F413948

General Info

Members Datasets Scaffolds Average Seq Length
339 207 678 148

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10770237|Ga0207664_107702371
Length 172
Sequence MTTIAEAAGGQAADGQRVDRAAEGGAGTAQTTQVYSVFIRATPEQIWEAITRPEWTQRYFYGARIEVGPDWRKVYSPDGGDDWGSTSVAEFDPPRRLVHEWKSSYNPELAAEEPSRVTWEIEPQEDGTTLLTVVHDQLEGAPKTAESVSGTGWMYVLSGLKTLLETGEPLAG

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.88
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.91
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10770237 3300025929 Unclassified 866
2 Ga0070683_100194858 3300005329 Bacteria 1924
3 Ga0070683_100272543 3300005329 Bacteria 1610
4 Ga0070680_100926737 3300005336 Bacteria 752
5 Ga0070682_100034606 3300005337 Bacteria 3077
6 Ga0068868_101474662 3300005338 Bacteria 636
7 Ga0070660_100129625 3300005339 Bacteria 2017
8 Ga0070661_100190292 3300005344 Bacteria 1565
9 Ga0070692_10117297 3300005345 Bacteria 1480
10 Ga0070668_101073230 3300005347 Unclassified 726
11 Ga0070668_101915361 3300005347 Unclassified 546
12 Ga0070675_101331487 3300005354 Bacteria 662
13 Ga0070671_100481141 3300005355 Bacteria 1067
14 Ga0070671_100535967 3300005355 Bacteria 1009
15 Ga0070688_100337375 3300005365 Bacteria 1100
16 Ga0070659_100023656 3300005366 Bacteria 4704
17 Ga0070659_101268379 3300005366 Bacteria 653
18 Ga0070703_10199215 3300005406 Bacteria 785
19 Ga0070709_10007139 3300005434 Bacteria 6116
20 Ga0070709_10049847 3300005434 Bacteria 2620
21 Ga0070709_10105729 3300005434 Bacteria 1883
22 Ga0070714_100045411 3300005435 Bacteria 3724
23 Ga0070714_100252845 3300005435 Bacteria 1630
24 Ga0070714_100304990 3300005435 Bacteria 1485
25 Ga0070714_100595059 3300005435 Bacteria 1062
26 Ga0070714_101552102 3300005435 Bacteria 647
27 Ga0070713_100011491 3300005436 Bacteria 6450
28 Ga0070713_100200600 3300005436 Bacteria 1801
29 Ga0070710_10001541 3300005437 Bacteria 10892
30 Ga0070701_10196940 3300005438 Bacteria 1188
31 Ga0070701_10892650 3300005438 Bacteria 613
32 Ga0070711_100040213 3300005439 Bacteria 3152
33 Ga0070711_100330560 3300005439 Bacteria 1220
34 Ga0070708_100056088 3300005445 Bacteria 3504
35 Ga0070663_101143058 3300005455 Bacteria 682
36 Ga0070663_102072479 3300005455 Unclassified 512
37 Ga0070678_100695254 3300005456 Bacteria 916
38 Ga0070662_101724585 3300005457 Bacteria 541
39 Ga0070685_10801887 3300005466 Bacteria 694
40 Ga0070685_10968234 3300005466 Bacteria 637
41 Ga0070707_100404209 3300005468 Bacteria 1326
42 Ga0070698_100517213 3300005471 Bacteria 1132
43 Ga0070679_101460055 3300005530 Unclassified 630
44 Ga0070684_100581401 3300005535 Unclassified 1041
45 Ga0070684_100616200 3300005535 Bacteria 1009
46 Ga0070684_101120459 3300005535 Bacteria 740
47 Ga0070686_101046595 3300005544 Bacteria 671
48 Ga0070695_101618588 3300005545 Bacteria 541
49 Ga0070696_100253983 3300005546 Bacteria 1330
50 Ga0070693_100138653 3300005547 Bacteria 1528
51 Ga0070665_101093777 3300005548 Bacteria 809
52 Ga0070704_100221139 3300005549 Bacteria 1540
53 Ga0070704_100859356 3300005549 Bacteria 814
54 Ga0068855_100264082 3300005563 Bacteria 1917
55 Ga0070664_100061980 3300005564 Bacteria 3188
56 Ga0070664_100225438 3300005564 Bacteria 1678
