F413984

General Info

Members Datasets Scaffolds Average Seq Length
339 224 338 115

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10530163|Ga0307514_105301631
Length 127
Sequence MLRPAVRRQGLLLMQLPVAVEALSALAHAIRLAVFRLLVRAGPEGMAAGDIAREVGALPNTLSTHLTILGHAGLVQSRRDGRSVIYSADYDGMRDLLGFLVADCCAGRAEICGSLAEVASGAGCCPS

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
161 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
220 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
221 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.63
Nodule 0.29
Rhizoplane 0.88
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c001967 3300000041 Bacteria 1962
2 JGI24752J21851_1000905 3300001976 Bacteria 4035
3 JGI24739J22299_10000550 3300001989 Bacteria 13408
4 JGI24739J22299_10042301 3300001989 Bacteria 1511
5 JGI24739J22299_10054581 3300001989 Bacteria 1279
6 JGI24737J22298_10007565 3300001990 Bacteria 3662
7 JGI24737J22298_10132257 3300001990 Bacteria 737
8 JGI24743J22301_10099238 3300001991 Bacteria 626
9 JGI24735J21928_10020608 3300002067 Bacteria 2018
10 JGI24735J21928_10055144 3300002067 Bacteria 1145
11 JGI24735J21928_10063090 3300002067 Bacteria 1064
12 JGI24735J21928_10138755 3300002067 Bacteria 701
13 JGI24750J21931_1000018 3300002070 Bacteria 20458
14 JGI24749J21850_1000698 3300002076 Bacteria 4823
15 JGI24744J21845_10009843 3300002077 Bacteria 1962
16 JGI24742J22300_10066923 3300002244 Bacteria 666
17 JGI24751J29686_10000731 3300002459 Bacteria 7933
18 JGI25165J46597_1000073 3300003214 Bacteria 192140
19 JGI25153J46596_10000070 3300003215 Bacteria 117125
20 rootH1_10001906 3300003316 Bacteria 1636
21 rootH2_10205111 3300003320 Bacteria 1538
22 Ga0055537_1001397 3300003773 Bacteria 9564
23 Ga0055524_1001171 3300003775 Bacteria 15663
24 Ga0055530_10007115 3300003791 Bacteria 4794
25 Ga0055531_10010833 3300003794 Bacteria 4481
26 Ga0065165_1022354 3300005262 Bacteria 2170
27 Ga0065707_10084417 3300005295 Bacteria 7223
28 Ga0070658_10000328 3300005327 Bacteria 40677
29 Ga0070658_10000972 3300005327 Bacteria 24584
30 Ga0070658_10145526 3300005327 Bacteria 1981
31 Ga0070658_10449616 3300005327 Bacteria 1110
32 Ga0070676_10006126 3300005328 Bacteria 6423
33 Ga0070690_100000005 3300005330 Bacteria 142006
34 Ga0070670_100000005 3300005331 Bacteria 351569
35 Ga0070670_101393310 3300005331 Unclassified 643
36 Ga0070677_10294535 3300005333 Bacteria 822
37 Ga0068869_100000306 3300005334 Bacteria 26133
38 Ga0068869_101611417 3300005334 Bacteria 578
39 Ga0070666_10000084 3300005335 Bacteria 66975
40 Ga0068868_100162689 3300005338 Bacteria 1844
41 Ga0070660_100000890 3300005339 Bacteria 19982
42 Ga0070660_100204121 3300005339 Bacteria 1604
43 Ga0070660_100506486 3300005339 Bacteria 1004
44 Ga0070660_100676756 3300005339 Bacteria 865
45 Ga0070660_101275794 3300005339 Bacteria 623
46 Ga0070660_101861665 3300005339 Bacteria 513
47 Ga0070661_100067715 3300005344 Bacteria 2624
48 Ga0070668_100114672 3300005347 Bacteria 2147
49 Ga0070668_100143481 3300005347 Bacteria 1926
50 Ga0070669_100000141 3300005353 Bacteria 64131
51 Ga0070669_100525351 3300005353 Bacteria 984
52 Ga0070675_100462836 3300005354 Bacteria 1139
53 Ga0070671_100052395 3300005355 Bacteria 3393
54 Ga0070671_100083695 3300005355 Bacteria 2668
55 Ga0070674_100008757 3300005356 Bacteria 6037
56 Ga0070673_100000022 3300005364 Bacteria 92156
57 Ga0070659_100031931 3300005366 Bacteria 4081
58 Ga0070659_100170539 3300005366 Bacteria 1782
59 Ga0070659_100495663 3300005366 Bacteria 1041
60 Ga0070659_100902657 3300005366 Bacteria 772
61 Ga0070667_100003022 3300005367 Bacteria 14455
62 Ga0070667_100006995 3300005367 Bacteria 9377
63 Ga0070663_102083148 3300005455 Unclassified 511
64 Ga0070678_100169782 3300005456 Bacteria 1775
65 Ga0070662_100051361 3300005457 Bacteria 2977
66 Ga0070662_101024882 3300005457 Unclassified 707
67 Ga0070681_10517142 3300005458 Bacteria 1107
68 Ga0068867_100000023 3300005459 Bacteria 92322
69 Ga0068867_101148832 3300005459 Bacteria 711
70 Ga0070685_10034769 3300005466 Bacteria 2840
71 Ga0070679_100299044 3300005530 Bacteria 1560
72 Ga0070679_101116366 3300005530 Bacteria 733
73 Ga0068853_100116719 3300005539 Bacteria 2377
74 Ga0068853_100348462 3300005539 Bacteria 1377
75 Ga0068853_100547725 3300005539 Bacteria 1096
76 Ga0068853_101506948 3300005539 Bacteria 651
77 Ga0070672_100013718 3300005543 Bacteria 5729
78 Ga0070672_100406671 3300005543 Bacteria 1167
79 Ga0070672_101006731 3300005543 Bacteria 738
80 Ga0070686_100000001 3300005544 Bacteria 515830
81 Ga0070664_102307377 3300005564 Bacteria 510
82 Ga0068857_100274105 3300005577 Bacteria 1551
83 Ga0068857_100356536 3300005577 Bacteria 1355
84 Ga0068854_100097559 3300005578 Bacteria 2197
85 Ga0068854_100209394 3300005578 Bacteria 1537
86 Ga0068856_100047153 3300005614 Bacteria 4245
87 Ga0068856_100226667 3300005614 Bacteria 1884
