706_100159591 3300005467 Unclassified 2105
55 Ga0070707_100000625 3300005468 Bacteria 35433
56 Ga0070707_100106429 3300005468 Unclassified 2720
57 Ga0070707_100461461 3300005468 Bacteria 1231
58 Ga0070707_100625948 3300005468 Bacteria 1039
59 Ga0070698_100000084 3300005471 Bacteria 73239
60 Ga0070698_100383199 3300005471 Unclassified 1339
61 Ga0070679_100280819 3300005530 Bacteria 1618
62 Ga0070684_100249797 3300005535 Unclassified 1621
63 Ga0070684_100466933 3300005535 Bacteria 1167
64 Ga0070697_100004753 3300005536 Bacteria 10411
65 Ga0068853_100015546 3300005539 Bacteria 6252
66 Ga0068853_100133046 3300005539 Bacteria 2227
67 Ga0070686_100115070 3300005544 Bacteria 1838
68 Ga0070686_100150699 3300005544 Unclassified 1628
69 Ga0070686_100275956 3300005544 Bacteria 1238
70 Ga0070686_100297537 3300005544 Unclassified 1196
71 Ga0070695_100078268 3300005545 Unclassified 2180
72 Ga0070693_100048079 3300005547 Bacteria 2429
73 Ga0070704_100019739 3300005549 Unclassified 4336
74 Ga0070704_100075802 3300005549 Bacteria 2458
75 Ga0068855_100249808 3300005563 Bacteria 1979
76 Ga0070664_100030078 3300005564 Bacteria 4530
77 Ga0070664_100088092 3300005564 Bacteria 2684
78 Ga0070664_100140219 3300005564 Bacteria 2128
79 Ga0068857_100086028 3300005577 Bacteria 2810
80 Ga0068854_100106886 3300005578 Bacteria 2106
81 Ga0068859_100004245 3300005617 Bacteria 14629
82 Ga0068859_100019387 3300005617 Bacteria 6833
83 Ga0068859_100037190 3300005617 Bacteria 4885
84 Ga0068859_100122407 3300005617 Bacteria 2669
85 Ga0068864_100026274 3300005618 Unclassified 4910
86 Ga0068864_100042458 3300005618 Bacteria 3891
87 Ga0068864_100054238 3300005618 Bacteria 3460
88 Ga0068864_100163461 3300005618 Bacteria 2025
89 Ga0068866_10076975 3300005718 Bacteria 1780
90 Ga0068861_100148320 3300005719 Bacteria 1922
91 Ga0068863_100138948 3300005841 Bacteria 2322
92 Ga0068858_100000053 3300005842 Bacteria 119869
93 Ga0068860_100022840 3300005843 Bacteria 6049
94 Ga0068860_100032201 3300005843 Bacteria 5039
95 Ga0068862_100022183 3300005844 Bacteria 5312
96 Ga0068862_100077378 3300005844 Bacteria 2881
97 Ga0068862_100232240 3300005844 Unclassified 1674
98 Ga0081539_10002485 3300005985 Bacteria 25925
99 Ga0070716_100000010 3300006173 Bacteria 157261
100 Ga0097621_100111408 3300006237 Bacteria 2313
101 Ga0068871_100085382 3300006358 Bacteria 2621
102 Ga0075433_10005936 3300006852 Bacteria 9616
103 Ga0075433_10139151 3300006852 Bacteria 2158
104 Ga0075434_100097753 3300006871 Bacteria 2940
105 Ga0075434_100245891 3300006871 Bacteria 1808
106 Ga0075429_100118919 3300006880 Bacteria 2309
107 Ga0068865_100272982 3300006881 Bacteria 1343
108 Ga0075436_100000017 3300006914 Bacteria 151066
109 Ga0097620_100004245 3300006931 Bacteria 14629
110 Ga0097620_100019387 3300006931 Bacteria 6833
111 Ga0097620_100037190 3300006931 Bacteria 4885
112 Ga0097620_100063033 3300006931 Bacteria 3737
113 Ga0097620_100122407 3300006931 Bacteria 2669