57 Ga0070664_101940711 3300005564 Bacteria 559
58 Ga0068857_100186875 3300005577 Bacteria 1887
59 Ga0068857_100278303 3300005577 Bacteria 1539
60 Ga0068857_100384364 3300005577 Bacteria 1304
61 Ga0068857_101417520 3300005577 Bacteria 676
62 Ga0068854_100217540 3300005578 Bacteria 1510
63 Ga0068856_100037784 3300005614 Bacteria 4738
64 Ga0068856_100705293 3300005614 Bacteria 1029
65 Ga0068856_102146792 3300005614 Bacteria 568
66 Ga0070702_100099044 3300005615 Bacteria 1784
67 Ga0070702_100994955 3300005615 Unclassified 663
68 Ga0068852_100906915 3300005616 Bacteria 898
69 Ga0068864_100105670 3300005618 Bacteria 2502
70 Ga0068864_100548893 3300005618 Bacteria 1117
71 Ga0068866_10194758 3300005718 Bacteria 1207
72 Ga0068851_10638611 3300005834 Viruses 651
73 Ga0068870_10436805 3300005840 Bacteria 860
74 Ga0068863_100023232 3300005841 Bacteria 5925
75 Ga0068863_100089826 3300005841 Bacteria 2913
76 Ga0068858_100022298 3300005842 Bacteria 5913
77 Ga0068858_101097263 3300005842 Bacteria 781
78 Ga0068860_100677822 3300005843 Bacteria 1040
79 Ga0068860_101259545 3300005843 Bacteria 760
80 Ga0081540_1006108 3300005983 Bacteria 8848
81 Ga0070717_10042733 3300006028 Bacteria 3697
82 Ga0075432_10167078 3300006058 Bacteria 854
83 Ga0070716_100004482 3300006173 Bacteria 6680
84 Ga0070712_100179367 3300006175 Bacteria 1649
85 Ga0068871_100417349 3300006358 Bacteria 1198
86 Ga0075428_100698412 3300006844 Bacteria 1081
87 Ga0075428_100971396 3300006844 Bacteria 900
88 Ga0075431_100622545 3300006847 Bacteria 1062
89 Ga0075434_100140052 3300006871 Bacteria 2438
90 Ga0075429_101462385 3300006880 Bacteria 595
91 Ga0075435_100293799 3300007076 Bacteria 1389
92 Ga0105251_10270660 3300009011 Bacteria 767
93 Ga0105240_11657679 3300009093 Bacteria 668
94 Ga0111539_10475340 3300009094 Bacteria 1455
95 Ga0111539_10516477 3300009094 Bacteria 1391
96 Ga0111539_10711887 3300009094 Bacteria 1169
97 Ga0105245_10074827 3300009098 Bacteria 3082
98 Ga0114129_10006082 3300009147 Bacteria 17109
99 Ga0114129_10280226 3300009147 Bacteria 2228
100 Ga0114129_11192757 3300009147 Bacteria 948
101 Ga0114129_12092329 3300009147 Bacteria 683
102 Ga0105243_10119775 3300009148 Bacteria 2217
103 Ga0105241_10273063 3300009174 Bacteria 1441
104 Ga0105242_10419561 3300009176 Bacteria 1254
105 Ga0105248_10180816 3300009177 Bacteria 2377
106 Ga0105248_10375312 3300009177 Bacteria 1601
107 Ga0105248_10441076 3300009177 Bacteria 1467
108 Ga0105248_10791470 3300009177 Bacteria 1070
109 Ga0105237_11165011 3300009545 Bacteria 777
110 Ga0105238_10133710 3300009551 Bacteria 2458
111 Ga0105249_10715552 3300009553 Bacteria 1062
112 Ga0105249_11891721 3300009553 Bacteria 669
113 Ga0105239_10601483 3300010375 Bacteria 1254
114 Ga0105239_10863185 3300010375 Bacteria 1038
115 Ga0105246_10803713 3300011119 Bacteria 835
116 Ga0157369_10273738 3300013105 Bacteria 1759
117 Ga0157369_11685371 3300013105 Bacteria 644
118 Ga0157374_11614089 3300013296 Bacteria 673
119 Ga0163162_10247286 3300013306 Bacteria 1915
120 Ga0157372_10665906 3300013307 Bacteria 1212
121 Ga0157375_12542835 3300013308 Unclassified 611
122 Ga0163163_10005467 3300014325 Bacteria 10984
123 Ga0163163_10005786 3300014325 Bacteria 10741
