F413828

General Info

Members Datasets Scaffolds Average Seq Length
339 166 678 252

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100002271|Ga0070698_1000022718
Length 271
Sequence MTVAADTSGKLLSEADFMAGFHAIGEERYHHKHPFHLLMHDGKLTHGQLQAWALNRYYYQSRIPIKDAAILARSDDPAFRLAWRKRILDHDGDGTNPGGIEKWLRLVEATGLSRNLALCGDGILPATRYAVQAYVDFVSARSHLEAVASSLTELFSKKLITLRMDRLRQHYPWLSSGLDYFAARLTQASEDADFALAWVVKHAQTRTEQDLAHAALRAKCDILWAQLDALYFAYVNPGWPPPAAFVPSSVGTPACAPASHGMSPALGHKTK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
86 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.65
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 12.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100002271 3300005471 Bacteria 21272
2 LJNas_1000026 3300000546 Bacteria 19576
3 Ga0065707_10272272 3300005295 Bacteria 1068
4 Ga0070680_100186737 3300005336 Bacteria 1746
5 Ga0070709_10013128 3300005434 Bacteria 4650
6 Ga0070709_10041927 3300005434 Bacteria 2823
7 Ga0070714_100065387 3300005435 Bacteria 3132
8 Ga0070714_100870616 3300005435 Bacteria 874
9 Ga0070713_100008024 3300005436 Bacteria 7461
10 Ga0070713_100009701 3300005436 Bacteria 6913
11 Ga0070713_100015746 3300005436 Bacteria 5666
12 Ga0070713_100018825 3300005436 Bacteria 5256
13 Ga0070713_100021388 3300005436 Bacteria 4974
14 Ga0070710_10041468 3300005437 Bacteria 2542
15 Ga0070711_100010084 3300005439 Bacteria 5837
16 Ga0070711_100037288 3300005439 Bacteria 3261
17 Ga0070711_100039201 3300005439 Bacteria 3189
18 Ga0070711_100309762 3300005439 Bacteria 1258
19 Ga0070705_100001919 3300005440 Bacteria 10680
20 Ga0070694_100036841 3300005444 Bacteria 3242
21 Ga0070708_100002491 3300005445 Bacteria 14219
22 Ga0070708_100035891 3300005445 Unclassified 4322
23 Ga0070708_100056961 3300005445 Bacteria 3478
24 Ga0070708_100141022 3300005445 Unclassified 2235
25 Ga0070708_100618793 3300005445 Bacteria 1021
26 Ga0070706_100000665 3300005467 Bacteria 39170
27 Ga0070706_100006770 3300005467 Bacteria 10819
28 Ga0070706_100027996 3300005467 Bacteria 5184
29 Ga0070706_100312427 3300005467 Bacteria 1466
30 Ga0070707_100048527 3300005468 Bacteria 4066
31 Ga0070707_100104853 3300005468 Bacteria 2741
32 Ga0070707_100113974 3300005468 Bacteria 2623
33 Ga0070698_100001063 3300005471 Bacteria 30156
34 Ga0070698_100028715 3300005471 Bacteria 5775
35 Ga0070698_100094696 3300005471 Bacteria 2965
36 Ga0070699_100002090 3300005518 Bacteria 18072
37 Ga0070699_100011081 3300005518 Bacteria 7795
38 Ga0070699_100083585 3300005518 Unclassified 2785
39 Ga0070699_100305019 3300005518 Bacteria 1429
40 Ga0070699_100469665 3300005518 Bacteria 1141
41 Ga0070679_100191647 3300005530 Bacteria 2013
42 Ga0070697_100002764 3300005536 Bacteria 13506
43 Ga0070697_100003056 3300005536 Bacteria 12833
44 Ga0070697_100003665 3300005536 Bacteria 11811
45 Ga0070697_100014248 3300005536 Bacteria 6248
46 Ga0070686_100080499 3300005544 Bacteria 2155
47 Ga0070695_100005419 3300005545 Bacteria 7511
48 Ga0070695_100044514 3300005545 Bacteria 2826
49 Ga0070696_100001148 3300005546 Bacteria 17171
50 Ga0070696_100132613 3300005546 Bacteria 1814
51 Ga0070693_100000160 3300005547 Bacteria 30875
52 Ga0070665_100002111 3300005548 Bacteria 22209
53 Ga0070665_100084473 3300005548 Unclassified 3180
54 Ga0068855_100424473 3300005563 Bacteria 1454