114 Ga0075435_100000286 3300007076 Bacteria 31463
115 Ga0105240_10090159 3300009093 Bacteria 3748
116 Ga0111539_10092114 3300009094 Unclassified 3561
117 Ga0105247_10000052 3300009101 Bacteria 141465
118 Ga0114129_10019079 3300009147 Bacteria 9767
119 Ga0114129_10180486 3300009147 Unclassified 2873
120 Ga0105243_10000319 3300009148 Bacteria 52947
121 Ga0105243_10010604 3300009148 Bacteria 6996
122 Ga0105243_10025715 3300009148 Bacteria 4502
123 Ga0105243_10043897 3300009148 Bacteria 3505
124 Ga0105243_10141015 3300009148 Bacteria 2056
125 Ga0105243_10267823 3300009148 Bacteria 1532
126 Ga0105241_10045833 3300009174 Bacteria 3319
127 Ga0105242_10000004 3300009176 Bacteria 224767
128 Ga0105242_10001128 3300009176 Bacteria 21045
129 Ga0105242_10011012 3300009176 Bacteria 6946
130 Ga0105242_10393784 3300009176 Unclassified 1291
131 Ga0105242_10417397 3300009176 Unclassified 1256
132 Ga0105248_10068357 3300009177 Unclassified 3989
133 Ga0105248_10383530 3300009177 Bacteria 1582
134 Ga0105248_10819328 3300009177 Bacteria 1050
135 Ga0105237_10427898 3300009545 Unclassified 1329
136 Ga0105249_10000003 3300009553 Bacteria 370855
137 Ga0105249_10000241 3300009553 Bacteria 61056
138 Ga0105249_10033215 3300009553 Bacteria 4671
139 Ga0105249_10085360 3300009553 Bacteria 2942
140 Ga0105239_10013773 3300010375 Bacteria 8977
141 Ga0105239_10089017 3300010375 Bacteria 3404
142 Ga0157369_10062484 3300013105 Bacteria 4013
143 Ga0157369_10374518 3300013105 Bacteria 1478
144 Ga0157374_10025839 3300013296 Bacteria 5279
145 Ga0157374_10294916 3300013296 Bacteria 1603
146 Ga0157378_10000090 3300013297 Bacteria 86085
147 Ga0157378_10004645 3300013297 Bacteria 12045
148 Ga0157378_10057531 3300013297 Unclassified 3465
149 Ga0157378_10094394 3300013297 Bacteria 2724
150 Ga0157378_10240049 3300013297 Bacteria 1731
151 Ga0157378_10328905 3300013297 Bacteria 1487
152 Ga0163162_10000020 3300013306 Bacteria 220558
153 Ga0163162_10025917 3300013306 Bacteria 5794
154 Ga0163162_10038728 3300013306 Bacteria 4758
155 Ga0163162_10047065 3300013306 Bacteria 4323
156 Ga0163162_10234997 3300013306 Unclassified 1964
157 Ga0163162_10333913 3300013306 Bacteria 1648
158 Ga0157372_10042448 3300013307 Bacteria 5031
159 Ga0157372_10082173 3300013307 Bacteria 3647
160 Ga0157372_10239150 3300013307 Bacteria 2107
161 Ga0157372_10286487 3300013307 Bacteria 1916
162 Ga0157375_10032551 3300013308 Bacteria 4946
163 Ga0157375_10082728 3300013308 Unclassified 3253
164 Ga0157375_10311312 3300013308 Bacteria 1739
165 Ga0163163_10176284 3300014325 Bacteria 2184
166 Ga0163163_10340903 3300014325 Unclassified 1554
167 Ga0157380_10020777 3300014326 Bacteria 4914
168 Ga0157380_10022333 3300014326 Bacteria 4761
169 Ga0163161_10007726 3300017792 Bacteria 7440
170 Ga0163161_10015577 3300017792 Bacteria 5302
171 Ga0213876_10000104 3300021384 Bacteria 93860
172 Ga0213876_10000620 3300021384 Bacteria 26119
173 Ga0213875_10003287 3300021388 Bacteria 9254
