F413896

General Info

Members Datasets Scaffolds Average Seq Length
339 199 678 372

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10058063|Ga0105243_100580632
Length 415
Sequence MGRRFFLIGPTVQGVTASDLGHSLRDGAPGLRLAPRSQMPYDPRAVNFDFSPDQRSLRDQARKFLAEQASSARVRRILEGAAPYDAELWRGMGEMGWIGTAIPEAHGGAGFGYLELCVIAEELGRSLAPTPFASTIYLAAEALLLAGSEAQKKRWLPRIAQGNAIGCFALAEGAHVATAGNLTTRADGGRVTGAKLPVMDGDVADFAVLAAAEPGGRTGLFLVDLKGAGVTRTPLTTVDPTRSHARLVFDGTAAEPLGAPGAGWPLVERLLDRAAVLVAFEQLGGAQAALDMAREYAIGRFAFGRQIASFQAIKHKLADMYVGVELARSNTYYGAWALNTDAAELPVAAAAARXXXXEAYYQAAKENIQVHGGMGFTWEFDCHLHYRRAKLTGLVLGSARRWKDLLVSRLEAGAA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.29
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10058063 3300009148 Bacteria 3083
2 Ga0065165_1019105 3300005262 Bacteria 2459
3 Ga0070676_10000459 3300005328 Bacteria 19463
4 Ga0070683_100108256 3300005329 Bacteria 2621
5 Ga0070670_100014832 3300005331 Bacteria 6681
6 Ga0068869_100001223 3300005334 Bacteria 15106
7 Ga0068869_100005061 3300005334 Bacteria 8263
8 Ga0068869_100031798 3300005334 Bacteria 3715
9 Ga0070680_100001404 3300005336 Bacteria 17393
10 Ga0070680_100029101 3300005336 Bacteria 4436
11 Ga0070682_100001489 3300005337 Bacteria 13135
12 Ga0068868_100222384 3300005338 Bacteria 1581
13 Ga0070660_100009266 3300005339 Bacteria 6919
14 Ga0070689_100078842 3300005340 Bacteria 2583
15 Ga0070689_100139072 3300005340 Bacteria 1952
16 Ga0070691_10002539 3300005341 Bacteria 8133
17 Ga0070691_10075792 3300005341 Bacteria 1639
18 Ga0070687_100001837 3300005343 Bacteria 7684
19 Ga0070661_100006607 3300005344 Bacteria 7999
20 Ga0070692_10013374 3300005345 Bacteria 3824
21 Ga0070668_100212117 3300005347 Bacteria 1593
22 Ga0070669_100027125 3300005353 Bacteria 4123
23 Ga0070673_100013172 3300005364 Bacteria 5707
24 Ga0070659_100001234 3300005366 Bacteria 18550
25 Ga0070667_100100348 3300005367 Bacteria 2500
26 Ga0070703_10000822 3300005406 Bacteria 10098
27 Ga0070701_10049771 3300005438 Bacteria 2167
28 Ga0070705_100003678 3300005440 Bacteria 7510
29 Ga0070705_100053293 3300005440 Bacteria 2367
30 Ga0070705_100192459 3300005440 Bacteria 1391
31 Ga0070700_100068065 3300005441 Bacteria 2263
32 Ga0070694_100001184 3300005444 Bacteria 14991
33 Ga0070694_100003798 3300005444 Bacteria 9013
34 Ga0070694_100049472 3300005444 Bacteria 2831
35 Ga0070708_100010003 3300005445 Bacteria 7674
36 Ga0070708_100035178 3300005445 Bacteria 4362
37 Ga0070708_100167777 3300005445 Bacteria 2048
38 Ga0070663_100091965 3300005455 Bacteria 2249
39 Ga0070662_100003722 3300005457 Bacteria 9543
40 Ga0070662_100115114 3300005457 Bacteria 2054
41 Ga0070681_10004707 3300005458 Bacteria 13062
42 Ga0068867_100163471 3300005459 Bacteria 1757
43 Ga0070685_10017870 3300005466 Bacteria 3805
44 Ga0070706_100007847 3300005467 Bacteria 9974
45 Ga0070706_100035389 3300005467 Bacteria 4612
46 Ga0070706_100138404 3300005467 Bacteria 2272
47 Ga0070707_100064841 3300005468 Bacteria 3508
48 Ga0070707_100214699 3300005468 Bacteria 1875
49 Ga0070698_100003263 3300005471 Bacteria 17820
50 Ga0070698_100040779 3300005471 Bacteria 4769
51 Ga0070699_100039379 3300005518 Bacteria 4092
52 Ga0070679_100000297 3300005530 Bacteria 42324
53 Ga0070697_100002121 3300005536 Bacteria 15200
54 Ga0068853_100006091 3300005539 Bacteria 9548
55 Ga0070672_100012633 3300005543 Bacteria 5940
56 Ga0070672_100044435 3300005543 Bacteria 3431
57 Ga0070686_100171777 3300005544 Bacteria 1534
58 Ga0070695_100003770 3300005545 Bacteria 8841
59 Ga0070695_100072545 3300005545 Bacteria 2258
60 Ga0070696_100003774 3300005546 Bacteria 10119