55 Ga0068856_100015643 3300005614 Bacteria 7334
56 Ga0068856_100122716 3300005614 Bacteria 2600
57 Ga0068859_100113755 3300005617 Unclassified 2770
58 Ga0068866_10191474 3300005718 Bacteria 1215
59 Ga0068863_100003491 3300005841 Bacteria 15513
60 Ga0068863_100111746 3300005841 Bacteria 2602
61 Ga0068858_100259693 3300005842 Bacteria 1651
62 Ga0068860_100018355 3300005843 Bacteria 6806
63 Ga0068860_100899871 3300005843 Unclassified 901
64 Ga0081540_1026855 3300005983 Unclassified 3276
65 Ga0070717_10001528 3300006028 Bacteria 16038
66 Ga0070717_10008205 3300006028 Bacteria 7800
67 Ga0070717_10018047 3300006028 Bacteria 5504
68 Ga0070717_10031863 3300006028 Bacteria 4244
69 Ga0070717_10068585 3300006028 Unclassified 2952
70 Ga0070717_10070310 3300006028 Bacteria 2917
71 Ga0070717_10176234 3300006028 Unclassified 1862
72 Ga0070717_10348786 3300006028 Bacteria 1323
73 Ga0070715_10083631 3300006163 Bacteria 1454
74 Ga0070716_100002601 3300006173 Bacteria 8335
75 Ga0070716_100009053 3300006173 Bacteria 4955
76 Ga0070716_100028449 3300006173 Plasmid 3011
77 Ga0070716_100089695 3300006173 Bacteria 1858
78 Ga0070716_100199141 3300006173 Bacteria 1330
79 Ga0070712_100039085 3300006175 Bacteria 3246
80 Ga0070712_100061226 3300006175 Bacteria 2658
81 Ga0070712_100250922 3300006175 Bacteria 1414
82 Ga0097621_100030767 3300006237 Bacteria 4253
83 Ga0068871_100023266 3300006358 Bacteria 4790
84 Ga0075436_100001774 3300006914 Bacteria 14789
85 Ga0075436_100005244 3300006914 Bacteria 8921
86 Ga0075436_100020086 3300006914 Bacteria 4584
87 Ga0097620_100113753 3300006931 Unclassified 2770
88 Ga0075435_100068780 3300007076 Bacteria 2885
89 Ga0099794_10006064 3300007265 Bacteria 4883
90 Ga0099794_10009908 3300007265 Bacteria 4029
91 Ga0099794_10019879 3300007265 Bacteria 3034
92 Ga0099794_10031356 3300007265 Bacteria 2488
93 Ga0099794_10040054 3300007265 Unclassified 2226
94 Ga0099794_10060775 3300007265 Bacteria 1835
95 Ga0099794_10062791 3300007265 Bacteria 1807
96 Ga0099794_10077655 3300007265 Bacteria 1634
97 Ga0099794_10083775 3300007265 Bacteria 1576
98 Ga0099794_10117107 3300007265 Bacteria 1338
99 Ga0099795_10110508 3300007788 Unclassified 1089
100 Ga0099795_10147859 3300007788 Bacteria 960
101 Ga0105240_10039980 3300009093 Bacteria 6004
102 Ga0105240_10775088 3300009093 Bacteria 1041
103 Ga0105245_10028586 3300009098 Bacteria 4919
104 Ga0105242_10054142 3300009176 Bacteria 3279
105 Ga0105248_10041940 3300009177 Bacteria 5131
106 Ga0105238_10144093 3300009551 Bacteria 2359
107 Ga0099796_10001106 3300010159 Bacteria 5175
108 Ga0099796_10047254 3300010159 Bacteria 1481
109 Ga0105239_10219389 3300010375 Bacteria 2133
110 Ga0157374_10500077 3300013296 Bacteria 1220
111 Ga0157378_10000053 3300013297 Bacteria 99982
112 Ga0157372_10112477 3300013307 Bacteria 3120
113 Ga0157372_10797934 3300013307 Bacteria 1097
114 Ga0157375_10228486 3300013308 Bacteria 2019
115 Ga0157375_10557107 3300013308 Unclassified 1308
116 Ga0163163_10207481 3300014325 Bacteria 2008
117 Ga0157379_10034577 3300014968 Bacteria 4506
118 Ga0157376_10010164 3300014969 Bacteria 6871
119 Ga0213873_10036091 3300021358 Bacteria 1253
120 Ga0213872_10000517 3300021361 Bacteria 30415
121 Ga0213872_10000948 3300021361 Bacteria 20307
122 Ga0213876_10010317 3300021384 Bacteria 5016