88 Ga0068852_100008765 3300005616 Bacteria 7481
89 Ga0068852_100084855 3300005616 Bacteria 2820
90 Ga0068852_102292346 3300005616 Bacteria 561
91 Ga0068859_100000375 3300005617 Bacteria 44582
92 Ga0068864_100000011 3300005618 Bacteria 350056
93 Ga0068861_100003145 3300005719 Bacteria 10912
94 Ga0068861_100100272 3300005719 Bacteria 2301
95 Ga0068863_100000046 3300005841 Bacteria 143895
96 Ga0068858_100005317 3300005842 Bacteria 12622
97 Ga0068860_100000333 3300005843 Bacteria 64236
98 Ga0068860_101554154 3300005843 Bacteria 683
99 Ga0068862_100000011 3300005844 Bacteria 270105
100 Ga0068862_100000953 3300005844 Bacteria 27817
101 Ga0075370_10078027 3300006353 Bacteria 1901
102 Ga0068871_100496473 3300006358 Bacteria 1099
103 Ga0068865_100000031 3300006881 Bacteria 88580
104 Ga0097620_100000375 3300006931 Bacteria 44582
105 Ga0099826_10421751 3300006948 Bacteria 642
106 Ga0105240_10994311 3300009093 Bacteria 897
107 Ga0105245_10009117 3300009098 Bacteria 8651
108 Ga0105245_10015460 3300009098 Bacteria 6654
109 Ga0105243_10000156 3300009148 Bacteria 78467
110 Ga0105243_10138374 3300009148 Bacteria 2074
111 Ga0105242_10007978 3300009176 Bacteria 8156
112 Ga0105242_10491001 3300009176 Bacteria 1166
113 Ga0105242_12221606 3300009176 Bacteria 594
114 Ga0105248_10000069 3300009177 Bacteria 120989
115 Ga0105237_10296590 3300009545 Bacteria 1619
116 Ga0105238_10009566 3300009551 Bacteria 9696
117 Ga0105249_10000353 3300009553 Bacteria 46052
118 Ga0105249_10333702 3300009553 Bacteria 1531
119 Ga0157373_10121988 3300013100 Bacteria 1832
120 Ga0157373_10370875 3300013100 Bacteria 1023
121 Ga0157371_10183342 3300013102 Bacteria 1497
122 Ga0157370_10000017 3300013104 Bacteria 169971
123 Ga0157369_10168637 3300013105 Bacteria 2308
124 Ga0157374_10013587 3300013296 Bacteria 7111
125 Ga0157378_10049461 3300013297 Bacteria 3740
126 Ga0157378_10069097 3300013297 Bacteria 3168
127 Ga0157372_10040515 3300013307 Bacteria 5146
128 Ga0157372_10436179 3300013307 Bacteria 1527
129 Ga0157372_11355100 3300013307 Unclassified 821
130 Ga0157375_10002652 3300013308 Bacteria 15491
131 Ga0163163_10234591 3300014325 Bacteria 1884
132 Ga0163163_12428191 3300014325 Unclassified 582
133 Ga0157380_10001128 3300014326 Bacteria 17241
134 Ga0157379_10097105 3300014968 Bacteria 2644
135 Ga0157376_10000124 3300014969 Bacteria 53299
136 Ga0163161_10000388 3300017792 Bacteria 36948
137 Ga0163161_10465523 3300017792 Bacteria 1024
138 Ga0207672_1000809 3300025223 Bacteria 3333
139 Ga0209437_103965 3300025233 Bacteria 2630
140 Ga0209148_1000059 3300025254 Bacteria 350224
141 Ga0209148_1004492 3300025254 Bacteria 3426
142 Ga0209148_1036970 3300025254 Bacteria 695
143 Ga0209233_1000142 3300025261 Bacteria 192193
144 Ga0209565_1000007 3300025263 Bacteria 784361
145 Ga0209455_1007020 3300025272 Bacteria 3241
146 Ga0209455_1020434 3300025272 Bacteria 1310
147 Ga0209673_1005398 3300025273 Bacteria 6442
148 Ga0209675_1004240 3300025291 Bacteria 6463
149 Ga0209564_1047786 3300025295 Bacteria 1074
150 Ga0209758_1000023 3300025297 Bacteria 612453
151 Ga0209758_1110252 3300025297 Bacteria 763
152 Ga0209050_1009345 3300025298 Bacteria 5034
153 Ga0209256_1000009 3300025299 Bacteria 922071
154 Ga0209256_1000010 3300025299 Bacteria 912110
155 Ga0209257_1023522 3300025304 Bacteria 2163
156 Ga0207656_10699386 3300025321 Bacteria 519
157 Ga0207682_10329206 3300025893 Bacteria 718
158 Ga0207688_10197819 3300025901 Bacteria 1204
159 Ga0207680_10000008 3300025903 Bacteria 518177
160 Ga0207647_10003125 3300025904 Bacteria 12436
161 Ga0207647_10138240 3300025904 Bacteria 1429
162 Ga0207647_10162042 3300025904 Bacteria 1304
163 Ga0207645_10010196 3300025907 Bacteria 6458
164 Ga0207705_10000046 3300025909 Bacteria 177574
165 Ga0207705_10000244 3300025909 Bacteria 53451
166 Ga0207705_10007676 3300025909 Bacteria 7929
167 Ga0207705_10169213 3300025909 Bacteria 1645
168 Ga0207671_10100099 3300025914 Bacteria 2194
169 Ga0207657_10003602 3300025919 Bacteria 16504
170 Ga0207657_10185020 3300025919 Bacteria 1682
171 Ga0207657_10289417 3300025919 Bacteria 1299
172 Ga0207657_10382975 3300025919 Bacteria 1107
173 Ga0207657_10531754 3300025919 Bacteria 920
174 Ga0207649_10036457 3300025920 Bacteria 2962
175 Ga0207652_10936562 3300025921 Bacteria 764
176 Ga0207681_10000001 3300025923 Bacteria 1105841
177 Ga0207681_10695704 3300025923 Bacteria 845
178 Ga0207694_10010185 3300025924 Bacteria 7085
179 Ga0207650_10000018 3300025925 Bacteria 352120
180 Ga0207650_10130357 3300025925 Bacteria 1967
181 Ga0207659_10012851 3300025926 Bacteria 5346
182 Ga0207687_10007954 3300025927 Bacteria 6942
183 Ga0207644_10008403 3300025931 Bacteria 6756
184 Ga0207644_10064197 3300025931 Bacteria 2668
185 Ga0207690_10049302 3300025932 Bacteria 2807
186 Ga0207690_10222986 3300025932 Bacteria 1443
187 Ga0207690_10346881 3300025932 Bacteria 1173
