F413710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 153 | 338 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0613684|Ga0501048_0613684_86_703 |
| Length | 205 |
| Sequence | MTIRRSYRSPGPLVVHSRRPHGFTADEISRTLRETPVKSIRAWLGLDRPEAPEPAPLRDVLGALDHLEPVRARYLAAFAYLLGRVAHADQHVSPEETRAMEAALVEHGELTEEQAMLVTQLAKTNNLLFGGTANFLVAREFAETATYEQKLALLRCIFAVSASDEAISLSEESEIHRLARELRIDPPDLLALRVEHQRHLPGRNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 96 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 97 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 98 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 103 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 106 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 107 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 108 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 109 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 110 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 111 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 112 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 116 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 117 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 131 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 132 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 133 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 134 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 138 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 141 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 142 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 151 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 152 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.59 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10115089 | 3300005293 | Unclassified | 2427 |
| 2 | Ga0065707_10236718 | 3300005295 | Unclassified | 1170 |
| 3 | Ga0065707_10394504 | 3300005295 | Bacteria | 860 |
| 4 | Ga0065707_10878050 | 3300005295 | Unclassified | 573 |
| 5 | Ga0070670_100036223 | 3300005331 | Bacteria | 4247 |
| 6 | Ga0068869_101062449 | 3300005334 | Bacteria | 707 |
| 7 | Ga0070680_100522991 | 3300005336 | Bacteria | 1016 |
| 8 | Ga0070680_100527872 | 3300005336 | Bacteria | 1011 |
| 9 | Ga0070680_100634381 | 3300005336 | Unclassified | 918 |
| 10 | Ga0070660_100954734 | 3300005339 | Bacteria | 724 |
| 11 | Ga0070689_100166529 | 3300005340 | Bacteria | 1784 |
| 12 | Ga0070668_100105418 | 3300005347 | Bacteria | 2239 |
| 13 | Ga0070668_100129130 | 3300005347 | Unclassified | 2027 |
| 14 | Ga0070669_100016667 | 3300005353 | Bacteria | 5244 |
| 15 | Ga0070669_100021630 | 3300005353 | Bacteria | 4597 |
| 16 | Ga0070669_101148869 | 3300005353 | Unclassified | 670 |
| 17 | Ga0070675_100000624 | 3300005354 | Bacteria | 24512 |