123 Ga0213876_10068600 3300021384 Bacteria 1873
124 Ga0213875_10000038 3300021388 Bacteria 164463
125 Ga0213875_10001968 3300021388 Bacteria 12710
126 Ga0213875_10005660 3300021388 Bacteria 6669
127 Ga0213871_10005212 3300021441 Viruses 2664
128 Ga0228598_1004131 3300024227 Bacteria 3085
129 Ga0207653_10009520 3300025885 Bacteria 3028
130 Ga0207692_10056770 3300025898 Unclassified 2010
131 Ga0207692_10153348 3300025898 Bacteria 1321
132 Ga0207642_10135806 3300025899 Bacteria 1290
133 Ga0207699_10001312 3300025906 Bacteria 11824
134 Ga0207699_10012333 3300025906 Bacteria 4346
135 Ga0207684_10000229 3300025910 Bacteria 85591
136 Ga0207684_10002403 3300025910 Bacteria 18935
137 Ga0207684_10021575 3300025910 Bacteria 5499
138 Ga0207707_10295402 3300025912 Bacteria 1401
139 Ga0207695_10027773 3300025913 Bacteria 6295
140 Ga0207693_10041644 3300025915 Bacteria 3616
141 Ga0207693_10042078 3300025915 Bacteria 3597
142 Ga0207693_10068786 3300025915 Bacteria 2772
143 Ga0207693_10134370 3300025915 Bacteria 1945
144 Ga0207663_10010234 3300025916 Bacteria 4983
145 Ga0207663_10033536 3300025916 Bacteria 3060
146 Ga0207663_10065240 3300025916 Bacteria 2327
147 Ga0207660_10205204 3300025917 Bacteria 1541
148 Ga0207646_10001325 3300025922 Bacteria 30725
149 Ga0207646_10031459 3300025922 Bacteria 4804
150 Ga0207646_10162104 3300025922 Bacteria 2018
151 Ga0207650_10107032 3300025925 Bacteria 2160
152 Ga0207687_10221765 3300025927 Bacteria 1489
153 Ga0207700_10028911 3300025928 Bacteria 3906
154 Ga0207700_10033666 3300025928 Bacteria 3669
155 Ga0207700_10035529 3300025928 Bacteria 3590
156 Ga0207700_10038305 3300025928 Bacteria 3479
157 Ga0207700_10095745 3300025928 Bacteria 2355
158 Ga0207665_10000014 3300025939 Bacteria 137803
159 Ga0207665_10013562 3300025939 Bacteria 5360
160 Ga0207665_10016248 3300025939 Unclassified 4887
161 Ga0207665_10022394 3300025939 Bacteria 4157
162 Ga0207665_10118785 3300025939 Bacteria 1866
163 Ga0207665_10124684 3300025939 Bacteria 1822
164 Ga0207665_10367575 3300025939 Bacteria 1089
165 Ga0207665_10396833 3300025939 Bacteria 1050
166 Ga0207661_10074851 3300025944 Bacteria 2777
167 Ga0207677_10047310 3300026023 Bacteria 2887
168 Ga0207703_10147682 3300026035 Bacteria 2047
169 Ga0207702_10004380 3300026078 Bacteria 12583
170 Ga0207702_10413992 3300026078 Bacteria 1302
171 Ga0207641_10089678 3300026088 Bacteria 2688
172 Ga0207683_10603246 3300026121 Bacteria 1016
173 Ga0209179_1003658 3300027512 Bacteria 2240
174 Ga0209588_1013901 3300027671 Bacteria 2459
175 Ga0209588_1024166 3300027671 Bacteria 1918
176 Ga0265354_1000674 3300028016 Bacteria 5660
177 Ga0265356_1003568 3300028017 Bacteria 1956
178 Ga0268266_10000777 3300028379 Bacteria 42678
179 Ga0268266_10060476 3300028379 Unclassified 3266
180 Ga0268264_10212054 3300028381 Bacteria 1778
181 Ga0265338_10009829 3300028800 Bacteria 11339
182 Ga0265338_10110319 3300028800 Bacteria 2218
183 Ga0265762_1000630 3300030760 Bacteria 6198
184 Ga0265770_1014688 3300030878 Bacteria 1184
185 Ga0265765_1000800 3300030879 Bacteria 2686
186 Ga0265760_10002857 3300031090 Bacteria 5041
187 Ga0265760_10056744 3300031090 Bacteria 1185
188 Ga0316212_1001412 3300033547 Bacteria 3266
189 Ga0316212_1002351 3300033547 Bacteria 2691
190 Ga0373926_0002458 3300035083 Bacteria 5879
191 Ga0373926_0003234 3300035083 Bacteria 5232