61 Ga0070696_100008634 3300005546 Bacteria 6814
62 Ga0070693_100000123 3300005547 Bacteria 34654
63 Ga0070693_100162085 3300005547 Bacteria 1425
64 Ga0070704_100004745 3300005549 Bacteria 7866
65 Ga0070704_100039657 3300005549 Bacteria 3235
66 Ga0070704_100116656 3300005549 Bacteria 2042
67 Ga0070704_100120402 3300005549 Bacteria 2015
68 Ga0068855_100008171 3300005563 Bacteria 12651
69 Ga0068855_100222104 3300005563 Bacteria 2118
70 Ga0070664_100041511 3300005564 Bacteria 3882
71 Ga0068857_100027612 3300005577 Bacteria 5007
72 Ga0068854_100001641 3300005578 Bacteria 13604
73 Ga0068856_100008341 3300005614 Bacteria 10093
74 Ga0068859_100010830 3300005617 Bacteria 9176
75 Ga0068859_100013906 3300005617 Bacteria 8074
76 Ga0068859_100052640 3300005617 Bacteria 4093
77 Ga0068859_100213735 3300005617 Bacteria 2015
78 Ga0068864_100010710 3300005618 Bacteria 7579
79 Ga0068861_100182031 3300005719 Bacteria 1750
80 Ga0068870_10001309 3300005840 Bacteria 10024
81 Ga0068870_10122811 3300005840 Bacteria 1498
82 Ga0068863_100030132 3300005841 Bacteria 5183
83 Ga0068860_100029951 3300005843 Bacteria 5235
84 Ga0068860_100056843 3300005843 Bacteria 3718
85 Ga0068860_100081194 3300005843 Bacteria 3083
86 Ga0068860_100123526 3300005843 Bacteria 2480
87 Ga0068862_100002862 3300005844 Bacteria 15125
88 Ga0068862_100008350 3300005844 Bacteria 8571
89 Ga0068862_100009942 3300005844 Bacteria 7859
90 Ga0068862_100010895 3300005844 Bacteria 7507
91 Ga0068862_100133721 3300005844 Bacteria 2196
92 Ga0081455_10000058 3300005937 Bacteria 119171
93 Ga0081455_10015653 3300005937 Bacteria 7355
94 Ga0081540_1000040 3300005983 Bacteria 136968
95 Ga0081540_1018028 3300005983 Bacteria 4346
96 Ga0070716_100026310 3300006173 Bacteria 3115
97 Ga0070712_100010154 3300006175 Bacteria 5934
98 Ga0070712_100187079 3300006175 Bacteria 1617
99 Ga0075428_100000367 3300006844 Bacteria 44787
100 Ga0075428_100003950 3300006844 Bacteria 16269
101 Ga0075428_100165756 3300006844 Bacteria 2397
102 Ga0075428_100361033 3300006844 Bacteria 1558
103 Ga0075430_100000036 3300006846 Bacteria 68655
104 Ga0075430_100032586 3300006846 Bacteria 4423
105 Ga0075431_100000054 3300006847 Bacteria 62862
106 Ga0075431_100004891 3300006847 Bacteria 13195
107 Ga0075431_100005295 3300006847 Bacteria 12717
108 Ga0075433_10019911 3300006852 Bacteria 5602
109 Ga0075433_10037134 3300006852 Bacteria 4201
110 Ga0075434_100013058 3300006871 Bacteria 7887
111 Ga0075434_100031802 3300006871 Bacteria 5203
112 Ga0075434_100305297 3300006871 Bacteria 1612
113 Ga0075429_100000001 3300006880 Bacteria 139031
114 Ga0075429_100027661 3300006880 Bacteria 4922
115 Ga0075429_100087103 3300006880 Bacteria 2722
116 Ga0075429_100102639 3300006880 Bacteria 2497
117 Ga0068865_100214358 3300006881 Bacteria 1502
118 Ga0075436_100008216 3300006914 Bacteria 7141
119 Ga0097620_100010830 3300006931 Bacteria 9176
120 Ga0097620_100013906 3300006931 Bacteria 8074
121 Ga0097620_100052639 3300006931 Bacteria 4093
122 Ga0097620_100213731 3300006931 Bacteria 2015
123 Ga0075435_100100281 3300007076 Bacteria 2399
124 Ga0075435_100192058 3300007076 Bacteria 1729
125 Ga0111539_10002743 3300009094 Bacteria 23376
126 Ga0111539_10068470 3300009094 Bacteria 4191
127 Ga0111539_10224669 3300009094 Bacteria 2187
128 Ga0105245_10070519 3300009098 Bacteria 3171
129 Ga0114129_10059505 3300009147 Bacteria 5341
130 Ga0114129_10136458 3300009147 Bacteria 3366
131 Ga0114129_10160348 3300009147 Bacteria 3073
132 Ga0114129_10425674 3300009147 Bacteria 1745
133 Ga0105243_10005000 3300009148 Bacteria 10390
134 Ga0105243_10111019 3300009148 Bacteria 2294