| 18 | Ga0070675_100037255 | 3300005354 | Bacteria | 3961 |
| 19 | Ga0070675_100115211 | 3300005354 | Bacteria | 2278 |
| 20 | Ga0070675_100426159 | 3300005354 | Bacteria | 1187 |
| 21 | Ga0070674_100033673 | 3300005356 | Bacteria | 3413 |
| 22 | Ga0070674_100344237 | 3300005356 | Bacteria | 1202 |
| 23 | Ga0070673_100237846 | 3300005364 | Archaea | 1582 |
| 24 | Ga0070673_100772156 | 3300005364 | Unclassified | 886 |
| 25 | Ga0070688_100044284 | 3300005365 | Bacteria | 2746 |
| 26 | Ga0070688_100221308 | 3300005365 | Unclassified | 1334 |
| 27 | Ga0070688_101040981 | 3300005365 | Archaea | 652 |
| 28 | Ga0070703_10010124 | 3300005406 | Unclassified | 2659 |
| 29 | Ga0070701_10008116 | 3300005438 | Unclassified | 4522 |
| 30 | Ga0070705_100035975 | 3300005440 | Bacteria | 2780 |
| 31 | Ga0070700_100036688 | 3300005441 | Bacteria | 2975 |
| 32 | Ga0070700_100163976 | 3300005441 | Bacteria | 1533 |
| 33 | Ga0070694_100013544 | 3300005444 | Bacteria | 5095 |
| 34 | Ga0070694_100075184 | 3300005444 | Bacteria | 2336 |
| 35 | Ga0070708_100328802 | 3300005445 | Unclassified | 1440 |
| 36 | Ga0070678_100316957 | 3300005456 | Bacteria | 1330 |
| 37 | Ga0070678_100989972 | 3300005456 | Unclassified | 772 |
| 38 | Ga0070662_100057781 | 3300005457 | Unclassified | 2820 |
| 39 | Ga0070662_100089241 | 3300005457 | Bacteria | 2312 |
| 40 | Ga0070662_100332301 | 3300005457 | Unclassified | 1242 |
| 41 | Ga0068867_100001807 | 3300005459 | Bacteria | 14891 |
| 42 | Ga0068867_100052454 | 3300005459 | Unclassified | 3010 |
| 43 | Ga0070685_10192062 | 3300005466 | Bacteria | 1322 |
| 44 | Ga0070685_10269968 | 3300005466 | Unclassified | 1135 |
| 45 | Ga0070685_10603816 | 3300005466 | Bacteria | 790 |
| 46 | Ga0070707_100215740 | 3300005468 | Bacteria | 1870 |
| 47 | Ga0070698_100020190 | 3300005471 | Bacteria | 6986 |
| 48 | Ga0070698_100680904 | 3300005471 | Unclassified | 970 |
| 49 | Ga0070672_100032496 | 3300005543 | Bacteria | 3938 |
| 50 | Ga0070672_100068873 | 3300005543 | Bacteria | 2808 |
| 51 | Ga0070686_100160142 | 3300005544 | Bacteria | 1584 |
| 52 | Ga0070695_100039370 | 3300005545 | Bacteria | 2988 |
| 53 | Ga0070704_100126052 | 3300005549 | Bacteria | 1976 |
| 54 | Ga0070704_100432930 | 3300005549 | Unclassified | 1129 |
| 55 | Ga0070664_100315374 | 3300005564 | Bacteria | 1416 |
| 56 | Ga0068857_100051519 | 3300005577 | Unclassified | 3653 |
| 57 | Ga0068857_100153027 | 3300005577 | Unclassified | 2091 |
| 58 | Ga0068859_100048538 | 3300005617 | Bacteria | 4264 |
| 59 | Ga0068859_100225248 | 3300005617 | Unclassified | 1963 |
| 60 | Ga0068859_100397755 | 3300005617 | Bacteria | 1473 |
| 61 | Ga0068859_101213206 | 3300005617 | Bacteria | 831 |
| 62 | Ga0068859_101762183 | 3300005617 | Archaea | 684 |