192 Ga0373934_0002115 3300035086 Bacteria 7285
193 Ga0373934_0010698 3300035086 Bacteria 3445
194 Ga0373923_0044378 3300035111 Bacteria 1843
195 Ga0373923_0112917 3300035111 Bacteria 1208
196 Ga0373923_0156545 3300035111 Unclassified 1037
197 Ga0373953_0123299 3300035117 Bacteria 1101
198 Ga0373954_0001222 3300035118 Bacteria 10336
199 Ga0373954_0057280 3300035118 Unclassified 1835
200 Ga0373954_0155379 3300035118 Bacteria 1118
201 Ga0373954_0179501 3300035118 Bacteria 1038
202 Ga0373956_0013192 3300035119 Bacteria 3437
203 Ga0373956_0037403 3300035119 Bacteria 2145
204 Ga0373956_0095608 3300035119 Unclassified 1374
205 Ga0373957_0008820 3300035120 Bacteria 3283
206 Ga0373943_0109895 3300035170 Unclassified 1453
207 Ga0373946_0051556 3300035171 Bacteria 1722
208 Ga0373955_0021181 3300035172 Unclassified 3278
209 Ga0373955_0025205 3300035172 Bacteria 3051
210 Ga0373955_0106611 3300035172 Unclassified 1616
211 Ga0373955_0152880 3300035172 Bacteria 1359
212 Ga0373931_0017226 3300035691 Unclassified 3570
213 Ga0373931_0234717 3300035691 Bacteria 1109
214 Ga0373927_0000497 3300035695 Bacteria 29917
215 Ga0373927_0000932 3300035695 Bacteria 22214
216 Ga0373927_0044498 3300035695 Bacteria 2872
217 Ga0373927_0087133 3300035695 Unclassified 2027
218 Ga0373927_0181221 3300035695 Bacteria 1382
219 Ga0373933_0000092 3300035724 Bacteria 56195
220 Ga0373933_0003170 3300035724 Bacteria 9186
221 Ga0373947_0012443 3300035725 Bacteria 4876
222 Ga0373947_0026236 3300035725 Bacteria 3404
223 Ga0373937_0001023 3300036401 Bacteria 23642
224 Ga0373937_0012195 3300036401 Bacteria 7547
225 Ga0373937_0017107 3300036401 Bacteria 6449
226 Ga0373937_0024863 3300036401 Bacteria 5406
227 Ga0373937_0720319 3300036401 Bacteria 945
228 Ga0373925_0031793 3300037068 Bacteria 3882
229 Ga0373925_0038144 3300037068 Bacteria 3550
230 Ga0373925_0308254 3300037068 Bacteria 1279
231 Ga0436364_0553108 3300037853 Bacteria 29221
232 Ga0436364_0895803 3300037853 Bacteria 3988
233 Ga0436364_1006074 3300037853 Bacteria 129171
234 Ga0436364_1074508 3300037853 Bacteria 1398
235 Ga0436365_0463804 3300039437 Bacteria 3257
236 Ga0436365_0887715 3300039437 Unclassified 3691
237 Ga0436365_1033638 3300039437 Bacteria 1087
238 Ga0436360_1205360 3300039438 Bacteria 23779
239 Ga0436361_0061548 3300039447 Bacteria 27019
240 Ga0436361_0079738 3300039447 Bacteria 122121
241 Ga0436361_0384583 3300039447 Unclassified 900
242 Ga0436361_0528123 3300039447 Bacteria 19689
243 Ga0436363_0104883 3300039450 Bacteria 2707
244 Ga0466967_0140257 3300045976 Bacteria 2251
245 Ga0466967_0572413 3300045976 Bacteria 1113
246 Ga0495592_0093431 3300046454 Unclassified 2154
247 Ga0495592_0212226 3300046454 Unclassified 1299
248 Ga0495641_0028570 3300046461 Bacteria 2698
249 Ga0495651_0002419 3300046462 Bacteria 14419
250 Ga0495651_0003642 3300046462 Bacteria 11799
251 Ga0495651_0045024 3300046462 Bacteria 3419
252 Ga0495653_0004145 3300046463 Bacteria 11728
253 Ga0495580_0001322 3300046472 Bacteria 21865
254 Ga0495580_0004068 3300046472 Bacteria 12342
255 Ga0495580_0005812 3300046472 Bacteria 10127
256 Ga0495580_0050290 3300046472 Bacteria 2947
257 Ga0495580_0074159 3300046472 Bacteria 2375
258 Ga0495580_0089402 3300046472 Bacteria 2144
259 Ga0495582_0000161 3300046473 Bacteria 36312