135 Ga0105243_10322885 3300009148 Bacteria 1407
136 Ga0105243_10401490 3300009148 Bacteria 1273
137 Ga0105241_10008014 3300009174 Bacteria 7771
138 Ga0105241_10075361 3300009174 Bacteria 2629
139 Ga0105242_10112796 3300009176 Bacteria 2321
140 Ga0105248_10051511 3300009177 Bacteria 4619
141 Ga0105237_10221993 3300009545 Bacteria 1890
142 Ga0105238_10077738 3300009551 Bacteria 3309
143 Ga0105249_10049661 3300009553 Bacteria 3825
144 Ga0105249_10237644 3300009553 Bacteria 1800
145 Ga0105249_10381323 3300009553 Bacteria 1436
146 Ga0105239_10383739 3300010375 Bacteria 1589
147 Ga0157373_10002254 3300013100 Bacteria 14609
148 Ga0157369_10017389 3300013105 Bacteria 8082
149 Ga0157378_10027670 3300013297 Bacteria 5001
150 Ga0163162_10023819 3300013306 Bacteria 6042
151 Ga0157372_10000213 3300013307 Bacteria 64792
152 Ga0157375_10052457 3300013308 Bacteria 4009
153 Ga0207653_10000630 3300025885 Bacteria 12169
154 Ga0207688_10045235 3300025901 Bacteria 2455
155 Ga0207645_10000322 3300025907 Bacteria 39916
156 Ga0207643_10000277 3300025908 Bacteria 35621
157 Ga0207643_10011806 3300025908 Bacteria 4715
158 Ga0207684_10000711 3300025910 Bacteria 39198
159 Ga0207684_10030629 3300025910 Bacteria 4579
160 Ga0207684_10139494 3300025910 Bacteria 2083
161 Ga0207654_10108695 3300025911 Bacteria 1721
162 Ga0207707_10001701 3300025912 Bacteria 20239
163 Ga0207707_10003393 3300025912 Bacteria 14140
164 Ga0207693_10003246 3300025915 Bacteria 13955
165 Ga0207662_10012899 3300025918 Bacteria 4664
166 Ga0207657_10016434 3300025919 Bacteria 7140
167 Ga0207649_10004517 3300025920 Bacteria 7553
168 Ga0207652_10000467 3300025921 Bacteria 41423
169 Ga0207646_10001556 3300025922 Bacteria 28080
170 Ga0207646_10076277 3300025922 Bacteria 2995
171 Ga0207681_10012968 3300025923 Bacteria 5152
172 Ga0207650_10010262 3300025925 Bacteria 6421
173 Ga0207690_10007470 3300025932 Bacteria 6487
174 Ga0207686_10055748 3300025934 Bacteria 2481
175 Ga0207709_10182604 3300025935 Bacteria 1483
176 Ga0207670_10086100 3300025936 Bacteria 2210
177 Ga0207704_10143596 3300025938 Bacteria 1674
178 Ga0207704_10172050 3300025938 Bacteria 1555
179 Ga0207704_10182732 3300025938 Bacteria 1517
180 Ga0207665_10046980 3300025939 Bacteria 2893
181 Ga0207691_10032477 3300025940 Bacteria 4866
182 Ga0207711_10249307 3300025941 Bacteria 1630
183 Ga0207689_10000020 3300025942 Bacteria 110705
184 Ga0207689_10011761 3300025942 Bacteria 7501
185 Ga0207689_10045109 3300025942 Bacteria 3646
186 Ga0207661_10057148 3300025944 Bacteria 3136
187 Ga0207679_10003780 3300025945 Bacteria 9379
188 Ga0207667_10019632 3300025949 Bacteria 7537
189 Ga0207712_10111048 3300025961 Bacteria 2056
190 Ga0207668_10052399 3300025972 Bacteria 2823
191 Ga0207668_10194302 3300025972 Bacteria 1611
192 Ga0207640_10002414 3300025981 Bacteria 9995
193 Ga0207658_10192642 3300025986 Bacteria 1696
194 Ga0207677_10070203 3300026023 Bacteria 2468
195 Ga0207639_10015361 3300026041 Bacteria 5402
196 Ga0207678_10033507 3300026067 Bacteria 4473
197 Ga0207708_10194694 3300026075 Bacteria 1615
198 Ga0207641_10121988 3300026088 Bacteria 2327
199 Ga0207648_10023746 3300026089 Bacteria 5486
200 Ga0207648_10068482 3300026089 Bacteria 3092
201 Ga0207676_10036568 3300026095 Bacteria 3737
202 Ga0207676_10103275 3300026095 Bacteria 2368
203 Ga0207674_10000665 3300026116 Bacteria 44712
204 Ga0207674_10012824 3300026116 Bacteria 9354
205 Ga0207675_100010687 3300026118 Bacteria 8600
206 Ga0207675_100318903 3300026118 Bacteria 1517
207 Ga0209983_1000293 3300027665 Bacteria 10405
208 Ga0209971_1000296 3300027682 Bacteria 13934