174 Ga0207672_1000063 3300025223 Bacteria 14272
175 Ga0207653_10000033 3300025885 Bacteria 103535
176 Ga0207710_10000004 3300025900 Bacteria 846540
177 Ga0207710_10003153 3300025900 Bacteria 7384
178 Ga0207688_10307521 3300025901 Bacteria 970
179 Ga0207705_10002218 3300025909 Bacteria 14995
180 Ga0207684_10007989 3300025910 Bacteria 9451
181 Ga0207654_10009234 3300025911 Bacteria 5002
182 Ga0207660_10140331 3300025917 Bacteria 1847
183 Ga0207660_10149880 3300025917 Bacteria 1791
184 Ga0207662_10103753 3300025918 Bacteria 1765
185 Ga0207662_10154274 3300025918 Bacteria 1463
186 Ga0207657_10051403 3300025919 Bacteria 3582
187 Ga0207652_10368441 3300025921 Bacteria 1297
188 Ga0207646_10001080 3300025922 Bacteria 34748
189 Ga0207646_10010348 3300025922 Bacteria 9124
190 Ga0207646_10232286 3300025922 Bacteria 1666
191 Ga0207646_10427266 3300025922 Bacteria 1196
192 Ga0207650_10024522 3300025925 Bacteria 4289
193 Ga0207650_10247851 3300025925 Unclassified 1441
194 Ga0207659_10009121 3300025926 Bacteria 6194
195 Ga0207659_10109812 3300025926 Unclassified 2094
196 Ga0207644_10000206 3300025931 Bacteria 41161
197 Ga0207644_10030213 3300025931 Bacteria 3765
198 Ga0207644_10318664 3300025931 Bacteria 1257
199 Ga0207706_10112388 3300025933 Unclassified 2396
200 Ga0207686_10000005 3300025934 Bacteria 260873
201 Ga0207686_10000619 3300025934 Bacteria 22102
202 Ga0207686_10000676 3300025934 Bacteria 21121
203 Ga0207709_10000133 3300025935 Bacteria 108698
204 Ga0207709_10001583 3300025935 Bacteria 15527
205 Ga0207709_10013626 3300025935 Bacteria 4485
206 Ga0207709_10100708 3300025935 Bacteria 1909
207 Ga0207669_10012540 3300025937 Bacteria 4172
208 Ga0207704_10290175 3300025938 Bacteria 1248
209 Ga0207665_10000010 3300025939 Bacteria 157219
210 Ga0207665_10133347 3300025939 Bacteria 1765
211 Ga0207691_10047733 3300025940 Bacteria 3928
212 Ga0207691_10140097 3300025940 Bacteria 2132
213 Ga0207691_10159817 3300025940 Unclassified 1977
214 Ga0207711_10075231 3300025941 Unclassified 2938
215 Ga0207711_10273424 3300025941 Bacteria 1555
216 Ga0207689_10005738 3300025942 Bacteria 11031
217 Ga0207689_10483677 3300025942 Unclassified 1037
218 Ga0207679_10105450 3300025945 Unclassified 2213
219 Ga0207679_10118547 3300025945 Bacteria 2103
220 Ga0207667_10389188 3300025949 Bacteria 1420
221 Ga0207667_10473455 3300025949 Bacteria 1272
222 Ga0207651_10067250 3300025960 Unclassified 2521
223 Ga0207712_10000096 3300025961 Bacteria 102247
224 Ga0207712_10001776 3300025961 Bacteria 14375
225 Ga0207712_10407732 3300025961 Bacteria 1144
226 Ga0207668_10024653 3300025972 Unclassified 3885
227 Ga0207640_10068571 3300025981 Unclassified 2377
228 Ga0207640_10093724 3300025981 Bacteria 2087
229 Ga0207677_10659012 3300026023 Bacteria 925
230 Ga0207703_10000093 3300026035 Bacteria 104313
231 Ga0207703_10022344 3300026035 Unclassified 4961
232 Ga0207703_10060041 3300026035 Bacteria 3108