260 Ga0495608_0006137 3300046511 Bacteria 8529
261 Ga0495608_0030109 3300046511 Bacteria 3678
262 Ga0495608_0061418 3300046511 Unclassified 2471
263 Ga0495608_0249663 3300046511 Bacteria 1106
264 Ga0495618_0339099 3300046514 Bacteria 928
265 Ga0495628_0058710 3300046516 Bacteria 3022
266 Ga0495628_0063695 3300046516 Bacteria 2888
267 Ga0495628_0139669 3300046516 Unclassified 1849
268 Ga0495630_0018811 3300046517 Bacteria 5077
269 Ga0495666_0007686 3300046526 Bacteria 5392
270 Ga0495666_0052996 3300046526 Bacteria 1948
271 Ga0495652_0006917 3300046529 Bacteria 10498
272 Ga0495665_0027488 3300046531 Bacteria 3053
273 Ga0495587_0000583 3300046536 Bacteria 25138
274 Ga0495587_0008539 3300046536 Bacteria 6580
275 Ga0495645_0218981 3300046543 Unclassified 1281
276 Ga0495667_0002361 3300046559 Bacteria 12621
277 Ga0495635_0160004 3300046663 Unclassified 1532
278 Ga0495657_0012219 3300046675 Bacteria 6384
279 Ga0495657_0033656 3300046675 Eukaryota 3566
280 Ga0495657_0180909 3300046675 Bacteria 1294
281 Ga0495599_0122287 3300046678 Bacteria 1618
282 Ga0495599_0221916 3300046678 Bacteria 1156
283 Ga0495599_0266314 3300046678 Unclassified 1040
284 Ga0495623_0009191 3300046679 Bacteria 6411
285 Ga0495623_0029224 3300046679 Bacteria 3547
286 Ga0495623_0061157 3300046679 Eukaryota 2362
287 Ga0495646_0010133 3300046680 Bacteria 5992
288 Ga0495646_0028328 3300046680 Eukaryota 3509
289 Ga0495658_0044874 3300046683 Bacteria 2478
290 Ga0495613_0106681 3300046689 Bacteria 2021
291 Ga0495624_0021486 3300046690 Bacteria 4278
292 Ga0495624_0064983 3300046690 Bacteria 2280
293 Ga0495600_0267762 3300046809 Unclassified 1084
294 Ga0495604_0004549 3300047317 Bacteria 10983
295 Ga0495604_0009253 3300047317 Bacteria 7799
296 Ga0495604_0013876 3300047317 Bacteria 6426
297 Ga0495604_0128713 3300047317 Unclassified 1822
298 Ga0495674_0039124 3300047319 Bacteria 4252
299 Ga0495674_0151798 3300047319 Bacteria 1942
300 Ga0495680_0000547 3300047322 Bacteria 42327
301 Ga0495680_0433530 3300047322 Unclassified 902
302 Ga0495675_0002703 3300047444 Bacteria 10627
303 Ga0495675_0093358 3300047444 Bacteria 1888
304 Ga0495675_0175434 3300047444 Unclassified 1315
305 Ga0495684_0002305 3300047471 Bacteria 15280
306 Ga0495602_0002422 3300048088 Bacteria 18984
307 Ga0495602_0004695 3300048088 Bacteria 14280
308 Ga0495602_0030882 3300048088 Eukaryota 5074
309 Ga0495602_0214359 3300048088 Unclassified 1458
310 Ga0495614_0013464 3300048089 Bacteria 3587
311 Ga0496101_0218586 3300048904 Bacteria 1478
312 Ga0496101_0588656 3300048904 Bacteria 880
313 Ga0496103_0202983 3300048906 Bacteria 1275
314 Ga0496104_0167317 3300048907 Bacteria 2108
315 Ga0496105_0073623 3300048908 Bacteria 2822
316 Ga0496106_0336839 3300048909 Bacteria 1211
317 Ga0496107_0334350 3300048910 Bacteria 1127
318 Ga0496114_0008658 3300048917 Bacteria 8066
319 Ga0496115_0114534 3300048918 Bacteria 2216
320 Ga0501034_0692644 3300049571 Unclassified 918
321 Ga0501037_0428184 3300049573 Unclassified 905
322 Ga0501080_0737576 3300049742 Unclassified 867
323 Ga0501044_0002307 3300049823 Bacteria 21740
324 Ga0501044_0052419 3300049823 Unclassified 4204
325 nmdc:mga0n895_312421_c1 3300050512 Bacteria 1593
326 nmdc:mga0n895_53785_c1 3300050512 Bacteria 3957
327 nmdc:mga0rr50_12881_c1 3300050513 Bacteria 5422