124 Ga0163163_10397271 3300014325 Bacteria 1437
125 Ga0163163_10668187 3300014325 Bacteria 1102
126 Ga0163163_11975755 3300014325 Bacteria 643
127 Ga0157377_11209000 3300014745 Unclassified 586
128 Ga0157379_10081833 3300014968 Bacteria 2892
129 Ga0157376_10363211 3300014969 Bacteria 1389
130 Ga0206356_10651616 3300020070 Bacteria 762
131 Ga0206356_10964136 3300020070 Bacteria 1490
132 Ga0207656_10377395 3300025321 Bacteria 710
133 Ga0207642_10084908 3300025899 Bacteria 1548
134 Ga0207685_10006238 3300025905 Bacteria 3229
135 Ga0207699_10009410 3300025906 Bacteria 4864
136 Ga0207699_10110129 3300025906 Bacteria 1763
137 Ga0207699_10528455 3300025906 Bacteria 854
138 Ga0207654_10587604 3300025911 Bacteria 794
139 Ga0207707_10372173 3300025912 Bacteria 1229
140 Ga0207707_10798665 3300025912 Bacteria 786
141 Ga0207671_10664119 3300025914 Bacteria 830
142 Ga0207693_10006088 3300025915 Bacteria 9990
143 Ga0207693_10074989 3300025915 Bacteria 2649
144 Ga0207663_10001265 3300025916 Bacteria 11722
145 Ga0207663_10238396 3300025916 Bacteria 1333
146 Ga0207649_10786379 3300025920 Bacteria 742
147 Ga0207652_10498736 3300025921 Bacteria 1096
148 Ga0207646_10718471 3300025922 Bacteria 893
149 Ga0207694_10186635 3300025924 Bacteria 1683
150 Ga0207687_10039703 3300025927 Bacteria 3224
151 Ga0207700_10013406 3300025928 Bacteria 5332
152 Ga0207700_11830245 3300025928 Unclassified 533
153 Ga0207664_10012867 3300025929 Bacteria 5995
154 Ga0207664_10279869 3300025929 Bacteria 1464
155 Ga0207664_10472918 3300025929 Bacteria 1120
156 Ga0207664_10594169 3300025929 Bacteria 994
157 Ga0207664_10763730 3300025929 Unclassified 869
158 Ga0207644_10495095 3300025931 Bacteria 1008
159 Ga0207644_11148985 3300025931 Bacteria 653
160 Ga0207690_10463279 3300025932 Bacteria 1020
161 Ga0207706_11488581 3300025933 Unclassified 553
162 Ga0207686_11329781 3300025934 Bacteria 590
163 Ga0207709_11084521 3300025935 Bacteria 657
164 Ga0207669_10713892 3300025937 Bacteria 825
165 Ga0207665_10000671 3300025939 Bacteria 23062
166 Ga0207665_10274900 3300025939 Bacteria 1252
167 Ga0207691_10444984 3300025940 Bacteria 1103
168 Ga0207711_10150886 3300025941 Bacteria 2097
169 Ga0207711_10348789 3300025941 Bacteria 1370
170 Ga0207661_10126098 3300025944 Bacteria 2187
171 Ga0207661_10198955 3300025944 Bacteria 1761
172 Ga0207661_10270398 3300025944 Bacteria 1516
173 Ga0207679_10592030 3300025945 Bacteria 998
174 Ga0207667_11330118 3300025949 Bacteria 694
175 Ga0207667_11517489 3300025949 Bacteria 641
176 Ga0207703_10068374 3300026035 Bacteria 2927
177 Ga0207639_10184418 3300026041 Bacteria 1778
178 Ga0207678_10923087 3300026067 Bacteria 772
179 Ga0207708_10062925 3300026075 Bacteria 2835
180 Ga0207708_10738300 3300026075 Bacteria 844
181 Ga0207702_10004243 3300026078 Bacteria 12798
182 Ga0207702_11902088 3300026078 Bacteria 586
183 Ga0207641_10026948 3300026088 Bacteria 4746
184 Ga0207641_11723048 3300026088 Bacteria 628
185 Ga0207676_10060819 3300026095 Bacteria 2989
186 Ga0207676_10424221 3300026095 Bacteria 1248
187 Ga0207674_10102962 3300026116 Bacteria 2834
188 Ga0207674_10328745 3300026116 Bacteria 1478
189 Ga0207698_10100141 3300026142 Bacteria 2399
190 Ga0207428_10235432 3300027907 Bacteria 1369