| 63 | Ga0068866_10319595 | 3300005718 | Bacteria | 976 |
| 64 | Ga0068861_100186676 | 3300005719 | Unclassified | 1730 |
| 65 | Ga0068861_100264202 | 3300005719 | Bacteria | 1475 |
| 66 | Ga0068861_100403312 | 3300005719 | Archaea | 1214 |
| 67 | Ga0068870_10000592 | 3300005840 | Bacteria | 13792 |
| 68 | Ga0068870_10044109 | 3300005840 | Bacteria | 2329 |
| 69 | Ga0068863_100736999 | 3300005841 | Bacteria | 981 |
| 70 | Ga0068862_100002885 | 3300005844 | Bacteria | 15044 |
| 71 | Ga0068862_100005392 | 3300005844 | Bacteria | 10699 |
| 72 | Ga0075432_10042962 | 3300006058 | Bacteria | 1583 |
| 73 | Ga0068871_100249551 | 3300006358 | Unclassified | 1545 |
| 74 | Ga0068871_100347523 | 3300006358 | Unclassified | 1311 |
| 75 | Ga0068871_100481525 | 3300006358 | Unclassified | 1116 |
| 76 | Ga0075428_100001326 | 3300006844 | Bacteria | 26221 |
| 77 | Ga0075428_100109691 | 3300006844 | Bacteria | 3006 |
| 78 | Ga0075428_100168868 | 3300006844 | Bacteria | 2372 |
| 79 | Ga0075428_100250508 | 3300006844 | Bacteria | 1909 |
| 80 | Ga0075428_100356216 | 3300006844 | Bacteria | 1570 |
| 81 | Ga0075428_100671468 | 3300006844 | Bacteria | 1104 |
| 82 | Ga0075428_101464908 | 3300006844 | Unclassified | 716 |
| 83 | Ga0075430_100001560 | 3300006846 | Bacteria | 18746 |
| 84 | Ga0075430_100036822 | 3300006846 | Bacteria | 4147 |
| 85 | Ga0075430_100072323 | 3300006846 | Unclassified | 2892 |
| 86 | Ga0075430_100140824 | 3300006846 | Bacteria | 2009 |
| 87 | Ga0075430_100203465 | 3300006846 | Bacteria | 1644 |
| 88 | Ga0075431_100003659 | 3300006847 | Bacteria | 14913 |
| 89 | Ga0075431_100024673 | 3300006847 | Bacteria | 6165 |
| 90 | Ga0075431_100097282 | 3300006847 | Bacteria | 3039 |
| 91 | Ga0075431_100201612 | 3300006847 | Bacteria | 2035 |
| 92 | Ga0075431_100215172 | 3300006847 | Unclassified | 1961 |
| 93 | Ga0075433_10144408 | 3300006852 | Unclassified | 2115 |
| 94 | Ga0075433_11022118 | 3300006852 | Bacteria | 720 |
| 95 | Ga0075434_100004694 | 3300006871 | Bacteria | 12346 |
| 96 | Ga0075429_100055255 | 3300006880 | Unclassified | 3455 |
| 97 | Ga0075429_100065541 | 3300006880 | Unclassified | 3162 |
| 98 | Ga0075429_100077719 | 3300006880 | Unclassified | 2892 |
| 99 | Ga0075429_100085329 | 3300006880 | Bacteria | 2753 |
| 100 | Ga0075429_100214065 | 3300006880 | Unclassified | 1688 |
| 101 | Ga0068865_100758199 | 3300006881 | Bacteria | 834 |
| 102 | Ga0097620_100048540 | 3300006931 | Bacteria | 4264 |
| 103 | Ga0097620_100225251 | 3300006931 | Unclassified | 1963 |
| 104 | Ga0097620_100397765 | 3300006931 | Bacteria | 1473 |
| 105 | Ga0097620_100770336 | 3300006931 | Bacteria | 1051 |
| 106 | Ga0097620_101213270 | 3300006931 | Bacteria | 831 |
| 107 | Ga0097620_101762509 | 3300006931 | Archaea | 684 |