233 Ga0207703_10095290 3300026035 Bacteria 2511
234 Ga0207639_10008762 3300026041 Bacteria 6951
235 Ga0207639_10013539 3300026041 Bacteria 5712
236 Ga0207639_10082232 3300026041 Bacteria 2552
237 Ga0207639_10121755 3300026041 Bacteria 2145
238 Ga0207708_10196733 3300026075 Bacteria 1607
239 Ga0207641_10054162 3300026088 Bacteria 3403
240 Ga0207641_10141624 3300026088 Unclassified 2170
241 Ga0207648_10193414 3300026089 Bacteria 1804
242 Ga0207676_10086258 3300026095 Unclassified 2564
243 Ga0207674_10073567 3300026116 Bacteria 3430
244 Ga0207675_100001424 3300026118 Bacteria 23965
245 Ga0207675_100280305 3300026118 Unclassified 1619
246 Ga0207675_100306577 3300026118 Unclassified 1547
247 Ga0207683_10019908 3300026121 Bacteria 5735
248 Ga0207428_10004764 3300027907 Bacteria 12826
249 Ga0268265_10042682 3300028380 Bacteria 3366
250 Ga0268265_10230212 3300028380 Bacteria 1628
251 Ga0268264_10022389 3300028381 Bacteria 5161
252 Ga0268264_10039067 3300028381 Bacteria 3920
253 Ga0268264_10192064 3300028381 Bacteria 1862
254 Ga0265330_10040695 3300031235 Bacteria 2063
255 Ga0265316_10001397 3300031344 Bacteria 25964
256 Ga0307408_100163750 3300031548 Bacteria 1769
257 Ga0307405_10023654 3300031731 Unclassified 3495
258 Ga0307413_10002521 3300031824 Bacteria 7468
259 Ga0307413_10005310 3300031824 Bacteria 5731
260 Ga0307413_10024941 3300031824 Unclassified 3268
261 Ga0307410_10002585 3300031852 Bacteria 8786
262 Ga0307410_10005282 3300031852 Bacteria 6813
263 Ga0307410_10006240 3300031852 Bacteria 6415
264 Ga0307410_10044201 3300031852 Unclassified 2957
265 Ga0307410_10149403 3300031852 Unclassified 1738
266 Ga0307406_10009418 3300031901 Bacteria 5476
267 Ga0307407_10000707 3300031903 Bacteria 10869
268 Ga0307407_10008360 3300031903 Bacteria 4744
269 Ga0307412_10003775 3300031911 Bacteria 8421
270 Ga0307412_10035033 3300031911 Bacteria 3204
271 Ga0307412_10145329 3300031911 Bacteria 1742
272 Ga0307409_100001097 3300031995 Bacteria 12799
273 Ga0307409_100002019 3300031995 Bacteria 10418
274 Ga0307409_100210333 3300031995 Bacteria 1748
275 Ga0307409_100677416 3300031995 Bacteria 1028
276 Ga0307416_100001651 3300032002 Bacteria 12305
277 Ga0307414_10014349 3300032004 Bacteria 4748
278 Ga0307414_10148467 3300032004 Bacteria 1846
279 Ga0307414_10293916 3300032004 Unclassified 1371
280 Ga0307411_10003923 3300032005 Bacteria 7019
281 Ga0307411_10006614 3300032005 Bacteria 5817
282 Ga0307411_10023621 3300032005 Bacteria 3646
283 Ga0307411_10042253 3300032005 Bacteria 2907
284 Ga0307411_10103482 3300032005 Bacteria 2020
285 Ga0307415_100008659 3300032126 Bacteria 5656
286 Ga0307415_100021093 3300032126 Bacteria 3995
287 Ga0395905_0030038 3300037471 Bacteria 5122
288 Ga0395905_0031369 3300037471 Bacteria 5003
289 Ga0395905_0123634 3300037471 Unclassified 2433
290 Ga0436364_0745657 3300037853 Bacteria 51254
291 Ga0436365_0653517 3300039437 Bacteria 2080
292 Ga0436365_0748815 3300039437 Bacteria 55323