209 Ga0209966_1000063 3300027695 Bacteria 47732
210 Ga0209998_10000058 3300027717 Bacteria 46200
211 Ga0207428_10017466 3300027907 Bacteria 6156
212 Ga0207428_10120742 3300027907 Bacteria 2010
213 Ga0207428_10183019 3300027907 Bacteria 1582
214 Ga0268265_10004800 3300028380 Bacteria 9319
215 Ga0268265_10089948 3300028380 Bacteria 2451
216 Ga0268265_10100596 3300028380 Bacteria 2334
217 Ga0268265_10118821 3300028380 Bacteria 2174
218 Ga0268264_10010351 3300028381 Bacteria 7714
219 Ga0268264_10052431 3300028381 Bacteria 3400
220 Ga0268264_10268979 3300028381 Bacteria 1591
221 Ga0268264_10371979 3300028381 Bacteria 1366
222 Ga0307517_10023304 3300028786 Bacteria 7701
223 Ga0307513_10004213 3300031456 Bacteria 19230
224 Ga0307513_10016000 3300031456 Bacteria 9066
225 Ga0307513_10210621 3300031456 Bacteria 1775
226 Ga0307408_100020419 3300031548 Bacteria 4472
227 Ga0307516_10000020 3300031730 Bacteria 195931
228 Ga0307516_10000539 3300031730 Bacteria 50564
229 Ga0307416_100016552 3300032002 Bacteria 5130
230 Ga0307416_100331815 3300032002 Bacteria 1529
231 Ga0373940_0005048 3300035088 Bacteria 2835
232 Ga0373949_0024803 3300035090 Bacteria 1396
233 Ga0373939_0013489 3300035114 Bacteria 2104
234 Ga0373960_0006369 3300035121 Bacteria 2768
235 Ga0373960_0022818 3300035121 Bacteria 1680
236 Ga0373960_0023915 3300035121 Bacteria 1648
237 Ga0373942_0013759 3300035207 Bacteria 1950
238 Ga0373931_0005435 3300035691 Bacteria 5890
239 Ga0373931_0007639 3300035691 Bacteria 5098
240 Ga0395899_0007332 3300037312 Bacteria 8532
241 Ga0395900_0012014 3300037418 Bacteria 8852
242 Ga0395898_0066143 3300037466 Bacteria 3503
243 Ga0395901_0005260 3300038443 Bacteria 13072
244 Ga0400483_216164 3300039062 Bacteria 1722
245 Ga0436360_0506572 3300039438 Bacteria 1837
246 Ga0436361_1181647 3300039447 Unclassified 1634
247 Ga0439460_0000681 3300042461 Bacteria 7508
248 Ga0451577_0021746 3300042876 Bacteria 5865
249 Ga0451577_0049002 3300042876 Bacteria 3772
250 Ga0453683_0021317 3300044673 Bacteria 4138
251 Ga0451576_0006840 3300045051 Bacteria 13840
252 Ga0451576_0012311 3300045051 Bacteria 9618
253 Ga0495598_0025988 3300046537 Bacteria 1601
254 Ga0495669_0010878 3300046684 Bacteria 3852
255 Ga0495672_0007267 3300047320 Bacteria 8355
256 Ga0495686_0065254 3300047472 Bacteria 2251
257 Ga0496102_0139262 3300048905 Bacteria 2275
258 Ga0496126_0081672 3300048929 Bacteria 2857
259 Ga0501032_0000642 3300049569 Bacteria 28381
260 Ga0501033_0036929 3300049570 Bacteria 3659
261 Ga0501034_0013359 3300049571 Bacteria 8454
262 Ga0501034_0070787 3300049571 Bacteria 3498
263 Ga0501034_0079828 3300049571 Bacteria 3275
264 Ga0501036_0130274 3300049572 Bacteria 2124
265 Ga0501036_0150258 3300049572 Bacteria 1965
266 Ga0501036_0208156 3300049572 Bacteria 1644
267 Ga0501037_0023032 3300049573 Bacteria 4606
268 Ga0501039_0067950 3300049575 Bacteria 2767
269 Ga0501040_0002992 3300049576 Bacteria 10940
270 Ga0501040_0266431 3300049576 Bacteria 1223
271 Ga0501042_0003630 3300049578 Bacteria 9731
272 Ga0501043_0065063 3300049579 Bacteria 2863
273 Ga0501043_0183869 3300049579 Bacteria 1628
274 Ga0501046_0000641 3300049580 Bacteria 34259
275 Ga0501046_0168822 3300049580 Bacteria 1643
276 Ga0501047_0003512 3300049581 Bacteria 14813
277 Ga0501047_0012161 3300049581 Bacteria 8147
278 Ga0501047_0015077 3300049581 Bacteria 7357
279 Ga0501047_0020744 3300049581 Bacteria 6312
280 Ga0501067_0000974 3300049583 Bacteria 15368
281 Ga0501067_0050733 3300049583 Bacteria 2299
282 Ga0501068_0002175 3300049584 Bacteria 10440
283 Ga0501072_0033162 3300049588 Bacteria 4046