328 nmdc:mga0rr50_185098_c1 3300050513 Bacteria 1704
329 nmdc:mga0rr50_23158_c1 3300050513 Bacteria 4276
330 nmdc:mga0rr50_402203_c1 3300050513 Bacteria 1157
331 nmdc:mga0rr50_548514_c1 3300050513 Bacteria 984
332 nmdc:mga0rr50_98725_c1 3300050513 Bacteria 2289
333 nmdc:mga08x19_22130_c1 3300050514 Bacteria 3933
334 nmdc:mga08x19_3168_c1 3300050514 Bacteria 9871
335 nmdc:mga08x19_6851_c1 3300050514 Bacteria 6769
336 nmdc:mga08x19_888_c1 3300050514 Bacteria 19057
337 Ga0495612_0001762 3300053078 Bacteria 8873
338 Ga0495595_0270486 3300053084 Bacteria 852
339 Ga0495619_0047102 3300053085 Bacteria 2838
340 Ga0070698_100002271
341 LJNas_1000026
342 Ga0065707_10272272
343 Ga0070680_100186737
344 Ga0070709_10013128
345 Ga0070709_10041927
346 Ga0070714_100065387
347 Ga0070714_100870616
348 Ga0070713_100008024
349 Ga0070713_100009701
350 Ga0070713_100015746
351 Ga0070713_100018825
352 Ga0070713_100021388
353 Ga0070710_10041468
354 Ga0070711_100010084
355 Ga0070711_100037288
356 Ga0070711_100039201
357 Ga0070711_100309762
358 Ga0070705_100001919
359 Ga0070694_100036841
360 Ga0070708_100002491
361 Ga0070708_100035891
362 Ga0070708_100056961
363 Ga0070708_100141022
364 Ga0070708_100618793
365 Ga0070706_100000665
366 Ga0070706_100006770
367 Ga0070706_100027996
368 Ga0070706_100312427
369 Ga0070707_100048527
370 Ga0070707_100104853
371 Ga0070707_100113974
372 Ga0070698_100001063
373 Ga0070698_100028715
374 Ga0070698_100094696
375 Ga0070699_100002090
376 Ga0070699_100011081
377 Ga0070699_100083585
378 Ga0070699_100305019
379 Ga0070699_100469665
380 Ga0070679_100191647
381 Ga0070697_100002764
382 Ga0070697_100003056
383 Ga0070697_100003665
384 Ga0070697_100014248
385 Ga0070686_100080499
386 Ga0070695_100005419
387 Ga0070695_100044514
388 Ga0070696_100001148
389 Ga0070696_100132613
390 Ga0070693_100000160
391 Ga0070665_100002111
392 Ga0070665_100084473
393 Ga0068855_100424473
394 Ga0068856_100015643
395 Ga0068856_100122716
396 Ga0068859_100113755
397 Ga0068866_10191474
398 Ga0068863_100003491
399 Ga0068863_100111746
400 Ga0068858_100259693
401 Ga0068860_100018355
402 Ga0068860_100899871
403 Ga0081540_1026855
404 Ga0070717_10001528
405 Ga0070717_10008205
406 Ga0070717_10018047
407 Ga0070717_10031863
408 Ga0070717_10068585
409 Ga0070717_10070310
410 Ga0070717_10176234
411 Ga0070717_10348786
412 Ga0070715_10083631
413 Ga0070716_100002601
414 Ga0070716_100009053
415 Ga0070716_100028449
416 Ga0070716_100089695
417 Ga0070716_100199141
418 Ga0070712_100039085
419 Ga0070712_100061226
420 Ga0070712_100250922
421 Ga0097621_100030767
422 Ga0068871_100023266
423 Ga0075436_100001774
424 Ga0075436_100005244
425 Ga0075436_100020086
426 Ga0097620_100113753
427 Ga0075435_100068780
428 Ga0099794_10006064
429 Ga0099794_10009908
430 Ga0099794_10019879
431 Ga0099794_10031356
432 Ga0099794_10040054
433 Ga0099794_10060775
434 Ga0099794_10062791
435 Ga0099794_10077655
436 Ga0099794_10083775
437 Ga0099794_10117107
438 Ga0099795_10110508
439 Ga0099795_10147859
440 Ga0105240_10039980
441 Ga0105240_10775088
442 Ga0105245_10028586
443 Ga0105242_10054142
444 Ga0105248_10041940
445 Ga0105238_10144093
446 Ga0099796_10001106
447 Ga0099796_10047254
448 Ga0105239_10219389
449 Ga0157374_10500077
450 Ga0157378_10000053
451 Ga0157372_10112477
452 Ga0157372_10797934
453 Ga0157375_10228486
