F413901

General Info

Members Datasets Scaffolds Average Seq Length
339 196 678 332

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10076983|Ga0105238_100769833
Length 367
Sequence MDVDRENLAVKSETMTLLRDFQSIVRQPDNQRQSSSGVRGGHLPKEQLHEMLRRMLRIRLFEEQAKRMKMALKIRGALHNAIGQEAEIVGACMALRNDDYMTGNHRSHGHPIGKGVALAPLMAELLGKKTGVCKGKGGSMHLADFSVGSLGESGIVGSLMPIAVGAGLSARLRGTDQVCLSFFGDGAANCGPFHESLNLSSVWKLPVVFLCENNGYATTSPQAQTTAVDNIAQRAVAYTMPGVIVDGQDVLAVHTAVLAAVARARSGEGPTLIEAKTYRYCDHSEFAPAELGGLTPPPYRSSAELDAWRARDPIKLFSVWLHSAGDLTGEEFEVIKAAVESEIEAAVVFAEESPPPNPKALFEDVFI

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
182 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2508501039 Frankia saprophytica CN3 Isolate Nodule
187 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
188 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
189 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
190 2687453737 Frankia sp. BMG5.36 Isolate Nodule
191 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
192 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
193 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
194 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
195 8002775197 Frankia nepalensis CN7 Isolate Nodule
196 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0.29
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 1.77
Rhizoplane 12.68
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10076983 3300009551 Bacteria 3328
2 SwRhRL2b_contig_3253917 2162886007 Bacteria 5781
3 JGI24745J21846_1000417 3300002073 Bacteria 3781
4 JGI24749J21850_1000230 3300002076 Bacteria 8736
5 JGI24034J26672_10008601 3300002239 Bacteria 1493
6 JGI24751J29686_10000658 3300002459 Bacteria 8668
7 JGI25406J46586_10032376 3300003203 Eukaryota 1943
8 rootH1_10246183 3300003323 Bacteria 1891
9 JGI25405J52794_10008777 3300003911 Bacteria 1896
10 Ga0058861_10857341 3300004800 Bacteria 3559
11 Ga0065704_10000421 3300005289 Bacteria 24733
12 Ga0065704_10034592 3300005289 Bacteria 1225
13 Ga0070676_10023894 3300005328 Bacteria 3438
14 Ga0070670_100008599 3300005331 Bacteria 8710
15 Ga0070670_100018050 3300005331 Bacteria 6055
16 Ga0068869_100004231 3300005334 Bacteria 8903
17 Ga0070666_10078004 3300005335 Bacteria 2261
18 Ga0070666_10119702 3300005335 Bacteria 1825
19 Ga0068868_100004209 3300005338 Bacteria 10065
20 Ga0068868_100166125 3300005338 Bacteria 1825
21 Ga0070689_100022329 3300005340 Bacteria 4724
22 Ga0070661_100009373 3300005344 Bacteria 6773
23 Ga0070668_100003745 3300005347 Bacteria 11220
24 Ga0070668_100006275 3300005347 Bacteria 8800
25 Ga0070668_100006385 3300005347 Bacteria 8735
26 Ga0070668_100011500 3300005347 Bacteria 6590
27 Ga0070669_100000243 3300005353 Bacteria 45185
28 Ga0070669_100002845 3300005353 Bacteria 12506
29 Ga0070669_100034100 3300005353 Bacteria 3685
30 Ga0070675_100125857 3300005354 Bacteria 2180
31 Ga0070671_100001781 3300005355 Bacteria 16352
32 Ga0070667_100023310 3300005367 Bacteria 5134
33 Ga0070714_100025235 3300005435 Bacteria 4904
34 Ga0070713_100022642 3300005436 Bacteria 4858
35 Ga0070701_10017764 3300005438 Bacteria 3330
36 Ga0070700_100007807 3300005441 Bacteria 5799
37 Ga0070663_100163633 3300005455 Bacteria 1714
38 Ga0070663_100203074 3300005455 Bacteria 1548
39 Ga0070678_100296318 3300005456 Bacteria 1373
40 Ga0070685_10093303 3300005466 Bacteria 1825