188 Ga0207706_10053928 3300025933 Bacteria 3549
189 Ga0207706_10187379 3300025933 Bacteria 1817
190 Ga0207686_10010088 3300025934 Bacteria 5138
191 Ga0207686_10326987 3300025934 Bacteria 1148
192 Ga0207709_10000100 3300025935 Bacteria 135080
193 Ga0207669_10343034 3300025937 Bacteria 1151
194 Ga0207704_10000008 3300025938 Bacteria 204682
195 Ga0207691_10168793 3300025940 Bacteria 1917
196 Ga0207711_10001189 3300025941 Bacteria 24690
197 Ga0207689_10000349 3300025942 Bacteria 43180
198 Ga0207689_10685195 3300025942 Bacteria 864
199 Ga0207667_11909741 3300025949 Bacteria 556
200 Ga0207651_10000008 3300025960 Bacteria 204538
201 Ga0207712_10000009 3300025961 Bacteria 518177
202 Ga0207712_10215758 3300025961 Bacteria 1531
203 Ga0207712_11274739 3300025961 Unclassified 656
204 Ga0207668_10106454 3300025972 Bacteria 2095
205 Ga0207668_10460170 3300025972 Bacteria 1087
206 Ga0207640_10469692 3300025981 Bacteria 1041
207 Ga0207658_10000956 3300025986 Bacteria 23857
208 Ga0207658_10009398 3300025986 Bacteria 6632
209 Ga0207677_10000091 3300026023 Bacteria 74163
210 Ga0207677_10049160 3300026023 Bacteria 2844
211 Ga0207703_10005709 3300026035 Bacteria 9983
212 Ga0207639_10079488 3300026041 Bacteria 2592
213 Ga0207639_10525766 3300026041 Bacteria 1084
214 Ga0207639_10716931 3300026041 Bacteria 929
215 Ga0207678_11378003 3300026067 Bacteria 624
216 Ga0207702_10063598 3300026078 Bacteria 3156
217 Ga0207702_10086195 3300026078 Bacteria 2738
218 Ga0207641_10000145 3300026088 Bacteria 100817
219 Ga0207648_10000009 3300026089 Bacteria 204229
220 Ga0207648_10661452 3300026089 Bacteria 966
221 Ga0207676_10000004 3300026095 Bacteria 725417
222 Ga0207676_10001200 3300026095 Bacteria 19451
223 Ga0207674_10071880 3300026116 Bacteria 3476
224 Ga0207674_10417406 3300026116 Bacteria 1297
225 Ga0207674_11365513 3300026116 Bacteria 678
226 Ga0207674_11809832 3300026116 Bacteria 578
227 Ga0207675_100002198 3300026118 Bacteria 19378
228 Ga0207683_10012044 3300026121 Bacteria 7382
229 Ga0207683_11519126 3300026121 Unclassified 618
230 Ga0207698_10062077 3300026142 Bacteria 2916
231 Ga0207698_10510759 3300026142 Bacteria 1171
232 Ga0268265_10000002 3300028380 Bacteria 1035381
233 Ga0268265_10000489 3300028380 Bacteria 41369
234 Ga0268264_10000003 3300028381 Bacteria 1141976
235 Ga0268264_11385528 3300028381 Bacteria 714
236 Ga0307513_10002089 3300031456 Bacteria 28063
237 Ga0307513_10328777 3300031456 Bacteria 1284
238 Ga0307509_10116740 3300031507 Bacteria 2657
239 Ga0307508_10001675 3300031616 Bacteria 24607
240 Ga0307514_10530163 3300031649 Bacteria 550
241 Ga0307412_10035301 3300031911 Bacteria 3193
242 Ga0307416_100255699 3300032002 Bacteria 1708
243 Ga0307510_10078200 3300033180 Bacteria 3238
244 Ga0373931_0208211 3300035691 Bacteria 1172
245 Ga0395900_0087145 3300037418 Bacteria 3209
246 Ga0395905_0405578 3300037471 Bacteria 1258
247 Ga0395901_0020753 3300038443 Bacteria 6726
248 Ga0395901_0490360 3300038443 Bacteria 1252
249 Ga0436365_1821732 3300039437 Bacteria 1068
250 Ga0439447_109145 3300041407 Bacteria 635
251 Ga0439461_0000272 3300041410 Bacteria 7462
252 Ga0451800_0107021 3300041459 Bacteria 623
253 Ga0439431_0000160 3300041997 Bacteria 12587
254 Ga0439442_005185 3300042002 Bacteria 2611
255 Ga0439448_0000346 3300042005 Bacteria 10365
256 Ga0439448_0053359 3300042005 Bacteria 1326
257 Ga0439448_0062486 3300042005 Bacteria 1232
258 Ga0439432_000807 3300042006 Bacteria 11686
259 Ga0439449_0097313 3300042007 Bacteria 1087
260 Ga0439450_047888 3300042008 Bacteria 1008
261 Ga0439450_098307 3300042008 Bacteria 741
262 Ga0439455_0000331 3300042012 Bacteria 6039
263 Ga0439455_0025458 3300042012 Bacteria 1438
264 Ga0439455_0063990 3300042012 Bacteria 979
265 Ga0439462_0078493 3300042015 Bacteria 900
266 Ga0439446_0030898 3300042156 Bacteria 1549
267 Ga0439458_0000297 3300042157 Bacteria 12378
268 Ga0439458_0002161 3300042157 Bacteria 4858
269 Ga0439458_0006421 3300042157 Bacteria 2623
270 Ga0439434_0011880 3300042435 Bacteria 2574
271 Ga0439459_0159103 3300042438 Bacteria 595
272 Ga0466972_0000616 3300044658 Bacteria 17397
273 Ga0466970_0269567 3300044765 Bacteria 956
274 Ga0466957_0358092 3300044842 Bacteria 991
275 Ga0466960_0019163 3300044901 Bacteria 3010
276 Ga0495638_0000758 3300046460 Bacteria 34400
277 Ga0495662_0296077 3300046476 Bacteria 796
278 Ga0495584_0024303 3300046491 Bacteria 3073
279 Ga0495583_0000627 3300046506 Bacteria 47369
280 Ga0495583_0014811 3300046506 Bacteria 4276
281 Ga0495606_0000092 3300046507 Bacteria 152369
282 Ga0495616_0186439 3300046513 Bacteria 919
283 Ga0495618_0375990 3300046514 Bacteria 872
284 Ga0495643_0030668 3300046522 Bacteria 3000
285 Ga0495643_0088860 3300046522 Bacteria 1596
286 Ga0495643_0233342 3300046522 Bacteria 866
287 Ga0495663_0027811 3300046525 Bacteria 1661
288 Ga0495642_0041529 3300046528 Bacteria 1871
289 Ga0495652_0600535 3300046529 Bacteria 751