454 Ga0157375_10557107
455 Ga0163163_10207481
456 Ga0157379_10034577
457 Ga0157376_10010164
458 Ga0213873_10036091
459 Ga0213872_10000517
460 Ga0213872_10000948
461 Ga0213876_10010317
462 Ga0213876_10068600
463 Ga0213875_10000038
464 Ga0213875_10001968
465 Ga0213875_10005660
466 Ga0213871_10005212
467 Ga0228598_1004131
468 Ga0207653_10009520
469 Ga0207692_10056770
470 Ga0207692_10153348
471 Ga0207642_10135806
472 Ga0207699_10001312
473 Ga0207699_10012333
474 Ga0207684_10000229
475 Ga0207684_10002403
476 Ga0207684_10021575
477 Ga0207707_10295402
478 Ga0207695_10027773
479 Ga0207693_10041644
480 Ga0207693_10042078
481 Ga0207693_10068786
482 Ga0207693_10134370
483 Ga0207663_10010234
484 Ga0207663_10033536
485 Ga0207663_10065240
486 Ga0207660_10205204
487 Ga0207646_10001325
488 Ga0207646_10031459
489 Ga0207646_10162104
490 Ga0207650_10107032
491 Ga0207687_10221765
492 Ga0207700_10028911
493 Ga0207700_10033666
494 Ga0207700_10035529
495 Ga0207700_10038305
496 Ga0207700_10095745
497 Ga0207665_10000014
498 Ga0207665_10013562
499 Ga0207665_10016248
500 Ga0207665_10022394
501 Ga0207665_10118785
502 Ga0207665_10124684
503 Ga0207665_10367575
504 Ga0207665_10396833
505 Ga0207661_10074851
506 Ga0207677_10047310
507 Ga0207703_10147682
508 Ga0207702_10004380
509 Ga0207702_10413992
510 Ga0207641_10089678
511 Ga0207683_10603246
512 Ga0209179_1003658
513 Ga0209588_1013901
514 Ga0209588_1024166
515 Ga0265354_1000674
516 Ga0265356_1003568
517 Ga0268266_10000777
518 Ga0268266_10060476
519 Ga0268264_10212054
520 Ga0265338_10009829
521 Ga0265338_10110319
522 Ga0265762_1000630
523 Ga0265770_1014688
524 Ga0265765_1000800
525 Ga0265760_10002857
526 Ga0265760_10056744
527 Ga0316212_1001412
528 Ga0316212_1002351
529 Ga0373926_0002458
530 Ga0373926_0003234
531 Ga0373934_0002115
532 Ga0373934_0010698
533 Ga0373923_0044378
534 Ga0373923_0112917
535 Ga0373923_0156545
536 Ga0373953_0123299
537 Ga0373954_0001222
538 Ga0373954_0057280
539 Ga0373954_0155379
540 Ga0373954_0179501
541 Ga0373956_0013192
542 Ga0373956_0037403
543 Ga0373956_0095608
544 Ga0373957_0008820
545 Ga0373943_0109895
546 Ga0373946_0051556
547 Ga0373955_0021181
548 Ga0373955_0025205
549 Ga0373955_0106611
550 Ga0373955_0152880
551 Ga0373931_0017226
552 Ga0373931_0234717
553 Ga0373927_0000497
554 Ga0373927_0000932
555 Ga0373927_0044498
556 Ga0373927_0087133
557 Ga0373927_0181221
558 Ga0373933_0000092
559 Ga0373933_0003170
560 Ga0373947_0012443
561 Ga0373947_0026236
562 Ga0373937_0001023
563 Ga0373937_0012195
564 Ga0373937_0017107
565 Ga0373937_0024863
566 Ga0373937_0720319
567 Ga0373925_0031793
568 Ga0373925_0038144
569 Ga0373925_0308254
570 Ga0436364_0553108
571 Ga0436364_0895803
572 Ga0436364_1006074
573 Ga0436364_1074508
574 Ga0436365_0463804
575 Ga0436365_0887715
576 Ga0436365_1033638
577 Ga0436360_1205360
578 Ga0436361_0061548
579 Ga0436361_0079738
580 Ga0436361_0384583
581 Ga0436361_0528123
582 Ga0436363_0104883
583 Ga0466967_0140257
584 Ga0466967_0572413
585 Ga0495592_0093431
586 Ga0495592_0212226
587 Ga0495641_0028570
588 Ga0495651_0002419
589 Ga0495651_0003642
590 Ga0495651_0045024
591 Ga0495653_0004145
592 Ga0495580_0001322
593 Ga0495580_0004068
594 Ga0495580_0005812
595 Ga0495580_0050290
596 Ga0495580_0074159
597 Ga0495580_0089402
598 Ga0495582_0000161
599 Ga0495608_0006137