| 108 | Ga0075435_100017219 | 3300007076 | Bacteria | 5464 |
| 109 | Ga0111539_10001033 | 3300009094 | Bacteria | 36485 |
| 110 | Ga0111539_10008361 | 3300009094 | Bacteria | 13167 |
| 111 | Ga0111539_10014801 | 3300009094 | Bacteria | 9730 |
| 112 | Ga0111539_10068870 | 3300009094 | Bacteria | 4178 |
| 113 | Ga0111539_10100686 | 3300009094 | Unclassified | 3392 |
| 114 | Ga0111539_10189730 | 3300009094 | Unclassified | 2399 |
| 115 | Ga0111539_10335411 | 3300009094 | Bacteria | 1760 |
| 116 | Ga0111539_10885256 | 3300009094 | Bacteria | 1039 |
| 117 | Ga0114129_10145870 | 3300009147 | Bacteria | 3242 |
| 118 | Ga0114129_10165428 | 3300009147 | Bacteria | 3019 |
| 119 | Ga0114129_10168710 | 3300009147 | Bacteria | 2985 |
| 120 | Ga0114129_10203067 | 3300009147 | Bacteria | 2683 |
| 121 | Ga0114129_12207342 | 3300009147 | Unclassified | 662 |
| 122 | Ga0105243_10237479 | 3300009148 | Bacteria | 1620 |
| 123 | Ga0105243_10993366 | 3300009148 | Bacteria | 841 |
| 124 | Ga0105243_11449735 | 3300009148 | Unclassified | 709 |
| 125 | Ga0105242_10865207 | 3300009176 | Bacteria | 901 |
| 126 | Ga0105242_11138395 | 3300009176 | Bacteria | 796 |
| 127 | Ga0105242_12084353 | 3300009176 | Bacteria | 611 |
| 128 | Ga0105248_10178299 | 3300009177 | Bacteria | 2395 |
| 129 | Ga0105248_11473483 | 3300009177 | Bacteria | 770 |
| 130 | Ga0105249_10005648 | 3300009553 | Bacteria | 10825 |
| 131 | Ga0105249_10539625 | 3300009553 | Bacteria | 1216 |
| 132 | Ga0157374_10025807 | 3300013296 | Bacteria | 5282 |
| 133 | Ga0157378_10373711 | 3300013297 | Unclassified | 1398 |
| 134 | Ga0163162_10965279 | 3300013306 | Bacteria | 963 |
| 135 | Ga0157375_10009491 | 3300013308 | Bacteria | 8543 |
| 136 | Ga0157375_11511254 | 3300013308 | Unclassified | 793 |
| 137 | Ga0157375_11773481 | 3300013308 | Unclassified | 731 |
| 138 | Ga0157375_12364008 | 3300013308 | Archaea | 634 |
| 139 | Ga0157380_10024876 | 3300014326 | Bacteria | 4536 |
| 140 | Ga0157380_10170426 | 3300014326 | Unclassified | 1902 |
| 141 | Ga0157380_10183411 | 3300014326 | Bacteria | 1841 |
| 142 | Ga0157380_10415812 | 3300014326 | Bacteria | 1281 |
| 143 | Ga0157377_10023668 | 3300014745 | Bacteria | 3258 |
| 144 | Ga0207653_10057164 | 3300025885 | Unclassified | 1309 |
| 145 | Ga0207647_10313635 | 3300025904 | Unclassified | 891 |
| 146 | Ga0207645_10031400 | 3300025907 | Unclassified | 3418 |
| 147 | Ga0207643_10000979 | 3300025908 | Bacteria | 17142 |
| 148 | Ga0207643_10051890 | 3300025908 | Bacteria | 2328 |
| 149 | Ga0207660_10583027 | 3300025917 | Unclassified | 910 |
| 150 | Ga0207662_10001870 | 3300025918 | Bacteria | 10352 |
| 151 | Ga0207662_10090476 | 3300025918 | Bacteria | 1881 |
| 152 | Ga0207657_10761437 | 3300025919 | Unclassified | 750 |
| 153 | Ga0207681_10013169 | 3300025923 | Bacteria | 5113 |