290 Ga0495587_0086813 3300046536 Bacteria 1811
291 Ga0495622_0005223 3300046557 Bacteria 6020
292 Ga0495668_0011742 3300046616 Bacteria 5229
293 Ga0495668_0030204 3300046616 Bacteria 3061
294 Ga0495625_0000083 3300046660 Bacteria 152144
295 Ga0495625_0062262 3300046660 Bacteria 2638
296 Ga0495625_0118903 3300046660 Bacteria 1800
297 Ga0495625_0304881 3300046660 Bacteria 1018
298 Ga0495670_0745019 3300046691 Bacteria 534
299 Ga0495589_0115171 3300046794 Bacteria 1296
300 Ga0495687_053127 3300047443 Bacteria 1708
301 Ga0495677_0000643 3300047445 Bacteria 14100
302 Ga0495686_0017966 3300047472 Bacteria 4755
303 Ga0495686_0101832 3300047472 Bacteria 1731
304 Ga0496101_1393840 3300048904 Bacteria 547
305 Ga0496107_1302206 3300048910 Bacteria 520
306 Ga0496118_0549822 3300048921 Bacteria 563
307 Ga0496121_0036607 3300048924 Bacteria 4371
308 Ga0496125_0146094 3300048928 Bacteria 1634
309 Ga0496126_0951065 3300048929 Unclassified 648
310 Ga0501073_0911232 3300049589 Bacteria 605
311 nmdc:mga07m45_144397_c1 3300050496 Bacteria 1379
312 nmdc:mga07m45_67759_c2 3300050496 Bacteria 1300
313 Ga0500643_001305 3300053087 Bacteria 14675
314 Ga0500643_006180 3300053087 Bacteria 5047
315 Ga0500643_216704 3300053087 Bacteria 514
316 Ga0500646_0139181 3300053090 Bacteria 795
317 Ga0500646_0271784 3300053090 Unclassified 601
318 Ga0500641_0002276 3300053096 Bacteria 6809
319 Ga0500641_0184139 3300053096 Bacteria 896
320 Ga0500556_0022778 3300053104 Bacteria 2038
321 Ga0500562_189478 3300053108 Bacteria 558
322 Ga0500594_0067451 3300053118 Bacteria 1045
323 Ga0500595_000551 3300053119 Bacteria 22467
324 Ga0500595_002194 3300053119 Bacteria 9916
325 Ga0500658_0014431 3300053134 Bacteria 2924
326 Ga0500559_0007196 3300053136 Bacteria 4954
327 Ga0500559_0065557 3300053136 Bacteria 1627
328 Ga0500568_0153352 3300053139 Bacteria 852
329 Ga0500604_0025689 3300053151 Bacteria 1694
330 Ga0500616_0005519 3300053153 Bacteria 8568
331 Ga0500616_0038094 3300053153 Bacteria 2599
332 Ga0500616_0166845 3300053153 Bacteria 1004
333 Ga0500619_002752 3300053154 Bacteria 3457
334 Ga0500624_000032 3300053157 Bacteria 104403
335 Ga0500627_0121061 3300053158 Bacteria 1180
336 Ga0500637_0001528 3300053178 Bacteria 9878
337 Ga0500645_045008 3300053730 Bacteria 1297
338 Ga0500596_000774 3300053735 Bacteria 6300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10097105 Ga0157379_100971054 101
2 3300026118 Ga0207675_100002198 Ga0207675_1000021988 101
3 3300005466 Ga0070685_10034769 Ga0070685_100347693 104
4 3300013100 Ga0157373_10370875 Ga0157373_103708752 107
5 3300048928 Ga0496125_0146094 Ga0496125_0146094_755_1078 107
6 3300003215 JGI25153J46596_10000070 JGI25153J46596_100000708 108
7 3300005327 Ga0070658_10449616 Ga0070658_104496161 108
8 3300005333 Ga0070677_10294535 Ga0070677_102945352 108
9 3300005334 Ga0068869_101611417 Ga0068869_1016114172 108
10 3300005338 Ga0068868_100162689 Ga0068868_1001626892 108
11 3300005344 Ga0070661_100067715 Ga0070661_1000677154 108
12 3300005459 Ga0068867_101148832 Ga0068867_1011488321 108
13 3300005578 Ga0068854_100209394 Ga0068854_1002093944 108
14 3300005842 Ga0068858_100005317 Ga0068858_1000053176 108
15 3300006358 Ga0068871_100496473 Ga0068871_1004964732 108
16 3300009098 Ga0105245_10009117 Ga0105245_1000911710 108
17 3300009148 Ga0105243_10138374 Ga0105243_101383742 108
18 3300009176 Ga0105242_10491001 Ga0105242_104910013 108
19 3300009551 Ga0105238_10009566 Ga0105238_100095665 108
20 3300013297 Ga0157378_10069097 Ga0157378_100690972 108
21 3300025254 Ga0209148_1036970 Ga0209148_10369702 108
22 3300025297 Ga0209758_1000023 Ga0209758_1000023384 108
23 3300025321 Ga0207656_10699386 Ga0207656_106993861 108
24 3300025893 Ga0207682_10329206 Ga0207682_103292062 108
25 3300025920 Ga0207649_10036457 Ga0207649_100364574 108
26 3300025924 Ga0207694_10010185 Ga0207694_100101856 108
27 3300025927 Ga0207687_10007954 Ga0207687_100079546 108
28 3300025934 Ga0207686_10326987 Ga0207686_103269873 108
29 3300025942 Ga0207689_10685195 Ga0207689_106851952 108
30 3300025949 Ga0207667_11909741 Ga0207667_119097411 108
31 3300026023 Ga0207677_10049160 Ga0207677_100491604 108
32 3300026035 Ga0207703_10005709 Ga0207703_100057094 108
33 3300026041 Ga0207639_10716931 Ga0207639_107169312 108
34 3300026089 Ga0207648_10661452 Ga0207648_106614522 108
35 3300026116 Ga0207674_11809832 Ga0207674_118098321 108
36 3300031456 Ga0307513_10002089 Ga0307513_100020894 108
37 3300031456 Ga0307513_10328777 Ga0307513_103287772 108
38 3300031507 Ga0307509_10116740 Ga0307509_101167404 108
39 3300031616 Ga0307508_10001675 Ga0307508_1000167521 108
40 3300037471 Ga0395905_0405578 Ga0395905_0405578_138_509 108
41 3300046476 Ga0495662_0296077 Ga0495662_0296077_73_447 108
42 3300046491 Ga0495584_0024303 Ga0495584_0024303_2653_2988 108
43 3300046506 Ga0495583_0000627 Ga0495583_0000627_35076_35450 108