284 Ga0501072_0201727 3300049588 Bacteria 1586
285 Ga0501073_0000005 3300049589 Bacteria 237180
286 Ga0501073_0008072 3300049589 Bacteria 7809
287 Ga0501074_0214306 3300049590 Bacteria 1371
288 Ga0501075_0062797 3300049591 Bacteria 2800
289 Ga0501075_0085742 3300049591 Bacteria 2386
290 Ga0501075_0277023 3300049591 Bacteria 1278
291 Ga0501076_0002744 3300049592 Bacteria 12198
292 Ga0501077_0000039 3300049593 Bacteria 65680
293 Ga0501077_0086160 3300049593 Bacteria 1991
294 Ga0501077_0169004 3300049593 Bacteria 1389
295 Ga0501079_0000614 3300049741 Bacteria 23614
296 Ga0501079_0034855 3300049741 Bacteria 3873
297 Ga0501079_0133940 3300049741 Bacteria 1929
298 Ga0501080_0000335 3300049742 Bacteria 36045
299 Ga0501080_0000950 3300049742 Bacteria 23703
300 Ga0501080_0006046 3300049742 Bacteria 10848
301 Ga0501080_0256590 3300049742 Bacteria 1594
302 Ga0501081_0003729 3300049743 Bacteria 9762
303 Ga0501081_0003940 3300049743 Bacteria 9513
304 Ga0501081_0062368 3300049743 Bacteria 2586
305 Ga0501083_0023223 3300049744 Bacteria 4302
306 Ga0501035_0080290 3300049822 Bacteria 2880
307 Ga0501044_0004094 3300049823 Bacteria 16356
308 Ga0501044_0019227 3300049823 Bacteria 7313
309 Ga0501044_0091586 3300049823 Bacteria 3067
310 Ga0501045_0001562 3300049824 Bacteria 15250
311 nmdc:mga05p37_111577_c1 3300050507 Bacteria 3363
312 nmdc:mga05p37_132131_c1 3300050507 Bacteria 3063
313 nmdc:mga05p37_13672_c1 3300050507 Bacteria 9726
314 nmdc:mga05p37_51770_c1 3300050507 Bacteria 5049
315 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
316 nmdc:mga0qj67_508_c1 3300050509 Bacteria 26601
317 nmdc:mga06r32_11458_c1 3300050510 Bacteria 7985
318 nmdc:mga06r32_1164_c1 3300050510 Bacteria 23678
319 nmdc:mga06r32_3135_c1 3300050510 Bacteria 14812
320 nmdc:mga08y16_133543_c1 3300050511 Bacteria 2580
321 nmdc:mga08y16_181851_c1 3300050511 Bacteria 2183
322 nmdc:mga08y16_63408_c1 3300050511 Bacteria 3860
323 nmdc:mga08y16_69329_c1 3300050511 Bacteria 3676
324 nmdc:mga0n895_50205_c1 3300050512 Bacteria 4089
325 nmdc:mga0rr50_291905_c1 3300050513 Bacteria 1363
326 nmdc:mga08x19_55779_c1 3300050514 Bacteria 2548
327 nmdc:mga0a205_14093_c1 3300050515 Bacteria 7460
328 nmdc:mga0a205_178442_c1 3300050515 Bacteria 2019
329 nmdc:mga0a205_198037_c1 3300050515 Bacteria 1900
330 Ga0501084_0005327 3300054114 Bacteria 10532
331 Ga0501084_0016660 3300054114 Bacteria 6104
332 Ga0501084_0078563 3300054114 Bacteria 2766
333 Ga0501084_0263568 3300054114 Bacteria 1455
334 Ga0501082_0005152 3300060353 Bacteria 11376
335 Ga0501082_0006935 3300060353 Bacteria 9791
336 Ga0501082_0030370 3300060353 Bacteria 4657
337 Ga0501082_0299280 3300060353 Bacteria 1401
338 Ga0530510_0020663 3300061734 Bacteria 4681
339 Ga0530510_0079628 3300061734 Bacteria 2383
340 Ga0105243_10058063
341 Ga0065165_1019105
342 Ga0070676_10000459
343 Ga0070683_100108256
344 Ga0070670_100014832
345 Ga0068869_100001223
346 Ga0068869_100005061
347 Ga0068869_100031798
348 Ga0070680_100001404
349 Ga0070680_100029101
350 Ga0070682_100001489
351 Ga0068868_100222384
352 Ga0070660_100009266
353 Ga0070689_100078842
354 Ga0070689_100139072
355 Ga0070691_10002539
356 Ga0070691_10075792
357 Ga0070687_100001837
358 Ga0070661_100006607
359 Ga0070692_10013374
360 Ga0070668_100212117
361 Ga0070669_100027125
362 Ga0070673_100013172
363 Ga0070659_100001234
364 Ga0070667_100100348
365 Ga0070703_10000822
366 Ga0070701_10049771
367 Ga0070705_100003678
368 Ga0070705_100053293
369 Ga0070705_100192459
370 Ga0070700_100068065
371 Ga0070694_100001184
372 Ga0070694_100003798
373 Ga0070694_100049472