| 154 | Ga0207681_10240290 | 3300025923 | Unclassified | 1409 |
| 155 | Ga0207650_11132772 | 3300025925 | Bacteria | 666 |
| 156 | Ga0207659_10001383 | 3300025926 | Bacteria | 14470 |
| 157 | Ga0207659_10009248 | 3300025926 | Bacteria | 6153 |
| 158 | Ga0207659_10064752 | 3300025926 | Bacteria | 2647 |
| 159 | Ga0207659_10148059 | 3300025926 | Bacteria | 1830 |
| 160 | Ga0207659_10187158 | 3300025926 | Bacteria | 1645 |
| 161 | Ga0207659_10381158 | 3300025926 | Bacteria | 1176 |
| 162 | Ga0207706_10022872 | 3300025933 | Bacteria | 5609 |
| 163 | Ga0207706_10378068 | 3300025933 | Unclassified | 1229 |
| 164 | Ga0207709_10017291 | 3300025935 | Bacteria | 4024 |
| 165 | Ga0207670_10011218 | 3300025936 | Bacteria | 5194 |
| 166 | Ga0207670_10054746 | 3300025936 | Bacteria | 2693 |
| 167 | Ga0207669_10037248 | 3300025937 | Bacteria | 2788 |
| 168 | Ga0207669_10168879 | 3300025937 | Bacteria | 1555 |
| 169 | Ga0207669_10280854 | 3300025937 | Unclassified | 1256 |
| 170 | Ga0207704_10069445 | 3300025938 | Unclassified | 2226 |
| 171 | Ga0207691_10044680 | 3300025940 | Bacteria | 4076 |
| 172 | Ga0207691_10180139 | 3300025940 | Bacteria | 1847 |
| 173 | Ga0207689_10052055 | 3300025942 | Bacteria | 3374 |
| 174 | Ga0207689_10085971 | 3300025942 | Unclassified | 2585 |
| 175 | Ga0207689_10093131 | 3300025942 | Bacteria | 2475 |
| 176 | Ga0207651_10023970 | 3300025960 | Bacteria | 3765 |
| 177 | Ga0207651_10976197 | 3300025960 | Archaea | 756 |
| 178 | Ga0207712_10004018 | 3300025961 | Bacteria | 9290 |
| 179 | Ga0207712_10656012 | 3300025961 | Unclassified | 912 |
| 180 | Ga0207712_11217853 | 3300025961 | Bacteria | 672 |
| 181 | Ga0207668_10151811 | 3300025972 | Bacteria | 1794 |
| 182 | Ga0207668_10297190 | 3300025972 | Bacteria | 1331 |
| 183 | Ga0207668_10682650 | 3300025972 | Bacteria | 901 |
| 184 | Ga0207640_10100513 | 3300025981 | Bacteria | 2027 |
| 185 | Ga0207677_10382876 | 3300026023 | Unclassified | 1188 |
| 186 | Ga0207677_10662056 | 3300026023 | Bacteria | 923 |
| 187 | Ga0207708_10058226 | 3300026075 | Bacteria | 2948 |
| 188 | Ga0207708_10062965 | 3300026075 | Unclassified | 2834 |
| 189 | Ga0207708_10441532 | 3300026075 | Bacteria | 1082 |
| 190 | Ga0207708_10719922 | 3300026075 | Unclassified | 854 |
| 191 | Ga0207641_11069947 | 3300026088 | Unclassified | 805 |
| 192 | Ga0207648_10001577 | 3300026089 | Bacteria | 24995 |
| 193 | Ga0207648_10838015 | 3300026089 | Bacteria | 857 |
| 194 | Ga0207676_10261564 | 3300026095 | Bacteria | 1563 |
| 195 | Ga0207676_10386696 | 3300026095 | Unclassified | 1304 |
| 196 | Ga0207674_10028000 | 3300026116 | Bacteria | 5955 |
| 197 | Ga0207674_10037062 | 3300026116 | Bacteria | 5074 |
| 198 | Ga0207674_11219040 | 3300026116 | Archaea | 722 |