44 3300046506 Ga0495583_0014811 Ga0495583_0014811_3307_3651 108
45 3300046507 Ga0495606_0000092 Ga0495606_0000092_79167_79541 108
46 3300046513 Ga0495616_0186439 Ga0495616_0186439_135_470 108
47 3300046514 Ga0495618_0375990 Ga0495618_0375990_380_754 108
48 3300046522 Ga0495643_0030668 Ga0495643_0030668_1885_2220 108
49 3300046522 Ga0495643_0088860 Ga0495643_0088860_917_1252 108
50 3300046522 Ga0495643_0233342 Ga0495643_0233342_367_702 108
51 3300046528 Ga0495642_0041529 Ga0495642_0041529_1232_1567 108
52 3300046536 Ga0495587_0086813 Ga0495587_0086813_91_465 108
53 3300046557 Ga0495622_0005223 Ga0495622_0005223_2797_3171 108
54 3300046616 Ga0495668_0030204 Ga0495668_0030204_2182_2550 108
55 3300046660 Ga0495625_0118903 Ga0495625_0118903_1112_1447 108
56 3300046660 Ga0495625_0304881 Ga0495625_0304881_37_411 108
57 3300046691 Ga0495670_0745019 Ga0495670_0745019_98_424 108
58 3300047445 Ga0495677_0000643 Ga0495677_0000643_3211_3546 108
59 3300048910 Ga0496107_1302206 Ga0496107_1302206_13_468 108
60 3300048924 Ga0496121_0036607 Ga0496121_0036607_1777_2130 108
61 3300053096 Ga0500641_0184139 Ga0500641_0184139_484_810 108
62 3300053104 Ga0500556_0022778 Ga0500556_0022778_1518_1844 108
63 3300053118 Ga0500594_0067451 Ga0500594_0067451_78_404 108
64 3300053119 Ga0500595_000551 Ga0500595_000551_4424_4798 108
65 3300053136 Ga0500559_0065557 Ga0500559_0065557_1100_1447 108
66 3300053154 Ga0500619_002752 Ga0500619_002752_2622_2957 108
67 3300053730 Ga0500645_045008 Ga0500645_045008_135_461 108
68 3300053735 Ga0500596_000774 Ga0500596_000774_2167_2541 108
69 3300005578 Ga0068854_100097559 Ga0068854_1000975593 109
70 3300005616 Ga0068852_100084855 Ga0068852_1000848552 109
71 3300025981 Ga0207640_10469692 Ga0207640_104696923 109
72 3300026142 Ga0207698_10510759 Ga0207698_105107593 109
73 3300033180 Ga0307510_10078200 Ga0307510_100782001 109
74 iso_pu_bacteria 2643221622 2644125350 109
75 3300003316 rootH1_10001906 rootH1_100019062 110
76 3300005539 Ga0068853_101506948 Ga0068853_1015069482 110
77 3300035691 Ga0373931_0208211 Ga0373931_0208211_301_633 110
78 3300038443 Ga0395901_0490360 Ga0395901_0490360_59_436 110
79 3300041459 Ga0451800_0107021 Ga0451800_0107021_259_597 110
80 3300049589 Ga0501073_0911232 Ga0501073_0911232_244_588 110
81 3300001976 JGI24752J21851_1000905 JGI24752J21851_10009054 111
82 3300002070 JGI24750J21931_1000018 JGI24750J21931_10000183 111
83 3300002076 JGI24749J21850_1000698 JGI24749J21850_10006983 111
84 3300002459 JGI24751J29686_10000731 JGI24751J29686_100007314 111
85 3300005295 Ga0065707_10084417 Ga0065707_100844174 111
86 3300005327 Ga0070658_10145526 Ga0070658_101455263 111
87 3300005330 Ga0070690_100000005 Ga0070690_10000000587 111
88 3300005331 Ga0070670_100000005 Ga0070670_10000000576 111
89 3300005335 Ga0070666_10000084 Ga0070666_1000008443 111
90 3300005347 Ga0070668_100114672 Ga0070668_1001146723 111
91 3300005347 Ga0070668_100143481 Ga0070668_1001434812 111
92 3300005353 Ga0070669_100000141 Ga0070669_10000014113 111
93 3300005355 Ga0070671_100052395 Ga0070671_1000523956 111
94 3300005367 Ga0070667_100003022 Ga0070667_10000302215 111
95 3300005367 Ga0070667_100006995 Ga0070667_1000069956 111
96 3300005458 Ga0070681_10517142 Ga0070681_105171422 111
97 3300005530 Ga0070679_101116366 Ga0070679_1011163662 111
98 3300005539 Ga0068853_100348462 Ga0068853_1003484622 111
99 3300005543 Ga0070672_100406671 Ga0070672_1004066712 111
100 3300005544 Ga0070686_100000001 Ga0070686_100000001215 111
101 3300005617 Ga0068859_100000375 Ga0068859_10000037515 111
102 3300005618 Ga0068864_100000011 Ga0068864_10000001175 111
103 3300005719 Ga0068861_100003145 Ga0068861_1000031459 111
104 3300005719 Ga0068861_100100272 Ga0068861_1001002722 111
105 3300005841 Ga0068863_100000046 Ga0068863_10000004654 111
106 3300005843 Ga0068860_100000333 Ga0068860_10000033342 111
107 3300005843 Ga0068860_101554154 Ga0068860_1015541542 111
108 3300005844 Ga0068862_100000011 Ga0068862_100000011159 111
109 3300005844 Ga0068862_100000953 Ga0068862_10000095334 111
110 3300006931 Ga0097620_100000375 Ga0097620_10000037515 111
111 3300009177 Ga0105248_10000069 Ga0105248_1000006938 111
112 3300009553 Ga0105249_10000353 Ga0105249_1000035320 111
113 3300013297 Ga0157378_10049461 Ga0157378_100494613 111
114 3300014325 Ga0163163_10234591 Ga0163163_102345913 111
115 3300014326 Ga0157380_10001128 Ga0157380_100011287 111
116 3300017792 Ga0163161_10000388 Ga0163161_1000038839 111
117 3300017792 Ga0163161_10465523 Ga0163161_104655232 111
118 3300025223 Ga0207672_1000809 Ga0207672_10008093 111
119 3300025254 Ga0209148_1004492 Ga0209148_10044924 111
120 3300025272 Ga0209455_1020434 Ga0209455_10204342 111
121 3300025903 Ga0207680_10000008 Ga0207680_10000008209 111
122 3300025909 Ga0207705_10007676 Ga0207705_100076767 111
123 3300025921 Ga0207652_10936562 Ga0207652_109365622 111