293 Ga0436365_1692876 3300039437 Bacteria 39820
294 Ga0451577_0094939 3300042876 Bacteria 2663
295 Ga0453683_0011725 3300044673 Bacteria 5772
296 Ga0451576_0058431 3300045051 Bacteria 4030
297 Ga0495632_0026131 3300046519 Bacteria 3077
298 Ga0495663_0000024 3300046525 Bacteria 97211
299 Ga0495598_0000124 3300046537 Bacteria 12958
300 Ga0495621_0000409 3300046539 Bacteria 10587
301 Ga0495645_0236797 3300046543 Unclassified 1220
302 Ga0496106_0001066 3300048909 Bacteria 20222
303 Ga0501038_0186787 3300049574 Bacteria 1670
304 Ga0501039_0083792 3300049575 Unclassified 2483
305 Ga0501041_0212575 3300049577 Bacteria 1213
306 Ga0501042_0366583 3300049578 Bacteria 1042
307 Ga0501071_0105646 3300049587 Bacteria 2079
308 Ga0501072_0041524 3300049588 Bacteria 3613
309 Ga0501072_0696683 3300049588 Unclassified 798
310 Ga0501074_0160453 3300049590 Bacteria 1606
311 Ga0501075_0014388 3300049591 Bacteria 5669
312 Ga0501076_0101522 3300049592 Bacteria 2319
313 Ga0501202_002913 3300049652 Unclassified 2905
314 Ga0501223_015907 3300049663 Bacteria 1489
315 Ga0501233_009484 3300049668 Bacteria 1898
316 Ga0501235_003134 3300049669 Bacteria 3563
317 Ga0501240_027242 3300049673 Bacteria 896
318 Ga0501247_000119 3300049677 Unclassified 4539
319 Ga0501249_001326 3300049679 Bacteria 5146
320 Ga0501250_005965 3300049680 Bacteria 1271
321 Ga0501252_007396 3300049682 Bacteria 1243
322 Ga0501257_008784 3300049686 Bacteria 2276
323 Ga0501257_010672 3300049686 Bacteria 2089
324 Ga0501221_033438 3300049704 Bacteria 1086
325 Ga0501229_002283 3300049706 Bacteria 2258
326 Ga0501080_0537363 3300049742 Bacteria 1042
327 Ga0501263_011761 3300049760 Bacteria 1090
328 Ga0501268_000180 3300049765 Bacteria 5911
329 Ga0501272_003873 3300049769 Bacteria 1540
330 nmdc:mga05p37_464247_c1 3300050507 Bacteria 1462
331 nmdc:mga09592_106540_c1 3300050508 Bacteria 2404
332 nmdc:mga08y16_330589_c1 3300050511 Bacteria 1568
333 nmdc:mga08y16_36305_c1 3300050511 Bacteria 5176
334 nmdc:mga0n895_12927_c1 3300050512 Bacteria 7505
335 nmdc:mga0rr50_116_c1 3300050513 Bacteria 44002
336 nmdc:mga08x19_40_c1 3300050514 Bacteria 154170
337 nmdc:mga0a205_180860_c1 3300050515 Bacteria 2003
338 Ga0495601_0142639 3300053077 Bacteria 1563
339 Ga0500616_0001590 3300053153 Bacteria 21217
340 Ga0307416_100177030
341 MBSR1b_contig_5367938
342 LJQas_1000873
343 JGI24034J14986_100090
344 JGI24748J21848_1000039
345 JGI24034J26672_10000042
346 JGI24034J26672_10000043
347 Ga0065712_10088701
348 Ga0065715_10102590
349 Ga0065707_10083202
350 Ga0070658_10013151
351 Ga0070683_100398629
352 Ga0070690_100016309
353 Ga0070670_100054968
354 Ga0070677_10007806
355 Ga0070677_10044427
356 Ga0068869_100100638
357 Ga0070680_100040832
358 Ga0070680_100170715
359 Ga0070680_100260197
360 Ga0070682_100000104
361 Ga0070682_100474652
362 Ga0070660_100298408
363 Ga0070689_100108178
364 Ga0070687_100056656
365 Ga0070687_100123540
366 Ga0070661_100207802