| 199 | Ga0207674_11644517 | 3300026116 | Unclassified | 611 |
| 200 | Ga0207675_100001310 | 3300026118 | Bacteria | 24930 |
| 201 | Ga0207675_100616132 | 3300026118 | Unclassified | 1089 |
| 202 | Ga0207683_10179733 | 3300026121 | Bacteria | 1918 |
| 203 | Ga0209974_10109478 | 3300027876 | Bacteria | 971 |
| 204 | Ga0207428_10003027 | 3300027907 | Bacteria | 16548 |
| 205 | Ga0207428_10005576 | 3300027907 | Bacteria | 11705 |
| 206 | Ga0207428_10014571 | 3300027907 | Bacteria | 6819 |
| 207 | Ga0207428_10032357 | 3300027907 | Bacteria | 4302 |
| 208 | Ga0207428_10064978 | 3300027907 | Unclassified | 2880 |
| 209 | Ga0268265_10001704 | 3300028380 | Bacteria | 17888 |
| 210 | Ga0307408_100002035 | 3300031548 | Bacteria | 14554 |
| 211 | Ga0307408_100013047 | 3300031548 | Bacteria | 5512 |
| 212 | Ga0307408_100923797 | 3300031548 | Bacteria | 800 |
| 213 | Ga0307405_10005971 | 3300031731 | Bacteria | 5942 |
| 214 | Ga0307405_10067262 | 3300031731 | Bacteria | 2288 |
| 215 | Ga0307405_10091380 | 3300031731 | Unclassified | 2017 |
| 216 | Ga0307405_10350193 | 3300031731 | Bacteria | 1139 |
| 217 | Ga0307413_10075518 | 3300031824 | Bacteria | 2139 |
| 218 | Ga0307413_10553281 | 3300031824 | Unclassified | 934 |
| 219 | Ga0307410_10001753 | 3300031852 | Bacteria | 10033 |
| 220 | Ga0307410_10370267 | 3300031852 | Unclassified | 1150 |
| 221 | Ga0307410_10990263 | 3300031852 | Bacteria | 724 |
| 222 | Ga0307410_11018738 | 3300031852 | Unclassified | 715 |
| 223 | Ga0307407_10002997 | 3300031903 | Bacteria | 6784 |
| 224 | Ga0307412_10005870 | 3300031911 | Bacteria | 6915 |
| 225 | Ga0307412_10499214 | 3300031911 | Bacteria | 1013 |
| 226 | Ga0307412_10595752 | 3300031911 | Archaea | 935 |
| 227 | Ga0307409_100128711 | 3300031995 | Bacteria | 2159 |
| 228 | Ga0307409_100182538 | 3300031995 | Unclassified | 1859 |
| 229 | Ga0307409_100539264 | 3300031995 | Unclassified | 1143 |
| 230 | Ga0307409_100938009 | 3300031995 | Bacteria | 881 |
| 231 | Ga0307416_100189064 | 3300032002 | Bacteria | 1939 |
| 232 | Ga0307416_100368527 | 3300032002 | Bacteria | 1461 |
| 233 | Ga0307416_100531719 | 3300032002 | Bacteria | 1246 |
| 234 | Ga0307411_10002325 | 3300032005 | Bacteria | 8351 |
| 235 | Ga0307411_10041684 | 3300032005 | Bacteria | 2923 |
| 236 | Ga0307411_10470581 | 3300032005 | Unclassified | 1056 |
| 237 | Ga0307415_100017876 | 3300032126 | Bacteria | 4264 |
| 238 | Ga0373948_0025329 | 3300034817 | Unclassified | 1163 |
| 239 | Ga0373941_0382097 | 3300035115 | Archaea | 579 |
| 240 | Ga0439433_0012187 | 3300041999 | Unclassified | 1885 |
| 241 | Ga0439433_0057926 | 3300041999 | Bacteria | 921 |
| 242 | Ga0439462_0024350 | 3300042015 | Unclassified | 1590 |
| 243 | Ga0450923_029898 | 3300042125 | Bacteria | 1106 |