41 Ga0070706_100137361 3300005467 Bacteria 2281
42 Ga0070706_100290801 3300005467 Bacteria 1525
43 Ga0070707_100001090 3300005468 Bacteria 26853
44 Ga0070698_100132618 3300005471 Bacteria 2446
45 Ga0070684_100077306 3300005535 Bacteria 2939
46 Ga0068853_100016643 3300005539 Bacteria 6054
47 Ga0068853_100274270 3300005539 Bacteria 1553
48 Ga0070672_100049462 3300005543 Bacteria 3270
49 Ga0070665_100011434 3300005548 Bacteria 8974
50 Ga0070665_100023811 3300005548 Bacteria 6169
51 Ga0070665_100061166 3300005548 Bacteria 3775
52 Ga0068855_100003695 3300005563 Bacteria 18708
53 Ga0068855_100035550 3300005563 Bacteria 5934
54 Ga0070664_100018162 3300005564 Bacteria 5773
55 Ga0068854_100012879 3300005578 Bacteria 5478
56 Ga0068856_100222458 3300005614 Bacteria 1903
57 Ga0068852_100076275 3300005616 Bacteria 2959
58 Ga0068859_100000899 3300005617 Bacteria 30312
59 Ga0068859_100039484 3300005617 Bacteria 4735
60 Ga0068864_100000185 3300005618 Bacteria 57142
61 Ga0068864_100008013 3300005618 Bacteria 8713
62 Ga0068861_100010586 3300005719 Bacteria 6405
63 Ga0068861_100031763 3300005719 Bacteria 3882
64 Ga0068851_10022840 3300005834 Bacteria 3053
65 Ga0068863_100000041 3300005841 Bacteria 157478
66 Ga0068863_100051659 3300005841 Bacteria 3895
67 Ga0068863_100148690 3300005841 Bacteria 2241
68 Ga0068863_100294485 3300005841 Bacteria 1573
69 Ga0068858_100000206 3300005842 Bacteria 63692
70 Ga0068858_100083906 3300005842 Bacteria 2963
71 Ga0068858_100126153 3300005842 Bacteria 2397
72 Ga0068860_100001087 3300005843 Bacteria 29961
73 Ga0068860_100028644 3300005843 Bacteria 5361
74 Ga0068860_100091912 3300005843 Bacteria 2891
75 Ga0068860_100186965 3300005843 Bacteria 2003
76 Ga0068862_100000073 3300005844 Bacteria 119632
77 Ga0068862_100006108 3300005844 Bacteria 10024
78 Ga0068862_100017240 3300005844 Bacteria 6011
79 Ga0081455_10007641 3300005937 Bacteria 11354
80 Ga0081538_10003496 3300005981 Bacteria 14822
81 Ga0081538_10015366 3300005981 Bacteria 5930
82 Ga0081538_10030824 3300005981 Bacteria 3632
83 Ga0081538_10072619 3300005981 Bacteria 1885
84 Ga0081539_10000155 3300005985 Bacteria 159271
85 Ga0081539_10000793 3300005985 Bacteria 61390
86 Ga0081539_10001864 3300005985 Bacteria 33132
87 Ga0081539_10024094 3300005985 Bacteria 3961
88 Ga0070717_10006838 3300006028 Bacteria 8417
89 Ga0075428_100520959 3300006844 Bacteria 1272
90 Ga0075431_100050006 3300006847 Bacteria 4310
91 Ga0075433_10143138 3300006852 Bacteria 2125
92 Ga0075434_100086001 3300006871 Bacteria 3144
93 Ga0075429_100086286 3300006880 Bacteria 2736
94 Ga0097620_100000899 3300006931 Bacteria 30312
95 Ga0097620_100039484 3300006931 Bacteria 4735
96 Ga0099794_10019621 3300007265 Bacteria 3051
97 Ga0105250_10012693 3300009092 Bacteria 3471
98 Ga0111539_10085054 3300009094 Bacteria 3718
99 Ga0111539_10135376 3300009094 Bacteria 2885
100 Ga0111539_10411063 3300009094 Bacteria 1576
101 Ga0105245_10028022 3300009098 Bacteria 4965
102 Ga0105247_10040290 3300009101 Bacteria 2855
103 Ga0105247_10095807 3300009101 Bacteria 1890
104 Ga0105243_10084126 3300009148 Bacteria 2605
105 Ga0105248_10075094 3300009177 Bacteria 3799
106 Ga0105248_10159699 3300009177 Bacteria 2543
107 Ga0105238_10211595 3300009551 Bacteria 1915
108 Ga0105238_10218257 3300009551 Bacteria 1883
109 Ga0105238_10262183 3300009551 Bacteria 1708
110 Ga0105249_10089978 3300009553 Bacteria 2869