124 3300025923 Ga0207681_10000001 Ga0207681_10000001582 111
125 3300025925 Ga0207650_10000018 Ga0207650_1000001877 111
126 3300025931 Ga0207644_10008403 Ga0207644_100084039 111
127 3300025941 Ga0207711_10001189 Ga0207711_1000118913 111
128 3300025961 Ga0207712_10000009 Ga0207712_10000009209 111
129 3300025972 Ga0207668_10106454 Ga0207668_101064543 111
130 3300025972 Ga0207668_10460170 Ga0207668_104601702 111
131 3300025986 Ga0207658_10000956 Ga0207658_1000095624 111
132 3300025986 Ga0207658_10009398 Ga0207658_100093986 111
133 3300026088 Ga0207641_10000145 Ga0207641_1000014515 111
134 3300026095 Ga0207676_10000004 Ga0207676_10000004470 111
135 3300026095 Ga0207676_10001200 Ga0207676_1000120015 111
136 3300026121 Ga0207683_11519126 Ga0207683_115191261 111
137 3300028380 Ga0268265_10000002 Ga0268265_10000002599 111
138 3300028380 Ga0268265_10000489 Ga0268265_1000048933 111
139 3300028381 Ga0268264_10000003 Ga0268264_10000003831 111
140 3300028381 Ga0268264_11385528 Ga0268264_113855282 111
141 3300044658 Ga0466972_0000616 Ga0466972_0000616_6317_6652 111
142 3300044765 Ga0466970_0269567 Ga0466970_0269567_418_753 111
143 3300044901 Ga0466960_0019163 Ga0466960_0019163_2588_2923 111
144 3300046616 Ga0495668_0011742 Ga0495668_0011742_3803_4153 111
145 3300046794 Ga0495589_0115171 Ga0495589_0115171_293_643 111
146 3300047443 Ga0495687_053127 Ga0495687_053127_512_847 111
147 3300048904 Ga0496101_1393840 Ga0496101_1393840_57_401 111
148 3300048921 Ga0496118_0549822 Ga0496118_0549822_86_442 111
149 3300053087 Ga0500643_001305 Ga0500643_001305_10925_11308 111
150 3300053087 Ga0500643_216704 Ga0500643_216704_72_419 111
151 3300053090 Ga0500646_0271784 Ga0500646_0271784_178_528 111
152 3300053108 Ga0500562_189478 Ga0500562_189478_147_524 111
153 3300053139 Ga0500568_0153352 Ga0500568_0153352_477_824 111
154 3300053151 Ga0500604_0025689 Ga0500604_0025689_974_1324 111
155 3300053153 Ga0500616_0005519 Ga0500616_0005519_5061_5438 111
156 3300053158 Ga0500627_0121061 Ga0500627_0121061_258_608 111
157 3300005530 Ga0070679_100299044 Ga0070679_1002990442 112
158 3300013104 Ga0157370_10000017 Ga0157370_1000001774 112
159 3300013307 Ga0157372_10040515 Ga0157372_100405155 112
160 3300047472 Ga0495686_0101832 Ga0495686_0101832_784_1122 112
161 3300053136 Ga0500559_0007196 Ga0500559_0007196_2412_2777 112
162 3300000041 ARcpr5oldR_c001967 ARcpr5oldR_0019673 113
163 3300001989 JGI24739J22299_10000550 JGI24739J22299_100005507 113
164 3300001989 JGI24739J22299_10042301 JGI24739J22299_100423013 113
165 3300001989 JGI24739J22299_10054581 JGI24739J22299_100545811 113
166 3300001990 JGI24737J22298_10007565 JGI24737J22298_100075653 113
167 3300001990 JGI24737J22298_10132257 JGI24737J22298_101322571 113
168 3300001991 JGI24743J22301_10099238 JGI24743J22301_100992382 113
169 3300002067 JGI24735J21928_10020608 JGI24735J21928_100206083 113
170 3300002067 JGI24735J21928_10055144 JGI24735J21928_100551443 113
171 3300002067 JGI24735J21928_10063090 JGI24735J21928_100630902 113
172 3300002067 JGI24735J21928_10138755 JGI24735J21928_101387552 113
173 3300002077 JGI24744J21845_10009843 JGI24744J21845_100098433 113
174 3300002244 JGI24742J22300_10066923 JGI24742J22300_100669232 113
175 3300003214 JGI25165J46597_1000073 JGI25165J46597_1000073157 113
176 3300003320 rootH2_10205111 rootH2_102051113 113
177 3300003773 Ga0055537_1001397 Ga0055537_100139711 113
178 3300003775 Ga0055524_1001171 Ga0055524_10011716 113
179 3300003791 Ga0055530_10007115 Ga0055530_100071154 113
180 3300003794 Ga0055531_10010833 Ga0055531_100108334 113
181 3300005262 Ga0065165_1022354 Ga0065165_10223542 113
182 3300005327 Ga0070658_10000328 Ga0070658_1000032848 113
183 3300005327 Ga0070658_10000972 Ga0070658_1000097221 113
184 3300005328 Ga0070676_10006126 Ga0070676_100061265 113
185 3300005331 Ga0070670_101393310 Ga0070670_1013933102 113
186 3300005334 Ga0068869_100000306 Ga0068869_1000003065 113
187 3300005339 Ga0070660_100000890 Ga0070660_1000008908 113
188 3300005339 Ga0070660_100204121 Ga0070660_1002041213 113
189 3300005339 Ga0070660_100506486 Ga0070660_1005064862 113
190 3300005339 Ga0070660_100676756 Ga0070660_1006767562 113
191 3300005339 Ga0070660_101275794 Ga0070660_1012757942 113
192 3300005339 Ga0070660_101861665 Ga0070660_1018616651 113
193 3300005353 Ga0070669_100525351 Ga0070669_1005253512 113
194 3300005354 Ga0070675_100462836 Ga0070675_1004628362 113
195 3300005355 Ga0070671_100083695 Ga0070671_1000836952 113
196 3300005356 Ga0070674_100008757 Ga0070674_1000087572 113
197 3300005364 Ga0070673_100000022 Ga0070673_10000002222 113
198 3300005366 Ga0070659_100031931 Ga0070659_1000319313 113
199 3300005366 Ga0070659_100170539 Ga0070659_1001705393 113
200 3300005366 Ga0070659_100495663 Ga0070659_1004956632 113
201 3300005366 Ga0070659_100902657 Ga0070659_1009026572 113
202 3300005455 Ga0070663_102083148 Ga0070663_1020831481 113