191 Ga0207428_10369590 3300027907 Bacteria 1053
192 Ga0268266_11407641 3300028379 Bacteria 673
193 Ga0307408_101872332 3300031548 Unclassified 575
194 Ga0307405_10030173 3300031731 Bacteria 3177
195 Ga0307413_10295210 3300031824 Bacteria 1226
196 Ga0307413_10849270 3300031824 Bacteria 771
197 Ga0307410_10225065 3300031852 Bacteria 1445
198 Ga0307410_10758822 3300031852 Bacteria 822
199 Ga0307406_10075547 3300031901 Bacteria 2223
200 Ga0307406_11364789 3300031901 Bacteria 620
201 Ga0307407_10085603 3300031903 Bacteria 1918
202 Ga0307407_10575243 3300031903 Bacteria 836
203 Ga0307412_10032999 3300031911 Bacteria 3286
204 Ga0307409_100017133 3300031995 Bacteria 4818
205 Ga0307409_100804207 3300031995 Bacteria 948
206 Ga0307409_101503744 3300031995 Bacteria 701
207 Ga0307416_100000774 3300032002 Bacteria 16782
208 Ga0307416_100868259 3300032002 Bacteria 1001
209 Ga0307414_10351229 3300032004 Bacteria 1266
210 Ga0307415_100000031 3300032126 Bacteria 60320
211 Ga0307415_100097614 3300032126 Bacteria 2145
212 Ga0307415_100115323 3300032126 Bacteria 2002
213 Ga0307415_100851203 3300032126 Bacteria 837
214 Ga0307415_101092187 3300032126 Bacteria 746
215 Ga0307507_10000110 3300033179 Bacteria 135506
216 Ga0373945_0000921 3300035116 Bacteria 8735
217 Ga0373953_0225853 3300035117 Bacteria 812
218 Ga0373960_0065306 3300035121 Bacteria 1113
219 Ga0373943_0011957 3300035170 Bacteria 3907
220 Ga0373946_0267875 3300035171 Bacteria 837
221 Ga0373924_0522724 3300035410 Bacteria 534
222 Ga0373935_0053915 3300035692 Bacteria 2559
223 Ga0373947_0002577 3300035725 Bacteria 10898
224 Ga0373925_0542022 3300037068 Bacteria 957
225 Ga0395900_0273169 3300037418 Bacteria 1684
226 Ga0395900_0523992 3300037418 Bacteria 1133
227 Ga0395898_0354775 3300037466 Bacteria 1398
228 Ga0395898_0865882 3300037466 Bacteria 842
229 Ga0395905_0090384 3300037471 Bacteria 2870
230 Ga0395901_0014874 3300038443 Bacteria 7905
231 Ga0395901_0355603 3300038443 Bacteria 1511
232 Ga0451853_3825530 3300041512 Bacteria 595
233 Ga0466966_0016924 3300044684 Bacteria 4820
234 Ga0466966_0147400 3300044684 Bacteria 1436
235 Ga0466961_0113402 3300044693 Bacteria 1704
236 Ga0466961_0159442 3300044693 Bacteria 1406
237 Ga0466963_0002079 3300044694 Bacteria 11055
238 Ga0466963_0002399 3300044694 Bacteria 10475
239 Ga0466963_0003281 3300044694 Bacteria 9220
240 Ga0466963_0143384 3300044694 Bacteria 1656
241 Ga0466963_0402666 3300044694 Bacteria 965
242 Ga0466963_0856256 3300044694 Bacteria 641
243 Ga0466964_0016686 3300044706 Bacteria 2805
244 Ga0466964_0027316 3300044706 Bacteria 2240
245 Ga0466964_0301426 3300044706 Bacteria 808
246 Ga0466971_0011518 3300044719 Bacteria 3872
247 Ga0466968_0000363 3300044735 Bacteria 14711
248 Ga0466968_0014362 3300044735 Bacteria 3129
249 Ga0466968_0105715 3300044735 Bacteria 1261
250 Ga0466970_0180158 3300044765 Bacteria 1172
251 Ga0466957_0153449 3300044842 Bacteria 1491
252 Ga0466957_0230788 3300044842 Bacteria 1225
253 Ga0466957_1237787 3300044842 Bacteria 541
254 Ga0466960_0720949 3300044901 Bacteria 599
255 Ga0466959_0002417 3300045049 Bacteria 11926
256 Ga0466959_0100279 3300045049 Bacteria 2073
257 Ga0466958_0009274 3300045836 Bacteria 5479