111 Ga0105249_10190239 3300009553 Bacteria 2003
112 Ga0105148_100025 3300009978 Bacteria 21796
113 Ga0163162_10011254 3300013306 Bacteria 8722
114 Ga0163162_10039030 3300013306 Bacteria 4741
115 Ga0157375_10054141 3300013308 Bacteria 3951
116 Ga0163163_10010336 3300014325 Bacteria 8385
117 Ga0163163_10017210 3300014325 Bacteria 6736
118 Ga0163163_10222169 3300014325 Bacteria 1938
119 Ga0157380_10000832 3300014326 Bacteria 19299
120 Ga0157380_10018806 3300014326 Bacteria 5138
121 Ga0157380_10021023 3300014326 Bacteria 4889
122 Ga0157380_10082669 3300014326 Bacteria 2629
123 Ga0157377_10008098 3300014745 Bacteria 5113
124 Ga0157379_10041590 3300014968 Bacteria 4103
125 Ga0157376_10027254 3300014969 Bacteria 4527
126 Ga0157376_10208593 3300014969 Bacteria 1802
127 Ga0163161_10208661 3300017792 Bacteria 1508
128 Ga0213876_10000150 3300021384 Bacteria 74357
129 Ga0213876_10072400 3300021384 Bacteria 1820
130 Ga0207696_1020711 3300025711 Bacteria 2115
131 Ga0207713_1004230 3300025735 Bacteria 9391
132 Ga0207710_10059440 3300025900 Bacteria 1730
133 Ga0207680_10081759 3300025903 Bacteria 2031
134 Ga0207645_10069733 3300025907 Bacteria 2249
135 Ga0207643_10004839 3300025908 Bacteria 7210
136 Ga0207684_10000072 3300025910 Bacteria 185716
137 Ga0207684_10100423 3300025910 Bacteria 2473
138 Ga0207660_10205643 3300025917 Bacteria 1539
139 Ga0207657_10036335 3300025919 Bacteria 4410
140 Ga0207649_10250988 3300025920 Bacteria 1274
141 Ga0207646_10001142 3300025922 Bacteria 33825
142 Ga0207646_10031627 3300025922 Bacteria 4791
143 Ga0207681_10000023 3300025923 Bacteria 229753
144 Ga0207681_10000404 3300025923 Bacteria 30024
145 Ga0207681_10027768 3300025923 Bacteria 3662
146 Ga0207681_10162621 3300025923 Bacteria 1684
147 Ga0207681_10183857 3300025923 Bacteria 1594
148 Ga0207694_10040078 3300025924 Bacteria 3605
149 Ga0207694_10111198 3300025924 Bacteria 2179
150 Ga0207694_10230944 3300025924 Bacteria 1511
151 Ga0207650_10000029 3300025925 Bacteria 236660
152 Ga0207650_10016979 3300025925 Bacteria 5092
153 Ga0207650_10243187 3300025925 Bacteria 1455
154 Ga0207659_10280297 3300025926 Bacteria 1362
155 Ga0207687_10196260 3300025927 Bacteria 1574
156 Ga0207700_10307558 3300025928 Unclassified 1370
157 Ga0207644_10005550 3300025931 Bacteria 8208
158 Ga0207706_10004351 3300025933 Bacteria 13301
159 Ga0207689_10003677 3300025942 Bacteria 13982
160 Ga0207679_10010122 3300025945 Bacteria 6064
161 Ga0207667_10000860 3300025949 Bacteria 39081
162 Ga0207667_10134638 3300025949 Bacteria 2545
163 Ga0207712_10057219 3300025961 Bacteria 2750
164 Ga0207668_10001872 3300025972 Bacteria 12291
165 Ga0207668_10009630 3300025972 Bacteria 5799
166 Ga0207668_10049643 3300025972 Bacteria 2886
167 Ga0207668_10244705 3300025972 Bacteria 1453
168 Ga0207640_10015916 3300025981 Bacteria 4364
169 Ga0207658_10004958 3300025986 Bacteria 9179
170 Ga0207658_10085968 3300025986 Bacteria 2424
171 Ga0207658_10088174 3300025986 Bacteria 2398
172 Ga0207677_10003385 3300026023 Bacteria 8441
173 Ga0207703_10000193 3300026035 Bacteria 70671
174 Ga0207703_10103333 3300026035 Bacteria 2419
175 Ga0207703_10459023 3300026035 Bacteria 1191
176 Ga0207678_10336498 3300026067 Bacteria 1300
177 Ga0207708_10007510 3300026075 Bacteria 8058
178 Ga0207641_10000027 3300026088 Bacteria 244787
179 Ga0207676_10000059 3300026095 Bacteria 119553
180 Ga0207676_10000093 3300026095 Bacteria 80702