367 Ga0070661_100315815
368 Ga0070692_10143062
369 Ga0070668_100011371
370 Ga0070669_100111873
371 Ga0070669_100403143
372 Ga0070675_100020846
373 Ga0070675_100170016
374 Ga0070671_100040244
375 Ga0070671_100056381
376 Ga0070674_100008747
377 Ga0070688_100097919
378 Ga0070703_10000244
379 Ga0070703_10027180
380 Ga0070705_100104827
381 Ga0070705_100233013
382 Ga0070700_100016746
383 Ga0070694_100007185
384 Ga0070694_100009781
385 Ga0070694_100113048
386 Ga0070678_100207248
387 Ga0070662_100147258
388 Ga0070662_100554285
389 Ga0070681_10013031
390 Ga0068867_100038648
391 Ga0070685_10010643
392 Ga0070706_100069432
393 Ga0070706_100159591
394 Ga0070707_100000625
395 Ga0070707_100106429
396 Ga0070707_100461461
397 Ga0070707_100625948
398 Ga0070698_100000084
399 Ga0070698_100383199
400 Ga0070679_100280819
401 Ga0070684_100249797
402 Ga0070684_100466933
403 Ga0070697_100004753
404 Ga0068853_100015546
405 Ga0068853_100133046
406 Ga0070686_100115070
407 Ga0070686_100150699
408 Ga0070686_100275956
409 Ga0070686_100297537
410 Ga0070695_100078268
411 Ga0070693_100048079
412 Ga0070704_100019739
413 Ga0070704_100075802
414 Ga0068855_100249808
415 Ga0070664_100030078
416 Ga0070664_100088092
417 Ga0070664_100140219
418 Ga0068857_100086028
419 Ga0068854_100106886
420 Ga0068859_100004245
421 Ga0068859_100019387
422 Ga0068859_100037190
423 Ga0068859_100122407
424 Ga0068864_100026274
425 Ga0068864_100042458
426 Ga0068864_100054238
427 Ga0068864_100163461
428 Ga0068866_10076975
429 Ga0068861_100148320
430 Ga0068863_100138948
431 Ga0068858_100000053
432 Ga0068860_100022840
433 Ga0068860_100032201
434 Ga0068862_100022183
435 Ga0068862_100077378
436 Ga0068862_100232240
437 Ga0081539_10002485
438 Ga0070716_100000010
439 Ga0097621_100111408
440 Ga0068871_100085382
441 Ga0075433_10005936
442 Ga0075433_10139151
443 Ga0075434_100097753
444 Ga0075434_100245891
445 Ga0075429_100118919
446 Ga0068865_100272982
447 Ga0075436_100000017
448 Ga0097620_100004245
449 Ga0097620_100019387
450 Ga0097620_100037190
451 Ga0097620_100063033
452 Ga0097620_100122407
453 Ga0075435_100000286
454 Ga0105240_10090159
455 Ga0111539_10092114
456 Ga0105247_10000052
457 Ga0114129_10019079
458 Ga0114129_10180486
459 Ga0105243_10000319
460 Ga0105243_10010604
461 Ga0105243_10025715
462 Ga0105243_10043897
463 Ga0105243_10141015
464 Ga0105243_10267823
465 Ga0105241_10045833
466 Ga0105242_10000004
467 Ga0105242_10001128
468 Ga0105242_10011012
469 Ga0105242_10393784
470 Ga0105242_10417397
471 Ga0105248_10068357
472 Ga0105248_10383530
473 Ga0105248_10819328
474 Ga0105237_10427898
475 Ga0105249_10000003
476 Ga0105249_10000241
477 Ga0105249_10033215
478 Ga0105249_10085360
479 Ga0105239_10013773
480 Ga0105239_10089017
481 Ga0157369_10062484
482 Ga0157369_10374518
483 Ga0157374_10025839
484 Ga0157374_10294916
485 Ga0157378_10000090
486 Ga0157378_10004645
487 Ga0157378_10057531
488 Ga0157378_10094394
489 Ga0157378_10240049
490 Ga0157378_10328905