| 244 | Ga0439434_0008784 | 3300042435 | Bacteria | 2968 |
| 245 | Ga0439434_0027171 | 3300042435 | Unclassified | 1730 |
| 246 | Ga0439435_0081410 | 3300042436 | Bacteria | 972 |
| 247 | Ga0439444_0059275 | 3300042437 | Unclassified | 796 |
| 248 | Ga0439440_0135693 | 3300042993 | Unclassified | 695 |
| 249 | Ga0495629_0574474 | 3300046459 | Bacteria | 755 |
| 250 | Ga0495658_0037810 | 3300046683 | Bacteria | 2670 |
| 251 | Ga0495676_0866276 | 3300047321 | Bacteria | 580 |
| 252 | Ga0501296_030837 | 3300049519 | Unclassified | 722 |
| 253 | Ga0501299_093138 | 3300049522 | Archaea | 688 |
| 254 | Ga0501036_0878950 | 3300049572 | Bacteria | 736 |
| 255 | Ga0501036_1049852 | 3300049572 | Unclassified | 666 |
| 256 | Ga0501039_0028741 | 3300049575 | Bacteria | 4281 |
| 257 | Ga0501039_0084573 | 3300049575 | Unclassified | 2471 |
| 258 | Ga0501040_0007557 | 3300049576 | Bacteria | 7029 |
| 259 | Ga0501040_0091234 | 3300049576 | Bacteria | 2118 |
| 260 | Ga0501041_0387578 | 3300049577 | Unclassified | 884 |
| 261 | Ga0501042_0051935 | 3300049578 | Unclassified | 2924 |
| 262 | Ga0501042_0110922 | 3300049578 | Bacteria | 1975 |
| 263 | Ga0501042_0422482 | 3300049578 | Bacteria | 966 |
| 264 | Ga0501046_0133923 | 3300049580 | Bacteria | 1878 |
| 265 | Ga0501048_0013656 | 3300049582 | Bacteria | 6026 |
| 266 | Ga0501048_0272529 | 3300049582 | Bacteria | 1203 |
| 267 | Ga0501048_0613684 | 3300049582 | Bacteria | 781 |
| 268 | Ga0501071_0077183 | 3300049587 | Bacteria | 2433 |
| 269 | Ga0501072_0298540 | 3300049588 | Unclassified | 1281 |
| 270 | Ga0501072_0607628 | 3300049588 | Bacteria | 862 |
| 271 | Ga0501074_0091867 | 3300049590 | Bacteria | 2174 |
| 272 | Ga0501075_0059974 | 3300049591 | Unclassified | 2867 |
| 273 | Ga0501075_0100432 | 3300049591 | Bacteria | 2197 |
| 274 | Ga0501075_0473972 | 3300049591 | Bacteria | 955 |
| 275 | Ga0501076_0681827 | 3300049592 | Bacteria | 848 |
| 276 | Ga0501077_0041368 | 3300049593 | Unclassified | 2934 |
| 277 | Ga0501077_0149735 | 3300049593 | Bacteria | 1481 |
| 278 | Ga0501216_056906 | 3300049660 | Unclassified | 780 |
| 279 | Ga0501223_036772 | 3300049663 | Unclassified | 952 |
| 280 | Ga0501249_022006 | 3300049679 | Unclassified | 1394 |
| 281 | Ga0501225_0049052 | 3300049705 | Bacteria | 1173 |
| 282 | Ga0501079_0067548 | 3300049741 | Bacteria | 2759 |
| 283 | Ga0501079_0184122 | 3300049741 | Unclassified | 1630 |
| 284 | Ga0501080_0479403 | 3300049742 | Bacteria | 1113 |
| 285 | Ga0501081_0038947 | 3300049743 | Unclassified | 3251 |
| 286 | Ga0501283_034844 | 3300049779 | Unclassified | 856 |
| 287 | Ga0501035_0506005 | 3300049822 | Unclassified | 994 |
| 288 | Ga0501045_0057110 | 3300049824 | Unclassified | 2856 |
| 289 | Ga0501045_0193973 | 3300049824 | Unclassified | 1514 |