181 Ga0207674_10001556 3300026116 Bacteria 29548
182 Ga0207675_100009851 3300026118 Bacteria 8937
183 Ga0207675_100010124 3300026118 Bacteria 8837
184 Ga0207675_100010381 3300026118 Bacteria 8726
185 Ga0207675_100014016 3300026118 Bacteria 7473
186 Ga0207683_10246781 3300026121 Bacteria 1629
187 Ga0268266_10037627 3300028379 Bacteria 4121
188 Ga0268266_10040143 3300028379 Bacteria 3988
189 Ga0268266_10289119 3300028379 Bacteria 1526
190 Ga0268265_10000018 3300028380 Bacteria 285651
191 Ga0268265_10175181 3300028380 Bacteria 1837
192 Ga0268264_10000947 3300028381 Bacteria 29977
193 Ga0268264_10011511 3300028381 Bacteria 7307
194 Ga0268264_10020804 3300028381 Bacteria 5361
195 Ga0268264_10332962 3300028381 Bacteria 1439
196 Ga0265318_10001572 3300028577 Bacteria 13223
197 Ga0265339_10069236 3300031249 Bacteria 1884
198 Ga0265316_10062684 3300031344 Bacteria 2885
199 Ga0307509_10000030 3300031507 Bacteria 206541
200 Ga0265313_10009523 3300031595 Bacteria 6291
201 Ga0265314_10017775 3300031711 Bacteria 5571
202 Ga0307412_10284296 3300031911 Bacteria 1300
203 Ga0307409_100260147 3300031995 Bacteria 1592
204 Ga0307416_100019709 3300032002 Bacteria 4791
205 Ga0307415_100003126 3300032126 Bacteria 8384
206 Ga0307415_100198195 3300032126 Unclassified 1591
207 Ga0395900_0341058 3300037418 Bacteria 1474
208 Ga0395898_0230718 3300037466 Bacteria 1765
209 Ga0436364_0185014 3300037853 Bacteria 2817
210 Ga0436364_0978417 3300037853 Bacteria 1526
211 Ga0395901_0312889 3300038443 Bacteria 1626
212 Ga0395901_0548137 3300038443 Bacteria 1172
213 Ga0400483_147094 3300039062 Bacteria 1760
214 Ga0436365_0966870 3300039437 Bacteria 4907
215 Ga0436365_1190254 3300039437 Bacteria 2830
216 Ga0436365_1247886 3300039437 Bacteria 61397
217 Ga0436363_1376402 3300039450 Bacteria 3467
218 Ga0451577_0193293 3300042876 Bacteria 1836
219 Ga0466969_0001219 3300044656 Bacteria 13884
220 Ga0466961_0081459 3300044693 Bacteria 2048
221 Ga0466964_0020667 3300044706 Bacteria 2537
222 Ga0466970_0042017 3300044765 Bacteria 2431
223 Ga0466970_0066112 3300044765 Bacteria 1941
224 Ga0466957_0004593 3300044842 Bacteria 7716
225 Ga0466960_0026300 3300044901 Bacteria 2643
226 Ga0495594_0060380 3300046499 Bacteria 2097
227 Ga0496100_0011732 3300048903 Bacteria 4996
228 Ga0496100_0249775 3300048903 Bacteria 1312
229 Ga0496101_0144670 3300048904 Bacteria 1815
230 Ga0496102_0000109 3300048905 Bacteria 117315
231 Ga0496102_0001592 3300048905 Bacteria 20024
232 Ga0496102_0026244 3300048905 Bacteria 5194
233 Ga0496102_0101498 3300048905 Bacteria 2673
234 Ga0496102_0131468 3300048905 Bacteria 2343
235 Ga0496103_0000181 3300048906 Bacteria 64065
236 Ga0496103_0001719 3300048906 Bacteria 14308
237 Ga0496103_0082383 3300048906 Unclassified 2025
238 Ga0496103_0187390 3300048906 Bacteria 1330
239 Ga0496104_0001291 3300048907 Bacteria 21592
240 Ga0496104_0002287 3300048907 Bacteria 16520
241 Ga0496104_0289690 3300048907 Bacteria 1550
242 Ga0496105_0000428 3300048908 Bacteria 27607
243 Ga0496105_0001785 3300048908 Bacteria 15369
244 Ga0496105_0026521 3300048908 Bacteria 4728
245 Ga0496105_0036080 3300048908 Bacteria 4072
246 Ga0496105_0096684 3300048908 Bacteria 2439
247 Ga0496106_0213115 3300048909 Bacteria 1539
248 Ga0496107_0201900 3300048910 Bacteria 1478
249 Ga0496107_0221966 3300048910 Bacteria 1406
250 Ga0496108_0012866 3300048911 Bacteria 6815