203 3300005456 Ga0070678_100169782 Ga0070678_1001697822 113
204 3300005457 Ga0070662_100051361 Ga0070662_1000513613 113
205 3300005457 Ga0070662_101024882 Ga0070662_1010248822 113
206 3300005459 Ga0068867_100000023 Ga0068867_10000002376 113
207 3300005539 Ga0068853_100116719 Ga0068853_1001167192 113
208 3300005539 Ga0068853_100547725 Ga0068853_1005477252 113
209 3300005543 Ga0070672_100013718 Ga0070672_1000137183 113
210 3300005543 Ga0070672_101006731 Ga0070672_1010067312 113
211 3300005564 Ga0070664_102307377 Ga0070664_1023073772 113
212 3300005577 Ga0068857_100274105 Ga0068857_1002741053 113
213 3300005577 Ga0068857_100356536 Ga0068857_1003565362 113
214 3300005614 Ga0068856_100047153 Ga0068856_1000471534 113
215 3300005614 Ga0068856_100226667 Ga0068856_1002266674 113
216 3300005616 Ga0068852_100008765 Ga0068852_1000087659 113
217 3300005616 Ga0068852_102292346 Ga0068852_1022923462 113
218 3300006353 Ga0075370_10078027 Ga0075370_100780272 113
219 3300006881 Ga0068865_100000031 Ga0068865_10000003122 113
220 3300006948 Ga0099826_10421751 Ga0099826_104217512 113
221 3300009093 Ga0105240_10994311 Ga0105240_109943112 113
222 3300009098 Ga0105245_10015460 Ga0105245_100154605 113
223 3300009148 Ga0105243_10000156 Ga0105243_1000015679 113
224 3300009176 Ga0105242_10007978 Ga0105242_100079785 113
225 3300009176 Ga0105242_12221606 Ga0105242_122216062 113
226 3300009545 Ga0105237_10296590 Ga0105237_102965902 113
227 3300009553 Ga0105249_10333702 Ga0105249_103337022 113
228 3300013100 Ga0157373_10121988 Ga0157373_101219883 113
229 3300013102 Ga0157371_10183342 Ga0157371_101833423 113
230 3300013105 Ga0157369_10168637 Ga0157369_101686373 113
231 3300013296 Ga0157374_10013587 Ga0157374_100135872 113
232 3300013307 Ga0157372_10436179 Ga0157372_104361793 113
233 3300013307 Ga0157372_11355100 Ga0157372_113551002 113
234 3300013308 Ga0157375_10002652 Ga0157375_100026525 113
235 3300014325 Ga0163163_12428191 Ga0163163_124281911 113
236 3300014969 Ga0157376_10000124 Ga0157376_1000012452 113
237 3300025233 Ga0209437_103965 Ga0209437_1039654 113
238 3300025254 Ga0209148_1000059 Ga0209148_1000059281 113
239 3300025261 Ga0209233_1000142 Ga0209233_100014226 113
240 3300025263 Ga0209565_1000007 Ga0209565_100000736 113
241 3300025272 Ga0209455_1007020 Ga0209455_10070205 113
242 3300025273 Ga0209673_1005398 Ga0209673_10053986 113
243 3300025291 Ga0209675_1004240 Ga0209675_10042409 113
244 3300025295 Ga0209564_1047786 Ga0209564_10477862 113
245 3300025297 Ga0209758_1110252 Ga0209758_11102522 113
246 3300025298 Ga0209050_1009345 Ga0209050_10093457 113
247 3300025299 Ga0209256_1000009 Ga0209256_1000009122 113
248 3300025299 Ga0209256_1000010 Ga0209256_100001046 113
249 3300025304 Ga0209257_1023522 Ga0209257_10235223 113
250 3300025901 Ga0207688_10197819 Ga0207688_101978192 113
251 3300025904 Ga0207647_10003125 Ga0207647_1000312510 113
252 3300025904 Ga0207647_10138240 Ga0207647_101382403 113
253 3300025904 Ga0207647_10162042 Ga0207647_101620421 113
254 3300025907 Ga0207645_10010196 Ga0207645_100101963 113
255 3300025909 Ga0207705_10000046 Ga0207705_1000004645 113
256 3300025909 Ga0207705_10000244 Ga0207705_1000024417 113
257 3300025909 Ga0207705_10169213 Ga0207705_101692132 113
258 3300025914 Ga0207671_10100099 Ga0207671_101000993 113
259 3300025919 Ga0207657_10003602 Ga0207657_1000360217 113
260 3300025919 Ga0207657_10185020 Ga0207657_101850202 113
261 3300025919 Ga0207657_10289417 Ga0207657_102894172 113
262 3300025919 Ga0207657_10382975 Ga0207657_103829752 113
263 3300025919 Ga0207657_10531754 Ga0207657_105317542 113
264 3300025923 Ga0207681_10695704 Ga0207681_106957042 113
265 3300025925 Ga0207650_10130357 Ga0207650_101303573 113
266 3300025926 Ga0207659_10012851 Ga0207659_100128514 113
267 3300025931 Ga0207644_10064197 Ga0207644_100641973 113
268 3300025932 Ga0207690_10049302 Ga0207690_100493023 113
269 3300025932 Ga0207690_10222986 Ga0207690_102229862 113
270 3300025932 Ga0207690_10346881 Ga0207690_103468812 113
271 3300025933 Ga0207706_10053928 Ga0207706_100539285 113
272 3300025933 Ga0207706_10187379 Ga0207706_101873793 113
273 3300025934 Ga0207686_10010088 Ga0207686_100100882 113
274 3300025935 Ga0207709_10000100 Ga0207709_10000100133 113
275 3300025937 Ga0207669_10343034 Ga0207669_103430342 113
276 3300025938 Ga0207704_10000008 Ga0207704_10000008202 113
277 3300025940 Ga0207691_10168793 Ga0207691_101687933 113
278 3300025942 Ga0207689_10000349 Ga0207689_100003494 113
279 3300025960 Ga0207651_10000008 Ga0207651_1000000822 113
280 3300025961 Ga0207712_10215758 Ga0207712_102157583 113
281 3300025961 Ga0207712_11274739 Ga0207712_112747392 113
282 3300026023 Ga0207677_10000091 Ga0207677_100000913 113
283 3300026041 Ga0207639_10079488 Ga0207639_100794884 113
284 3300026041 Ga0207639_10525766 Ga0207639_105257662 113
285 3300026067 Ga0207678_11378003 Ga0207678_113780032 113