374 Ga0070708_100010003
375 Ga0070708_100035178
376 Ga0070708_100167777
377 Ga0070663_100091965
378 Ga0070662_100003722
379 Ga0070662_100115114
380 Ga0070681_10004707
381 Ga0068867_100163471
382 Ga0070685_10017870
383 Ga0070706_100007847
384 Ga0070706_100035389
385 Ga0070706_100138404
386 Ga0070707_100064841
387 Ga0070707_100214699
388 Ga0070698_100003263
389 Ga0070698_100040779
390 Ga0070699_100039379
391 Ga0070679_100000297
392 Ga0070697_100002121
393 Ga0068853_100006091
394 Ga0070672_100012633
395 Ga0070672_100044435
396 Ga0070686_100171777
397 Ga0070695_100003770
398 Ga0070695_100072545
399 Ga0070696_100003774
400 Ga0070696_100008634
401 Ga0070693_100000123
402 Ga0070693_100162085
403 Ga0070704_100004745
404 Ga0070704_100039657
405 Ga0070704_100116656
406 Ga0070704_100120402
407 Ga0068855_100008171
408 Ga0068855_100222104
409 Ga0070664_100041511
410 Ga0068857_100027612
411 Ga0068854_100001641
412 Ga0068856_100008341
413 Ga0068859_100010830
414 Ga0068859_100013906
415 Ga0068859_100052640
416 Ga0068859_100213735
417 Ga0068864_100010710
418 Ga0068861_100182031
419 Ga0068870_10001309
420 Ga0068870_10122811
421 Ga0068863_100030132
422 Ga0068860_100029951
423 Ga0068860_100056843
424 Ga0068860_100081194
425 Ga0068860_100123526
426 Ga0068862_100002862
427 Ga0068862_100008350
428 Ga0068862_100009942
429 Ga0068862_100010895
430 Ga0068862_100133721
431 Ga0081455_10000058
432 Ga0081455_10015653
433 Ga0081540_1000040
434 Ga0081540_1018028
435 Ga0070716_100026310
436 Ga0070712_100010154
437 Ga0070712_100187079
438 Ga0075428_100000367
439 Ga0075428_100003950
440 Ga0075428_100165756
441 Ga0075428_100361033
442 Ga0075430_100000036
443 Ga0075430_100032586
444 Ga0075431_100000054
445 Ga0075431_100004891
446 Ga0075431_100005295
447 Ga0075433_10019911
448 Ga0075433_10037134
449 Ga0075434_100013058
450 Ga0075434_100031802
451 Ga0075434_100305297
452 Ga0075429_100000001
453 Ga0075429_100027661
454 Ga0075429_100087103
455 Ga0075429_100102639
456 Ga0068865_100214358
457 Ga0075436_100008216
458 Ga0097620_100010830
459 Ga0097620_100013906
460 Ga0097620_100052639
461 Ga0097620_100213731
462 Ga0075435_100100281
463 Ga0075435_100192058
464 Ga0111539_10002743
465 Ga0111539_10068470
466 Ga0111539_10224669
467 Ga0105245_10070519
468 Ga0114129_10059505
469 Ga0114129_10136458
470 Ga0114129_10160348
471 Ga0114129_10425674
472 Ga0105243_10005000
473 Ga0105243_10111019
474 Ga0105243_10322885
475 Ga0105243_10401490
476 Ga0105241_10008014
477 Ga0105241_10075361
478 Ga0105242_10112796
479 Ga0105248_10051511
480 Ga0105237_10221993
481 Ga0105238_10077738
482 Ga0105249_10049661
483 Ga0105249_10237644
484 Ga0105249_10381323
485 Ga0105239_10383739
486 Ga0157373_10002254
487 Ga0157369_10017389
488 Ga0157378_10027670
489 Ga0163162_10023819
490 Ga0157372_10000213
491 Ga0157375_10052457
492 Ga0207653_10000630
493 Ga0207688_10045235
494 Ga0207645_10000322
495 Ga0207643_10000277
496 Ga0207643_10011806
497 Ga0207684_10000711
498 Ga0207684_10030629
499 Ga0207684_10139494
500 Ga0207654_10108695
501 Ga0207707_10001701
502 Ga0207707_10003393
503 Ga0207693_10003246
504 Ga0207662_10012899
505 Ga0207657_10016434
506 Ga0207649_10004517
507 Ga0207652_10000467
508 Ga0207646_10001556
509 Ga0207646_10076277
510 Ga0207681_10012968
511 Ga0207650_10010262
512 Ga0207690_10007470
513 Ga0207686_10055748
514 Ga0207709_10182604
515 Ga0207670_10086100
516 Ga0207704_10143596
517 Ga0207704_10172050
518 Ga0207704_10182732
519 Ga0207665_10046980
520 Ga0207691_10032477
521 Ga0207711_10249307
522 Ga0207689_10000020
523 Ga0207689_10011761
524 Ga0207689_10045109
525 Ga0207661_10057148