251 Ga0496108_0143762 3300048911 Bacteria 2055
252 Ga0496108_0252796 3300048911 Bacteria 1533
253 Ga0496109_0113279 3300048912 Bacteria 2523
254 Ga0496110_0000336 3300048913 Bacteria 31385
255 Ga0496110_0017326 3300048913 Bacteria 6025
256 Ga0496110_0040287 3300048913 Bacteria 4071
257 Ga0496110_0064014 3300048913 Bacteria 3249
258 Ga0496111_0000281 3300048914 Bacteria 24645
259 Ga0496111_0053584 3300048914 Bacteria 2915
260 Ga0496111_0094252 3300048914 Unclassified 2195
261 Ga0496112_0041593 3300048915 Bacteria 4497
262 Ga0496113_0000041 3300048916 Bacteria 53534
263 Ga0496113_0027633 3300048916 Bacteria 4070
264 Ga0496114_0001702 3300048917 Bacteria 16693
265 Ga0496114_0004103 3300048917 Bacteria 11262
266 Ga0496114_0007806 3300048917 Bacteria 8465
267 Ga0496114_0111611 3300048917 Bacteria 2343
268 Ga0496115_0000042 3300048918 Bacteria 118348
269 Ga0496115_0072681 3300048918 Bacteria 2791
270 Ga0496116_0003926 3300048919 Bacteria 14487
271 Ga0496116_0035998 3300048919 Bacteria 3471
272 Ga0496117_0000398 3300048920 Bacteria 74273
273 Ga0496117_0001532 3300048920 Bacteria 32999
274 Ga0496117_0001905 3300048920 Bacteria 27997
275 Ga0496117_0003121 3300048920 Bacteria 19788
276 Ga0496117_0040176 3300048920 Bacteria 3445
277 Ga0496118_0000109 3300048921 Bacteria 153067
278 Ga0496118_0000227 3300048921 Bacteria 98264
279 Ga0496118_0006938 3300048921 Bacteria 12246
280 Ga0496118_0199132 3300048921 Bacteria 1188
281 Ga0496119_0001532 3300048922 Bacteria 27609
282 Ga0496119_0006218 3300048922 Bacteria 11155
283 Ga0496119_0022725 3300048922 Bacteria 4478
284 Ga0496119_0058675 3300048922 Bacteria 2317
285 Ga0496120_0003773 3300048923 Bacteria 13384
286 Ga0496120_0007859 3300048923 Bacteria 7859
287 Ga0496120_0013358 3300048923 Bacteria 5536
288 Ga0496121_0000038 3300048924 Bacteria 351739
289 Ga0496121_0000687 3300048924 Bacteria 63021
290 Ga0496121_0000831 3300048924 Bacteria 56152
291 Ga0496121_0003631 3300048924 Bacteria 21732
292 Ga0496121_0038424 3300048924 Bacteria 4240
293 Ga0496121_0065008 3300048924 Bacteria 2971
294 Ga0496121_0076811 3300048924 Unclassified 2662
295 Ga0496122_0002294 3300048925 Bacteria 27639
296 Ga0496122_0071188 3300048925 Unclassified 2479
297 Ga0496123_0001867 3300048926 Bacteria 27609
298 Ga0496123_0052331 3300048926 Unclassified 2711
299 Ga0496124_0000201 3300048927 Bacteria 117658
300 Ga0496124_0155078 3300048927 Unclassified 1792
301 Ga0496125_0007060 3300048928 Bacteria 11998
302 Ga0496125_0094902 3300048928 Unclassified 2220
303 Ga0496125_0207510 3300048928 Unclassified 1276
304 Ga0496126_0000654 3300048929 Bacteria 64276
305 Ga0496126_0002130 3300048929 Bacteria 27609
306 Ga0496126_0012301 3300048929 Bacteria 8781
307 Ga0501033_0000290 3300049570 Bacteria 48208
308 Ga0501033_0379441 3300049570 Bacteria 988
309 Ga0501034_0214734 3300049571 Bacteria 1878
310 Ga0501047_0000652 3300049581 Bacteria 36361
311 Ga0501047_0171476 3300049581 Bacteria 2038
312 Ga0501047_0354091 3300049581 Bacteria 1304
313 Ga0501067_0157190 3300049583 Bacteria 1267
314 Ga0501070_0350591 3300049586 Bacteria 1198
315 Ga0501075_0043647 3300049591 Bacteria 3363
316 Ga0501076_0052391 3300049592 Bacteria 3233
317 Ga0501080_0322328 3300049742 Bacteria 1398
318 nmdc:mga05p37_166715_c1 3300050507 Bacteria 2688
319 nmdc:mga05p37_504919_c1 3300050507 Bacteria 1387
320 nmdc:mga09592_64678_c1 3300050508 Bacteria 3097