258 Ga0466958_0044521 3300045836 Bacteria 2675
259 Ga0466958_0454793 3300045836 Bacteria 829
260 Ga0466967_0002118 3300045976 Bacteria 12176
261 Ga0466967_0078415 3300045976 Bacteria 2975
262 Ga0466967_0080368 3300045976 Bacteria 2941
263 Ga0466967_0083102 3300045976 Bacteria 2895
264 Ga0466967_0222207 3300045976 Bacteria 1795
265 Ga0466967_1654437 3300045976 Bacteria 637
266 Ga0495651_0139750 3300046462 Bacteria 1758
267 Ga0495596_0058577 3300046500 Bacteria 1502
268 Ga0495628_0107660 3300046516 Bacteria 2146
269 Ga0495630_0053750 3300046517 Bacteria 3016
270 Ga0495630_0666352 3300046517 Unclassified 796
271 Ga0495613_0351477 3300046689 Bacteria 1012
272 Ga0495624_0229782 3300046690 Bacteria 1124
273 Ga0495581_0389575 3300047315 Bacteria 813
274 Ga0496100_0245119 3300048903 Bacteria 1323
275 Ga0496100_0606389 3300048903 Bacteria 850
276 Ga0496101_0018246 3300048904 Bacteria 4768
277 Ga0496101_0221792 3300048904 Bacteria 1467
278 Ga0496101_1427250 3300048904 Unclassified 540
279 Ga0496102_0030802 3300048905 Bacteria 4804
280 Ga0496103_0046534 3300048906 Bacteria 2679
281 Ga0496103_0284146 3300048906 Bacteria 1064
282 Ga0496103_0483340 3300048906 Bacteria 793
283 Ga0496104_0016561 3300048907 Bacteria 6699
284 Ga0496105_0599979 3300048908 Bacteria 854
285 Ga0496106_0028124 3300048909 Bacteria 4187
286 Ga0496107_0037665 3300048910 Bacteria 3470
287 Ga0496107_0478409 3300048910 Bacteria 924
288 Ga0496107_0718540 3300048910 Bacteria 734
289 Ga0496108_0028760 3300048911 Bacteria 4598
290 Ga0496108_0234352 3300048911 Bacteria 1596
291 Ga0496108_0248171 3300048911 Bacteria 1548
292 Ga0496109_0017563 3300048912 Bacteria 6273
293 Ga0496109_0121070 3300048912 Bacteria 2438
294 Ga0496109_1142184 3300048912 Bacteria 716
295 Ga0496110_0014811 3300048913 Bacteria 6479
296 Ga0496110_0404459 3300048913 Bacteria 1244
297 Ga0496111_0016396 3300048914 Bacteria 5103
298 Ga0496111_0041275 3300048914 Bacteria 3310
299 Ga0496112_0008771 3300048915 Bacteria 9071
300 Ga0496112_0013296 3300048915 Bacteria 7599
301 Ga0496112_0022119 3300048915 Bacteria 6056
302 Ga0496112_0062131 3300048915 Bacteria 3684
303 Ga0496112_1912380 3300048915 Bacteria 505
304 Ga0496113_0067468 3300048916 Bacteria 2712
305 Ga0496113_0142047 3300048916 Bacteria 1889
306 Ga0496113_0310059 3300048916 Bacteria 1264
307 Ga0496114_0007644 3300048917 Bacteria 8548
308 Ga0496114_0141259 3300048917 Bacteria 2085
309 Ga0496115_0173972 3300048918 Bacteria 1780
310 Ga0496115_0505628 3300048918 Bacteria 970
311 Ga0501034_0213211 3300049571 Bacteria 1885
312 Ga0501046_0315435 3300049580 Bacteria 1140
313 Ga0501047_0028514 3300049581 Bacteria 5383
314 Ga0501047_0070857 3300049581 Bacteria 3356
315 Ga0501067_0025309 3300049583 Bacteria 3290
316 Ga0501069_0416081 3300049585 Unclassified 796
317 Ga0501070_0000112 3300049586 Bacteria 71632
318 Ga0501073_0139797 3300049589 Bacteria 1678
319 Ga0501035_1180446 3300049822 Bacteria 594
320 Ga0501044_1440678 3300049823 Bacteria 554
321 nmdc:mga05p37_11250_c1 3300050507 Bacteria 10643
322 nmdc:mga05p37_1391955_c1 3300050507 Bacteria 707
323 nmdc:mga05p37_724561_c1 3300050507 Bacteria 1101
324 nmdc:mga09592_966293_c1 3300050508 Bacteria 713
325 nmdc:mga06r32_700588_c1 3300050510 Bacteria 978