526 Ga0207679_10003780
527 Ga0207667_10019632
528 Ga0207712_10111048
529 Ga0207668_10052399
530 Ga0207668_10194302
531 Ga0207640_10002414
532 Ga0207658_10192642
533 Ga0207677_10070203
534 Ga0207639_10015361
535 Ga0207678_10033507
536 Ga0207708_10194694
537 Ga0207641_10121988
538 Ga0207648_10023746
539 Ga0207648_10068482
540 Ga0207676_10036568
541 Ga0207676_10103275
542 Ga0207674_10000665
543 Ga0207674_10012824
544 Ga0207675_100010687
545 Ga0207675_100318903
546 Ga0209983_1000293
547 Ga0209971_1000296
548 Ga0209966_1000063
549 Ga0209998_10000058
550 Ga0207428_10017466
551 Ga0207428_10120742
552 Ga0207428_10183019
553 Ga0268265_10004800
554 Ga0268265_10089948
555 Ga0268265_10100596
556 Ga0268265_10118821
557 Ga0268264_10010351
558 Ga0268264_10052431
559 Ga0268264_10268979
560 Ga0268264_10371979
561 Ga0307517_10023304
562 Ga0307513_10004213
563 Ga0307513_10016000
564 Ga0307513_10210621
565 Ga0307408_100020419
566 Ga0307516_10000020
567 Ga0307516_10000539
568 Ga0307416_100016552
569 Ga0307416_100331815
570 Ga0373940_0005048
571 Ga0373949_0024803
572 Ga0373939_0013489
573 Ga0373960_0006369
574 Ga0373960_0022818
575 Ga0373960_0023915
576 Ga0373942_0013759
577 Ga0373931_0005435
578 Ga0373931_0007639
579 Ga0395899_0007332
580 Ga0395900_0012014
581 Ga0395898_0066143
582 Ga0395901_0005260
583 Ga0400483_216164
584 Ga0436360_0506572
585 Ga0436361_1181647
586 Ga0439460_0000681
587 Ga0451577_0021746
588 Ga0451577_0049002
589 Ga0453683_0021317
590 Ga0451576_0006840
591 Ga0451576_0012311
592 Ga0495598_0025988
593 Ga0495669_0010878
594 Ga0495672_0007267
595 Ga0495686_0065254
596 Ga0496102_0139262
597 Ga0496126_0081672
598 Ga0501032_0000642
599 Ga0501033_0036929
600 Ga0501034_0013359
601 Ga0501034_0070787
602 Ga0501034_0079828
603 Ga0501036_0130274
604 Ga0501036_0150258
605 Ga0501036_0208156
606 Ga0501037_0023032
607 Ga0501039_0067950
608 Ga0501040_0002992
609 Ga0501040_0266431
610 Ga0501042_0003630
611 Ga0501043_0065063
612 Ga0501043_0183869
613 Ga0501046_0000641
614 Ga0501046_0168822
615 Ga0501047_0003512
616 Ga0501047_0012161
617 Ga0501047_0015077
618 Ga0501047_0020744
619 Ga0501067_0000974
620 Ga0501067_0050733
621 Ga0501068_0002175
622 Ga0501072_0033162
623 Ga0501072_0201727
624 Ga0501073_0000005
625 Ga0501073_0008072
626 Ga0501074_0214306
627 Ga0501075_0062797
628 Ga0501075_0085742
629 Ga0501075_0277023
630 Ga0501076_0002744
631 Ga0501077_0000039
632 Ga0501077_0086160
633 Ga0501077_0169004
634 Ga0501079_0000614
635 Ga0501079_0034855
636 Ga0501079_0133940
637 Ga0501080_0000335
638 Ga0501080_0000950
639 Ga0501080_0006046
640 Ga0501080_0256590
641 Ga0501081_0003729
642 Ga0501081_0003940
643 Ga0501081_0062368
644 Ga0501083_0023223
645 Ga0501035_0080290
646 Ga0501044_0004094
647 Ga0501044_0019227
648 Ga0501044_0091586
649 Ga0501045_0001562
650 nmdc:mga05p37_111577_c1
651 nmdc:mga05p37_132131_c1
652 nmdc:mga05p37_13672_c1
653 nmdc:mga05p37_51770_c1
654 nmdc:mga09592_66_c1
655 nmdc:mga0qj67_508_c1
656 nmdc:mga06r32_11458_c1
657 nmdc:mga06r32_1164_c1
658 nmdc:mga06r32_3135_c1
659 nmdc:mga08y16_133543_c1
660 nmdc:mga08y16_181851_c1
661 nmdc:mga08y16_63408_c1
662 nmdc:mga08y16_69329_c1
663 nmdc:mga0n895_50205_c1
664 nmdc:mga0rr50_291905_c1
665 nmdc:mga08x19_55779_c1
666 nmdc:mga0a205_14093_c1
667 nmdc:mga0a205_178442_c1
668 nmdc:mga0a205_198037_c1
669 Ga0501084_0005327
670 Ga0501084_0016660
671 Ga0501084_0078563
672 Ga0501084_0263568
673 Ga0501082_0005152
674 Ga0501082_0006935
675 Ga0501082_0030370
676 Ga0501082_0299280
677 Ga0530510_0020663
678 Ga0530510_0079628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