321 nmdc:mga06r32_84199_c1 3300050510 Bacteria 3099
322 nmdc:mga08y16_533711_c1 3300050511 Bacteria 1189
323 nmdc:mga08y16_88859_c1 3300050511 Bacteria 3220
324 Ga0500556_0000354 3300053104 Bacteria 34273
325 Ga0500652_007295 3300053131 Bacteria 3611
326 Ga0500568_0000087 3300053139 Bacteria 90384
327 Ga0501084_0218063 3300054114 Bacteria 1610
328 Ga0466962_0013768 3300061719 Bacteria 3894
329 2508676642 2508501039 Bacteria 9978592
330 2558912045 2558860112 Bacteria 9931328
331 2676199041 2675902999 Bacteria 9438463
332 2676483302 2675903059 Bacteria 8644972
333 2689957052 2687453737 Bacteria 11203906
334 2691513008 2690315906 Bacteria 4517044
335 2774843619 2773857921 Bacteria 9435764
336 2894822000 2894817345 Bacteria 4892941
337 2919055051 2919051321 Bacteria 4210889
338 8002783675 8002775197 Bacteria 10728764
339 8002786881 8002784119 Bacteria 9788632
340 Ga0105238_10076983
341 SwRhRL2b_contig_3253917
342 JGI24745J21846_1000417
343 JGI24749J21850_1000230
344 JGI24034J26672_10008601
345 JGI24751J29686_10000658
346 JGI25406J46586_10032376
347 rootH1_10246183
348 JGI25405J52794_10008777
349 Ga0058861_10857341
350 Ga0065704_10000421
351 Ga0065704_10034592
352 Ga0070676_10023894
353 Ga0070670_100008599
354 Ga0070670_100018050
355 Ga0068869_100004231
356 Ga0070666_10078004
357 Ga0070666_10119702
358 Ga0068868_100004209
359 Ga0068868_100166125
360 Ga0070689_100022329
361 Ga0070661_100009373
362 Ga0070668_100003745
363 Ga0070668_100006275
364 Ga0070668_100006385
365 Ga0070668_100011500
366 Ga0070669_100000243
367 Ga0070669_100002845
368 Ga0070669_100034100
369 Ga0070675_100125857
370 Ga0070671_100001781
371 Ga0070667_100023310
372 Ga0070714_100025235
373 Ga0070713_100022642
374 Ga0070701_10017764
375 Ga0070700_100007807
376 Ga0070663_100163633
377 Ga0070663_100203074
378 Ga0070678_100296318
379 Ga0070685_10093303
380 Ga0070706_100137361
381 Ga0070706_100290801
382 Ga0070707_100001090
383 Ga0070698_100132618
384 Ga0070684_100077306
385 Ga0068853_100016643
386 Ga0068853_100274270
387 Ga0070672_100049462
388 Ga0070665_100011434
389 Ga0070665_100023811
390 Ga0070665_100061166
391 Ga0068855_100003695
392 Ga0068855_100035550
393 Ga0070664_100018162
394 Ga0068854_100012879
395 Ga0068856_100222458
396 Ga0068852_100076275
397 Ga0068859_100000899
398 Ga0068859_100039484
399 Ga0068864_100000185
400 Ga0068864_100008013
401 Ga0068861_100010586
402 Ga0068861_100031763
403 Ga0068851_10022840
404 Ga0068863_100000041
405 Ga0068863_100051659
406 Ga0068863_100148690
407 Ga0068863_100294485
408 Ga0068858_100000206
409 Ga0068858_100083906
410 Ga0068858_100126153
411 Ga0068860_100001087
412 Ga0068860_100028644
413 Ga0068860_100091912
414 Ga0068860_100186965
415 Ga0068862_100000073
416 Ga0068862_100006108
417 Ga0068862_100017240
418 Ga0081455_10007641
419 Ga0081538_10003496
420 Ga0081538_10015366
421 Ga0081538_10030824
422 Ga0081538_10072619
423 Ga0081539_10000155
424 Ga0081539_10000793
425 Ga0081539_10001864
426 Ga0081539_10024094
427 Ga0070717_10006838
428 Ga0075428_100520959
429 Ga0075431_100050006
430 Ga0075433_10143138
431 Ga0075434_100086001
432 Ga0075429_100086286
433 Ga0097620_100000899
434 Ga0097620_100039484
435 Ga0099794_10019621
436 Ga0105250_10012693
437 Ga0111539_10085054
438 Ga0111539_10135376
439 Ga0111539_10411063
440 Ga0105245_10028022
441 Ga0105247_10040290
442 Ga0105247_10095807