286 3300026078 Ga0207702_10063598 Ga0207702_100635983 113
287 3300026078 Ga0207702_10086195 Ga0207702_100861954 113
288 3300026089 Ga0207648_10000009 Ga0207648_1000000922 113
289 3300026116 Ga0207674_10071880 Ga0207674_100718802 113
290 3300026116 Ga0207674_10417406 Ga0207674_104174062 113
291 3300026116 Ga0207674_11365513 Ga0207674_113655132 113
292 3300026121 Ga0207683_10012044 Ga0207683_100120444 113
293 3300026142 Ga0207698_10062077 Ga0207698_100620773 113
294 3300031649 Ga0307514_10530163 Ga0307514_105301631 113
295 3300031911 Ga0307412_10035301 Ga0307412_100353013 113
296 3300032002 Ga0307416_100255699 Ga0307416_1002556993 113
297 3300037418 Ga0395900_0087145 Ga0395900_0087145_2170_2544 113
298 3300038443 Ga0395901_0020753 Ga0395901_0020753_6331_6705 113
299 3300039437 Ga0436365_1821732 Ga0436365_1821732_341_682 113
300 3300041407 Ga0439447_109145 Ga0439447_109145_38_388 113
301 3300041410 Ga0439461_0000272 Ga0439461_0000272_6437_6787 113
302 3300041997 Ga0439431_0000160 Ga0439431_0000160_7694_8044 113
303 3300042002 Ga0439442_005185 Ga0439442_005185_1276_1626 113
304 3300042005 Ga0439448_0000346 Ga0439448_0000346_404_754 113
305 3300042005 Ga0439448_0053359 Ga0439448_0053359_270_644 113
306 3300042005 Ga0439448_0062486 Ga0439448_0062486_121_462 113
307 3300042006 Ga0439432_000807 Ga0439432_000807_7953_8303 113
308 3300042007 Ga0439449_0097313 Ga0439449_0097313_555_905 113
309 3300042008 Ga0439450_047888 Ga0439450_047888_613_987 113
310 3300042008 Ga0439450_098307 Ga0439450_098307_208_549 113
311 3300042012 Ga0439455_0000331 Ga0439455_0000331_1542_1892 113
312 3300042012 Ga0439455_0025458 Ga0439455_0025458_1025_1366 113
313 3300042012 Ga0439455_0063990 Ga0439455_0063990_151_525 113
314 3300042015 Ga0439462_0078493 Ga0439462_0078493_234_584 113
315 3300042156 Ga0439446_0030898 Ga0439446_0030898_780_1130 113
316 3300042157 Ga0439458_0000297 Ga0439458_0000297_3892_4266 113
317 3300042157 Ga0439458_0002161 Ga0439458_0002161_3461_3811 113
318 3300042157 Ga0439458_0006421 Ga0439458_0006421_1801_2142 113
319 3300042435 Ga0439434_0011880 Ga0439434_0011880_323_673 113
320 3300042438 Ga0439459_0159103 Ga0439459_0159103_61_411 113
321 3300044842 Ga0466957_0358092 Ga0466957_0358092_625_966 113
322 3300046460 Ga0495638_0000758 Ga0495638_0000758_15523_15873 113
323 3300046525 Ga0495663_0027811 Ga0495663_0027811_260_601 113
324 3300046529 Ga0495652_0600535 Ga0495652_0600535_148_501 113
325 3300046660 Ga0495625_0000083 Ga0495625_0000083_136778_137128 113
326 3300046660 Ga0495625_0062262 Ga0495625_0062262_1728_2078 113
327 3300047472 Ga0495686_0017966 Ga0495686_0017966_1842_2183 113
328 3300048929 Ga0496126_0951065 Ga0496126_0951065_233_604 113
329 3300050496 nmdc:mga07m45_144397_c1 nmdc:mga07m45_144397_c1_164_538 113
330 3300050496 nmdc:mga07m45_67759_c2 nmdc:mga07m45_67759_c2_263_613 113
331 3300053087 Ga0500643_006180 Ga0500643_006180_986_1330 113
332 3300053090 Ga0500646_0139181 Ga0500646_0139181_41_424 113
333 3300053096 Ga0500641_0002276 Ga0500641_0002276_4015_4368 113
334 3300053119 Ga0500595_002194 Ga0500595_002194_8808_9164 113
335 3300053134 Ga0500658_0014431 Ga0500658_0014431_804_1154 113
336 3300053153 Ga0500616_0038094 Ga0500616_0038094_804_1148 113
337 3300053153 Ga0500616_0166845 Ga0500616_0166845_289_633 113
338 3300053157 Ga0500624_000032 Ga0500624_000032_5960_6313 113
339 3300053178 Ga0500637_0001528 Ga0500637_0001528_3575_3928 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

26

78

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

28

77

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9463 18 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.945 1 87
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9392 15 75
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9336 15 75
6cnf-assembly1.cif.gz_P yeast rna polymerase iii elongation complex 0.9098 15 75
ID Description Score Start End Superfamily
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9751 16 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9725 15 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 18 74 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9702 15 75 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.963 11 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3YRF7-F1-model_v4 Transcriptional regulator 0.9992 1 87 GO:0003700
AF-A0A530K0I7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9977 1 84 GO:0003700
AF-A0A212JDE4-F1-model_v4 Transcriptional regulator, ArsR family, putative (Modular protein) 0.997 2 89 GO:0003700
AF-K9H3S7-F1-model_v4 Transcriptional regulator, ArsR family 0.995 1 87 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A651FWF4-F1-model_v4 MarR family transcriptional regulator 0.9929 1 90 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
88.66 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map