326 nmdc:mga08y16_513413_c1 3300050511 Bacteria 1216
327 nmdc:mga08y16_82949_c1 3300050511 Bacteria 3341
328 nmdc:mga0n895_1140_c1 3300050512 Bacteria 19437
329 nmdc:mga0a205_162475_c1 3300050515 Bacteria 2129
330 Ga0495601_0103125 3300053077 Bacteria 1844
331 Ga0495655_0004241 3300053083 Bacteria 2436
332 Ga0495655_0269609 3300053083 Bacteria 577
333 Ga0495619_1171663 3300053085 Bacteria 510
334 Ga0590075_099805 3300059424 Bacteria 755
335 Ga0590077_007297 3300059426 Bacteria 2262
336 Ga0587070_114417 3300059491 Bacteria 637
337 Ga0501082_1362257 3300060353 Bacteria 620
338 Ga0530510_0228680 3300061734 Bacteria 1383
339 8055068318 8055066027 Bacteria 9479577
340 Ga0207664_10770237
341 Ga0070683_100194858
342 Ga0070683_100272543
343 Ga0070680_100926737
344 Ga0070682_100034606
345 Ga0068868_101474662
346 Ga0070660_100129625
347 Ga0070661_100190292
348 Ga0070692_10117297
349 Ga0070668_101073230
350 Ga0070668_101915361
351 Ga0070675_101331487
352 Ga0070671_100481141
353 Ga0070671_100535967
354 Ga0070688_100337375
355 Ga0070659_100023656
356 Ga0070659_101268379
357 Ga0070703_10199215
358 Ga0070709_10007139
359 Ga0070709_10049847
360 Ga0070709_10105729
361 Ga0070714_100045411
362 Ga0070714_100252845
363 Ga0070714_100304990
364 Ga0070714_100595059
365 Ga0070714_101552102
366 Ga0070713_100011491
367 Ga0070713_100200600
368 Ga0070710_10001541
369 Ga0070701_10196940
370 Ga0070701_10892650
371 Ga0070711_100040213
372 Ga0070711_100330560
373 Ga0070708_100056088
374 Ga0070663_101143058
375 Ga0070663_102072479
376 Ga0070678_100695254
377 Ga0070662_101724585
378 Ga0070685_10801887
379 Ga0070685_10968234
380 Ga0070707_100404209
381 Ga0070698_100517213
382 Ga0070679_101460055
383 Ga0070684_100581401
384 Ga0070684_100616200
385 Ga0070684_101120459
386 Ga0070686_101046595
387 Ga0070695_101618588
388 Ga0070696_100253983
389 Ga0070693_100138653
390 Ga0070665_101093777
391 Ga0070704_100221139
392 Ga0070704_100859356
393 Ga0068855_100264082
394 Ga0070664_100061980
395 Ga0070664_100225438
396 Ga0070664_101940711
397 Ga0068857_100186875
398 Ga0068857_100278303
399 Ga0068857_100384364
400 Ga0068857_101417520
401 Ga0068854_100217540
402 Ga0068856_100037784
403 Ga0068856_100705293
404 Ga0068856_102146792
405 Ga0070702_100099044
406 Ga0070702_100994955
407 Ga0068852_100906915
408 Ga0068864_100105670
409 Ga0068864_100548893
410 Ga0068866_10194758
411 Ga0068851_10638611
412 Ga0068870_10436805
413 Ga0068863_100023232
414 Ga0068863_100089826
415 Ga0068858_100022298
416 Ga0068858_101097263
417 Ga0068860_100677822
418 Ga0068860_101259545
419 Ga0081540_1006108
420 Ga0070717_10042733
421 Ga0075432_10167078
422 Ga0070716_100004482
423 Ga0070712_100179367
424 Ga0068871_100417349
425 Ga0075428_100698412
426 Ga0075428_100971396
427 Ga0075431_100622545
428 Ga0075434_100140052
429 Ga0075429_101462385
430 Ga0075435_100293799
431 Ga0105251_10270660
432 Ga0105240_11657679
433 Ga0111539_10475340
434 Ga0111539_10516477
435 Ga0111539_10711887
436 Ga0105245_10074827
437 Ga0114129_10006082
438 Ga0114129_10280226
439 Ga0114129_11192757
440 Ga0114129_12092329
441 Ga0105243_10119775
442 Ga0105241_10273063
443 Ga0105242_10419561
444 Ga0105248_10180816
445 Ga0105248_10375312