443 Ga0105243_10084126
444 Ga0105248_10075094
445 Ga0105248_10159699
446 Ga0105238_10211595
447 Ga0105238_10218257
448 Ga0105238_10262183
449 Ga0105249_10089978
450 Ga0105249_10190239
451 Ga0105148_100025
452 Ga0163162_10011254
453 Ga0163162_10039030
454 Ga0157375_10054141
455 Ga0163163_10010336
456 Ga0163163_10017210
457 Ga0163163_10222169
458 Ga0157380_10000832
459 Ga0157380_10018806
460 Ga0157380_10021023
461 Ga0157380_10082669
462 Ga0157377_10008098
463 Ga0157379_10041590
464 Ga0157376_10027254
465 Ga0157376_10208593
466 Ga0163161_10208661
467 Ga0213876_10000150
468 Ga0213876_10072400
469 Ga0207696_1020711
470 Ga0207713_1004230
471 Ga0207710_10059440
472 Ga0207680_10081759
473 Ga0207645_10069733
474 Ga0207643_10004839
475 Ga0207684_10000072
476 Ga0207684_10100423
477 Ga0207660_10205643
478 Ga0207657_10036335
479 Ga0207649_10250988
480 Ga0207646_10001142
481 Ga0207646_10031627
482 Ga0207681_10000023
483 Ga0207681_10000404
484 Ga0207681_10027768
485 Ga0207681_10162621
486 Ga0207681_10183857
487 Ga0207694_10040078
488 Ga0207694_10111198
489 Ga0207694_10230944
490 Ga0207650_10000029
491 Ga0207650_10016979
492 Ga0207650_10243187
493 Ga0207659_10280297
494 Ga0207687_10196260
495 Ga0207700_10307558
496 Ga0207644_10005550
497 Ga0207706_10004351
498 Ga0207689_10003677
499 Ga0207679_10010122
500 Ga0207667_10000860
501 Ga0207667_10134638
502 Ga0207712_10057219
503 Ga0207668_10001872
504 Ga0207668_10009630
505 Ga0207668_10049643
506 Ga0207668_10244705
507 Ga0207640_10015916
508 Ga0207658_10004958
509 Ga0207658_10085968
510 Ga0207658_10088174
511 Ga0207677_10003385
512 Ga0207703_10000193
513 Ga0207703_10103333
514 Ga0207703_10459023
515 Ga0207678_10336498
516 Ga0207708_10007510
517 Ga0207641_10000027
518 Ga0207676_10000059
519 Ga0207676_10000093
520 Ga0207674_10001556
521 Ga0207675_100009851
522 Ga0207675_100010124
523 Ga0207675_100010381
524 Ga0207675_100014016
525 Ga0207683_10246781
526 Ga0268266_10037627
527 Ga0268266_10040143
528 Ga0268266_10289119
529 Ga0268265_10000018
530 Ga0268265_10175181
531 Ga0268264_10000947
532 Ga0268264_10011511
533 Ga0268264_10020804
534 Ga0268264_10332962
535 Ga0265318_10001572
536 Ga0265339_10069236
537 Ga0265316_10062684
538 Ga0307509_10000030
539 Ga0265313_10009523
540 Ga0265314_10017775
541 Ga0307412_10284296
542 Ga0307409_100260147
543 Ga0307416_100019709
544 Ga0307415_100003126
545 Ga0307415_100198195
546 Ga0395900_0341058
547 Ga0395898_0230718
548 Ga0436364_0185014
549 Ga0436364_0978417
550 Ga0395901_0312889
551 Ga0395901_0548137
552 Ga0400483_147094
553 Ga0436365_0966870
554 Ga0436365_1190254
555 Ga0436365_1247886
556 Ga0436363_1376402
557 Ga0451577_0193293
558 Ga0466969_0001219
559 Ga0466961_0081459
560 Ga0466964_0020667
561 Ga0466970_0042017
562 Ga0466970_0066112
563 Ga0466957_0004593
564 Ga0466960_0026300
565 Ga0495594_0060380
566 Ga0496100_0011732
567 Ga0496100_0249775
568 Ga0496101_0144670
569 Ga0496102_0000109
570 Ga0496102_0001592
571 Ga0496102_0026244
572 Ga0496102_0101498
573 Ga0496102_0131468
574 Ga0496103_0000181
575 Ga0496103_0001719
576 Ga0496103_0082383
577 Ga0496103_0187390
578 Ga0496104_0001291
579 Ga0496104_0002287
580 Ga0496104_0289690
581 Ga0496105_0000428
582 Ga0496105_0001785
583 Ga0496105_0026521
584 Ga0496105_0036080
585 Ga0496105_0096684
586 Ga0496106_0213115
587 Ga0496107_0201900
588 Ga0496107_0221966
589 Ga0496108_0012866
590 Ga0496108_0143762