491 Ga0163162_10000020
492 Ga0163162_10025917
493 Ga0163162_10038728
494 Ga0163162_10047065
495 Ga0163162_10234997
496 Ga0163162_10333913
497 Ga0157372_10042448
498 Ga0157372_10082173
499 Ga0157372_10239150
500 Ga0157372_10286487
501 Ga0157375_10032551
502 Ga0157375_10082728
503 Ga0157375_10311312
504 Ga0163163_10176284
505 Ga0163163_10340903
506 Ga0157380_10020777
507 Ga0157380_10022333
508 Ga0163161_10007726
509 Ga0163161_10015577
510 Ga0213876_10000104
511 Ga0213876_10000620
512 Ga0213875_10003287
513 Ga0207672_1000063
514 Ga0207653_10000033
515 Ga0207710_10000004
516 Ga0207710_10003153
517 Ga0207688_10307521
518 Ga0207705_10002218
519 Ga0207684_10007989
520 Ga0207654_10009234
521 Ga0207660_10140331
522 Ga0207660_10149880
523 Ga0207662_10103753
524 Ga0207662_10154274
525 Ga0207657_10051403
526 Ga0207652_10368441
527 Ga0207646_10001080
528 Ga0207646_10010348
529 Ga0207646_10232286
530 Ga0207646_10427266
531 Ga0207650_10024522
532 Ga0207650_10247851
533 Ga0207659_10009121
534 Ga0207659_10109812
535 Ga0207644_10000206
536 Ga0207644_10030213
537 Ga0207644_10318664
538 Ga0207706_10112388
539 Ga0207686_10000005
540 Ga0207686_10000619
541 Ga0207686_10000676
542 Ga0207709_10000133
543 Ga0207709_10001583
544 Ga0207709_10013626
545 Ga0207709_10100708
546 Ga0207669_10012540
547 Ga0207704_10290175
548 Ga0207665_10000010
549 Ga0207665_10133347
550 Ga0207691_10047733
551 Ga0207691_10140097
552 Ga0207691_10159817
553 Ga0207711_10075231
554 Ga0207711_10273424
555 Ga0207689_10005738
556 Ga0207689_10483677
557 Ga0207679_10105450
558 Ga0207679_10118547
559 Ga0207667_10389188
560 Ga0207667_10473455
561 Ga0207651_10067250
562 Ga0207712_10000096
563 Ga0207712_10001776
564 Ga0207712_10407732
565 Ga0207668_10024653
566 Ga0207640_10068571
567 Ga0207640_10093724
568 Ga0207677_10659012
569 Ga0207703_10000093
570 Ga0207703_10022344
571 Ga0207703_10060041
572 Ga0207703_10095290
573 Ga0207639_10008762
574 Ga0207639_10013539
575 Ga0207639_10082232
576 Ga0207639_10121755
577 Ga0207708_10196733
578 Ga0207641_10054162
579 Ga0207641_10141624
580 Ga0207648_10193414
581 Ga0207676_10086258
582 Ga0207674_10073567
583 Ga0207675_100001424
584 Ga0207675_100280305
585 Ga0207675_100306577
586 Ga0207683_10019908
587 Ga0207428_10004764
588 Ga0268265_10042682
589 Ga0268265_10230212
590 Ga0268264_10022389
591 Ga0268264_10039067
592 Ga0268264_10192064
593 Ga0265330_10040695
594 Ga0265316_10001397
595 Ga0307408_100163750
596 Ga0307405_10023654
597 Ga0307413_10002521
598 Ga0307413_10005310
599 Ga0307413_10024941
600 Ga0307410_10002585
601 Ga0307410_10005282
602 Ga0307410_10006240
603 Ga0307410_10044201
604 Ga0307410_10149403
605 Ga0307406_10009418
606 Ga0307407_10000707
607 Ga0307407_10008360
608 Ga0307412_10003775
609 Ga0307412_10035033
610 Ga0307412_10145329
611 Ga0307409_100001097
612 Ga0307409_100002019
613 Ga0307409_100210333
614 Ga0307409_100677416
615 Ga0307416_100001651
616 Ga0307414_10014349
617 Ga0307414_10148467