446 Ga0105248_10441076
447 Ga0105248_10791470
448 Ga0105237_11165011
449 Ga0105238_10133710
450 Ga0105249_10715552
451 Ga0105249_11891721
452 Ga0105239_10601483
453 Ga0105239_10863185
454 Ga0105246_10803713
455 Ga0157369_10273738
456 Ga0157369_11685371
457 Ga0157374_11614089
458 Ga0163162_10247286
459 Ga0157372_10665906
460 Ga0157375_12542835
461 Ga0163163_10005467
462 Ga0163163_10005786
463 Ga0163163_10397271
464 Ga0163163_10668187
465 Ga0163163_11975755
466 Ga0157377_11209000
467 Ga0157379_10081833
468 Ga0157376_10363211
469 Ga0206356_10651616
470 Ga0206356_10964136
471 Ga0207656_10377395
472 Ga0207642_10084908
473 Ga0207685_10006238
474 Ga0207699_10009410
475 Ga0207699_10110129
476 Ga0207699_10528455
477 Ga0207654_10587604
478 Ga0207707_10372173
479 Ga0207707_10798665
480 Ga0207671_10664119
481 Ga0207693_10006088
482 Ga0207693_10074989
483 Ga0207663_10001265
484 Ga0207663_10238396
485 Ga0207649_10786379
486 Ga0207652_10498736
487 Ga0207646_10718471
488 Ga0207694_10186635
489 Ga0207687_10039703
490 Ga0207700_10013406
491 Ga0207700_11830245
492 Ga0207664_10012867
493 Ga0207664_10279869
494 Ga0207664_10472918
495 Ga0207664_10594169
496 Ga0207664_10763730
497 Ga0207644_10495095
498 Ga0207644_11148985
499 Ga0207690_10463279
500 Ga0207706_11488581
501 Ga0207686_11329781
502 Ga0207709_11084521
503 Ga0207669_10713892
504 Ga0207665_10000671
505 Ga0207665_10274900
506 Ga0207691_10444984
507 Ga0207711_10150886
508 Ga0207711_10348789
509 Ga0207661_10126098
510 Ga0207661_10198955
511 Ga0207661_10270398
512 Ga0207679_10592030
513 Ga0207667_11330118
514 Ga0207667_11517489
515 Ga0207703_10068374
516 Ga0207639_10184418
517 Ga0207678_10923087
518 Ga0207708_10062925
519 Ga0207708_10738300
520 Ga0207702_10004243
521 Ga0207702_11902088
522 Ga0207641_10026948
523 Ga0207641_11723048
524 Ga0207676_10060819
525 Ga0207676_10424221
526 Ga0207674_10102962
527 Ga0207674_10328745
528 Ga0207698_10100141
529 Ga0207428_10235432
530 Ga0207428_10369590
531 Ga0268266_11407641
532 Ga0307408_101872332
533 Ga0307405_10030173
534 Ga0307413_10295210
535 Ga0307413_10849270
536 Ga0307410_10225065
537 Ga0307410_10758822
538 Ga0307406_10075547
539 Ga0307406_11364789
540 Ga0307407_10085603
541 Ga0307407_10575243
542 Ga0307412_10032999
543 Ga0307409_100017133
544 Ga0307409_100804207
545 Ga0307409_101503744
546 Ga0307416_100000774
547 Ga0307416_100868259
548 Ga0307414_10351229
549 Ga0307415_100000031
550 Ga0307415_100097614
551 Ga0307415_100115323
552 Ga0307415_100851203
553 Ga0307415_101092187
554 Ga0307507_10000110
555 Ga0373945_0000921
556 Ga0373953_0225853
557 Ga0373960_0065306
558 Ga0373943_0011957
559 Ga0373946_0267875
560 Ga0373924_0522724
561 Ga0373935_0053915
562 Ga0373947_0002577
563 Ga0373925_0542022
564 Ga0395900_0273169
565 Ga0395900_0523992
566 Ga0395898_0354775
567 Ga0395898_0865882
568 Ga0395905_0090384
569 Ga0395901_0014874
570 Ga0395901_0355603
571 Ga0451853_3825530
572 Ga0466966_0016924
573 Ga0466966_0147400
574 Ga0466961_0113402
575 Ga0466961_0159442
576 Ga0466963_0002079
577 Ga0466963_0002399
578 Ga0466963_0003281
579 Ga0466963_0143384
580 Ga0466963_0402666
581 Ga0466963_0856256
582 Ga0466964_0016686
583 Ga0466964_0027316
584 Ga0466964_0301426
585 Ga0466971_0011518