591 Ga0496108_0252796
592 Ga0496109_0113279
593 Ga0496110_0000336
594 Ga0496110_0017326
595 Ga0496110_0040287
596 Ga0496110_0064014
597 Ga0496111_0000281
598 Ga0496111_0053584
599 Ga0496111_0094252
600 Ga0496112_0041593
601 Ga0496113_0000041
602 Ga0496113_0027633
603 Ga0496114_0001702
604 Ga0496114_0004103
605 Ga0496114_0007806
606 Ga0496114_0111611
607 Ga0496115_0000042
608 Ga0496115_0072681
609 Ga0496116_0003926
610 Ga0496116_0035998
611 Ga0496117_0000398
612 Ga0496117_0001532
613 Ga0496117_0001905
614 Ga0496117_0003121
615 Ga0496117_0040176
616 Ga0496118_0000109
617 Ga0496118_0000227
618 Ga0496118_0006938
619 Ga0496118_0199132
620 Ga0496119_0001532
621 Ga0496119_0006218
622 Ga0496119_0022725
623 Ga0496119_0058675
624 Ga0496120_0003773
625 Ga0496120_0007859
626 Ga0496120_0013358
627 Ga0496121_0000038
628 Ga0496121_0000687
629 Ga0496121_0000831
630 Ga0496121_0003631
631 Ga0496121_0038424
632 Ga0496121_0065008
633 Ga0496121_0076811
634 Ga0496122_0002294
635 Ga0496122_0071188
636 Ga0496123_0001867
637 Ga0496123_0052331
638 Ga0496124_0000201
639 Ga0496124_0155078
640 Ga0496125_0007060
641 Ga0496125_0094902
642 Ga0496125_0207510
643 Ga0496126_0000654
644 Ga0496126_0002130
645 Ga0496126_0012301
646 Ga0501033_0000290
647 Ga0501033_0379441
648 Ga0501034_0214734
649 Ga0501047_0000652
650 Ga0501047_0171476
651 Ga0501047_0354091
652 Ga0501067_0157190
653 Ga0501070_0350591
654 Ga0501075_0043647
655 Ga0501076_0052391
656 Ga0501080_0322328
657 nmdc:mga05p37_166715_c1
658 nmdc:mga05p37_504919_c1
659 nmdc:mga09592_64678_c1
660 nmdc:mga06r32_84199_c1
661 nmdc:mga08y16_533711_c1
662 nmdc:mga08y16_88859_c1
663 Ga0500556_0000354
664 Ga0500652_007295
665 Ga0500568_0000087
666 Ga0501084_0218063
667 Ga0466962_0013768
668 2508676642
669 2558912045
670 2676199041
671 2676483302
672 2689957052
673 2691513008
674 2774843619
675 2894822000
676 2919055051
677 8002783675
678 8002786881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

53

359

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exh-assembly2.cif.gz_E crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9571 5 315
3exh-assembly2.cif.gz_G crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.955 5 314
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9546 5 317
2ozl-assembly1.cif.gz_C human pyruvate dehydrogenase s264e variant 0.9528 5 315
6cer-assembly1.cif.gz_C human pyruvate dehydrogenase complex e1 component v138m mutation 0.948 5 317
ID Description Score Start End Superfamily
af_A0A1D6GTY5_25_137_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9606 119 232 3.40.50.970
af_P12694_46_445_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9496 2 325 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9484 5 326 3.40.50.970
af_I1N1B9_20_344_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9435 9 292 3.40.50.970
af_I1KHP5_58_413_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9434 1 325 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A359MM89-F1-model_v4 deleted 0.9804 123 225
AF-A0A6M1XCA5-F1-model_v4 deleted 0.9802 121 245
AF-A0A351VIB8-F1-model_v4 Dehydrogenase 0.9788 4 236 GO:0004739
GO:0006086
AF-A0A117LN08-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) 0.9784 28 324 GO:0004739
GO:0006086
AF-A0A6I2Y6T4-F1-model_v4 Dehydrogenase E1 component domain-containing protein 0.9782 20 218 GO:0000287
GO:0004739
GO:0006086

Map