261

410

0.97

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

51

163

0.88

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

276

387

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fah-assembly1.cif.gz_C molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction 0.9473 3 369
4l1f-assembly1.cif.gz_A electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation 0.9367 1 369
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9367 5 374
5lnx-assembly2.cif.gz_G crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9341 12 369
3mpi-assembly2.cif.gz_C structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex 0.9327 1 366
ID Description Score Start End Superfamily
af_Q22347_263_410_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9576 228 372 1.20.140.10
af_Q9VDT1_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9574 226 372 1.20.140.10
af_A0A0K3AQR2_269_362_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9574 226 315 1.20.140.10
af_Q6AXI7_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9567 226 374 1.20.140.10
af_Q22781_259_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9561 226 371 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A3B0R8Q6-F1-model_v4 Acyl-CoA dehydrogenase 0.9823 1 305 GO:0003995
GO:0050660
AF-A0A3B0R8Q6-F1-model_v4 Acyl-CoA dehydrogenase 0.9791 1 305 GO:0003995
GO:0050660
AF-A0A2E1W7Z5-F1-model_v4 Acyl-CoA dehydrogenase 0.9752 1 374 GO:0003995
GO:0050660
AF-A0A2E1W7Z5-F1-model_v4 Acyl-CoA dehydrogenase 0.97 1 374 GO:0003995
GO:0050660
AF-X1VUV6-F1-model_v4 Acyl-CoA dehydrogenase/oxidase C-terminal domain-containing protein 0.9645 217 367 GO:0003995

Map