586 Ga0466968_0000363
587 Ga0466968_0014362
588 Ga0466968_0105715
589 Ga0466970_0180158
590 Ga0466957_0153449
591 Ga0466957_0230788
592 Ga0466957_1237787
593 Ga0466960_0720949
594 Ga0466959_0002417
595 Ga0466959_0100279
596 Ga0466958_0009274
597 Ga0466958_0044521
598 Ga0466958_0454793
599 Ga0466967_0002118
600 Ga0466967_0078415
601 Ga0466967_0080368
602 Ga0466967_0083102
603 Ga0466967_0222207
604 Ga0466967_1654437
605 Ga0495651_0139750
606 Ga0495596_0058577
607 Ga0495628_0107660
608 Ga0495630_0053750
609 Ga0495630_0666352
610 Ga0495613_0351477
611 Ga0495624_0229782
612 Ga0495581_0389575
613 Ga0496100_0245119
614 Ga0496100_0606389
615 Ga0496101_0018246
616 Ga0496101_0221792
617 Ga0496101_1427250
618 Ga0496102_0030802
619 Ga0496103_0046534
620 Ga0496103_0284146
621 Ga0496103_0483340
622 Ga0496104_0016561
623 Ga0496105_0599979
624 Ga0496106_0028124
625 Ga0496107_0037665
626 Ga0496107_0478409
627 Ga0496107_0718540
628 Ga0496108_0028760
629 Ga0496108_0234352
630 Ga0496108_0248171
631 Ga0496109_0017563
632 Ga0496109_0121070
633 Ga0496109_1142184
634 Ga0496110_0014811
635 Ga0496110_0404459
636 Ga0496111_0016396
637 Ga0496111_0041275
638 Ga0496112_0008771
639 Ga0496112_0013296
640 Ga0496112_0022119
641 Ga0496112_0062131
642 Ga0496112_1912380
643 Ga0496113_0067468
644 Ga0496113_0142047
645 Ga0496113_0310059
646 Ga0496114_0007644
647 Ga0496114_0141259
648 Ga0496115_0173972
649 Ga0496115_0505628
650 Ga0501034_0213211
651 Ga0501046_0315435
652 Ga0501047_0028514
653 Ga0501047_0070857
654 Ga0501067_0025309
655 Ga0501069_0416081
656 Ga0501070_0000112
657 Ga0501073_0139797
658 Ga0501035_1180446
659 Ga0501044_1440678
660 nmdc:mga05p37_11250_c1
661 nmdc:mga05p37_1391955_c1
662 nmdc:mga05p37_724561_c1
663 nmdc:mga09592_966293_c1
664 nmdc:mga06r32_700588_c1
665 nmdc:mga08y16_513413_c1
666 nmdc:mga08y16_82949_c1
667 nmdc:mga0n895_1140_c1
668 nmdc:mga0a205_162475_c1
669 Ga0495601_0103125
670 Ga0495655_0004241
671 Ga0495655_0269609
672 Ga0495619_1171663
673 Ga0590075_099805
674 Ga0590077_007297
675 Ga0587070_114417
676 Ga0501082_1362257
677 Ga0530510_0228680
678 8055068318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

40

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.8241 1 131
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8063 2 133
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.7807 2 131
7dme-assembly1.cif.gz_A solution structure of human aha1 0.7703 1 129
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.7656 1 133
ID Description Score Start End Superfamily
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8369 1 131 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7673 1 129 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7608 2 135 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7574 1 132 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7543 1 130 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A538JWT0-F1-model_v4 ATPase 0.9753 1 135
AF-A0A5P9QEV8-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9739 1 134
AF-A0A538JWT0-F1-model_v4 ATPase 0.9683 1 135
AF-A0A5M3VU97-F1-model_v4 ATPase 0.9661 3 135
AF-A0A4V2S759-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9625 1 135

Map