600 Ga0495608_0030109
601 Ga0495608_0061418
602 Ga0495608_0249663
603 Ga0495618_0339099
604 Ga0495628_0058710
605 Ga0495628_0063695
606 Ga0495628_0139669
607 Ga0495630_0018811
608 Ga0495666_0007686
609 Ga0495666_0052996
610 Ga0495652_0006917
611 Ga0495665_0027488
612 Ga0495587_0000583
613 Ga0495587_0008539
614 Ga0495645_0218981
615 Ga0495667_0002361
616 Ga0495635_0160004
617 Ga0495657_0012219
618 Ga0495657_0033656
619 Ga0495657_0180909
620 Ga0495599_0122287
621 Ga0495599_0221916
622 Ga0495599_0266314
623 Ga0495623_0009191
624 Ga0495623_0029224
625 Ga0495623_0061157
626 Ga0495646_0010133
627 Ga0495646_0028328
628 Ga0495658_0044874
629 Ga0495613_0106681
630 Ga0495624_0021486
631 Ga0495624_0064983
632 Ga0495600_0267762
633 Ga0495604_0004549
634 Ga0495604_0009253
635 Ga0495604_0013876
636 Ga0495604_0128713
637 Ga0495674_0039124
638 Ga0495674_0151798
639 Ga0495680_0000547
640 Ga0495680_0433530
641 Ga0495675_0002703
642 Ga0495675_0093358
643 Ga0495675_0175434
644 Ga0495684_0002305
645 Ga0495602_0002422
646 Ga0495602_0004695
647 Ga0495602_0030882
648 Ga0495602_0214359
649 Ga0495614_0013464
650 Ga0496101_0218586
651 Ga0496101_0588656
652 Ga0496103_0202983
653 Ga0496104_0167317
654 Ga0496105_0073623
655 Ga0496106_0336839
656 Ga0496107_0334350
657 Ga0496114_0008658
658 Ga0496115_0114534
659 Ga0501034_0692644
660 Ga0501037_0428184
661 Ga0501080_0737576
662 Ga0501044_0002307
663 Ga0501044_0052419
664 nmdc:mga0n895_312421_c1
665 nmdc:mga0n895_53785_c1
666 nmdc:mga0rr50_12881_c1
667 nmdc:mga0rr50_185098_c1
668 nmdc:mga0rr50_23158_c1
669 nmdc:mga0rr50_402203_c1
670 nmdc:mga0rr50_548514_c1
671 nmdc:mga0rr50_98725_c1
672 nmdc:mga08x19_22130_c1
673 nmdc:mga08x19_3168_c1
674 nmdc:mga08x19_6851_c1
675 nmdc:mga08x19_888_c1
676 Ga0495612_0001762
677 Ga0495595_0270486
678 Ga0495619_0047102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

20

229

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9724 18 248
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9675 18 248
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9405 17 251
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9361 17 251
5vrd-assembly1.cif.gz_D crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9334 16 251
ID Description Score Start End Superfamily
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8823 23 236 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8784 18 255 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8714 23 236 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.843 18 255 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8071 18 239 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A3D1AUX6-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein C 0.9945 34 252 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A2V9TBV9-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein PqqC 0.9925 76 256 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A2V9Z9L9-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9917 17 256 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A2V9BXK1-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9906 13 256 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A7L5A6P0-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9884 15 256 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615

Map