618 Ga0307414_10293916
619 Ga0307411_10003923
620 Ga0307411_10006614
621 Ga0307411_10023621
622 Ga0307411_10042253
623 Ga0307411_10103482
624 Ga0307415_100008659
625 Ga0307415_100021093
626 Ga0395905_0030038
627 Ga0395905_0031369
628 Ga0395905_0123634
629 Ga0436364_0745657
630 Ga0436365_0653517
631 Ga0436365_0748815
632 Ga0436365_1692876
633 Ga0451577_0094939
634 Ga0453683_0011725
635 Ga0451576_0058431
636 Ga0495632_0026131
637 Ga0495663_0000024
638 Ga0495598_0000124
639 Ga0495621_0000409
640 Ga0495645_0236797
641 Ga0496106_0001066
642 Ga0501038_0186787
643 Ga0501039_0083792
644 Ga0501041_0212575
645 Ga0501042_0366583
646 Ga0501071_0105646
647 Ga0501072_0041524
648 Ga0501072_0696683
649 Ga0501074_0160453
650 Ga0501075_0014388
651 Ga0501076_0101522
652 Ga0501202_002913
653 Ga0501223_015907
654 Ga0501233_009484
655 Ga0501235_003134
656 Ga0501240_027242
657 Ga0501247_000119
658 Ga0501249_001326
659 Ga0501250_005965
660 Ga0501252_007396
661 Ga0501257_008784
662 Ga0501257_010672
663 Ga0501221_033438
664 Ga0501229_002283
665 Ga0501080_0537363
666 Ga0501263_011761
667 Ga0501268_000180
668 Ga0501272_003873
669 nmdc:mga05p37_464247_c1
670 nmdc:mga09592_106540_c1
671 nmdc:mga08y16_330589_c1
672 nmdc:mga08y16_36305_c1
673 nmdc:mga0n895_12927_c1
674 nmdc:mga0rr50_116_c1
675 nmdc:mga08x19_40_c1
676 nmdc:mga0a205_180860_c1
677 Ga0495601_0142639
678 Ga0500616_0001590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

42

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pzl-assembly1.cif.gz_B the crystal structure of agmatine ureohydrolase of thermoplasma volcanium 0.9069 8 292
3m1r-assembly2.cif.gz_A the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.8997 21 287
1gq6-assembly1.cif.gz_B proclavaminate amidino hydrolase from streptomyces clavuligerus 0.8908 25 290
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.8892 21 287
8c0h-assembly1.cif.gz_C error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8c0h 0.8871 2 294
ID Description Score Start End Superfamily
1wogB00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.9012 25 289 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8999 27 290 3.40.800.10
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8906 21 289 3.40.800.10
af_Q57757_1_282_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.883 20 285 3.40.800.10
af_Q10088_33_382_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8765 3 290 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A0B6X0Y5-F1-model_v4 Agmatinase (EC 3.5.3.11) 0.9777 10 297 GO:0008783
GO:0033389
GO:0046872
AF-A0A7V9GCP6-F1-model_v4 Arginase family protein 0.975 1 193 GO:0008783
GO:0033389
GO:0046872
AF-A0A2D5XCG1-F1-model_v4 Agmatinase 0.9713 7 290 GO:0008783
GO:0033389
GO:0046872
AF-A0A7L4PR66-F1-model_v4 Agmatinase (EC 3.5.3.11) 0.9696 6 289 GO:0008783
GO:0033389
GO:0046872
AF-A0A7V9P8D9-F1-model_v4 Agmatinase (EC 3.5.3.11) 0.9695 52 300 GO:0008783
GO:0033389
GO:0046872

Map