| 290 | nmdc:mga00v17_270655_c1 | 3300050491 | Bacteria | 1102 |
| 291 | nmdc:mga0k408_343135_c1 | 3300050493 | Unclassified | 890 |
| 292 | nmdc:mga05p37_11019_c1 | 3300050507 | Bacteria | 10738 |
| 293 | nmdc:mga05p37_309126_c1 | 3300050507 | Bacteria | 1874 |
| 294 | nmdc:mga05p37_494120_c1 | 3300050507 | Bacteria | 1406 |
| 295 | nmdc:mga05p37_499995_c1 | 3300050507 | Unclassified | 1396 |
| 296 | nmdc:mga05p37_504696_c1 | 3300050507 | Bacteria | 1387 |
| 297 | nmdc:mga05p37_89993_c1 | 3300050507 | Bacteria | 3782 |
| 298 | nmdc:mga09592_101793_c1 | 3300050508 | Unclassified | 2461 |
| 299 | nmdc:mga09592_1092054_c1 | 3300050508 | Unclassified | 663 |
| 300 | nmdc:mga09592_145924_c1 | 3300050508 | Bacteria | 2040 |
| 301 | nmdc:mga09592_216034_c1 | 3300050508 | Unclassified | 1661 |
| 302 | nmdc:mga09592_225923_c1 | 3300050508 | Bacteria | 1622 |
| 303 | nmdc:mga09592_29441_c1 | 3300050508 | Unclassified | 4567 |
| 304 | nmdc:mga09592_493262_c1 | 3300050508 | Bacteria | 1055 |
| 305 | nmdc:mga09592_747435_c1 | 3300050508 | Unclassified | 830 |
| 306 | nmdc:mga0qj67_110324_c1 | 3300050509 | Unclassified | 2221 |
| 307 | nmdc:mga0qj67_146566_c1 | 3300050509 | Bacteria | 1914 |
| 308 | nmdc:mga0qj67_19217_c1 | 3300050509 | Bacteria | 5219 |
| 309 | nmdc:mga0qj67_26818_c1 | 3300050509 | Bacteria | 4461 |
| 310 | nmdc:mga0qj67_439723_c1 | 3300050509 | Unclassified | 1051 |
| 311 | nmdc:mga06r32_155729_c1 | 3300050510 | Unclassified | 2266 |
| 312 | nmdc:mga06r32_19615_c1 | 3300050510 | Bacteria | 6209 |
| 313 | nmdc:mga06r32_232201_c1 | 3300050510 | Bacteria | 1833 |
| 314 | nmdc:mga06r32_248210_c1 | 3300050510 | Bacteria | 1767 |
| 315 | nmdc:mga06r32_265920_c1 | 3300050510 | Unclassified | 1702 |
| 316 | nmdc:mga06r32_516189_c1 | 3300050510 | Bacteria | 1171 |
| 317 | nmdc:mga06r32_637175_c1 | 3300050510 | Bacteria | 1035 |
| 318 | nmdc:mga08y16_164527_c1 | 3300050511 | Bacteria | 2304 |
| 319 | nmdc:mga08y16_2241_c1 | 3300050511 | Bacteria | 19824 |
| 320 | nmdc:mga08y16_382557_c1 | 3300050511 | Bacteria | 1442 |
| 321 | nmdc:mga08y16_445_c1 | 3300050511 | Bacteria | 38283 |
| 322 | nmdc:mga08y16_69072_c1 | 3300050511 | Bacteria | 3684 |
| 323 | nmdc:mga08y16_693695_c1 | 3300050511 | Archaea | 1019 |
| 324 | nmdc:mga08y16_7225_c1 | 3300050511 | Bacteria | 11655 |
| 325 | nmdc:mga0n895_372_c1 | 3300050512 | Bacteria | 30333 |
| 326 | nmdc:mga0a205_129161_c1 | 3300050515 | Bacteria | 2427 |
| 327 | nmdc:mga0a205_153512_c1 | 3300050515 | Bacteria | 2201 |
| 328 | nmdc:mga0a205_312_c1 | 3300050515 | Bacteria | 36141 |
| 329 | Ga0501084_0072886 | 3300054114 | Bacteria | 2876 |
| 330 | Ga0501084_0127962 | 3300054114 | Bacteria | 2138 |
| 331 | Ga0590071_000678 | 3300059421 | Bacteria | 9665 |
| 332 | Ga0590077_000535 | 3300059426 | Bacteria | 10510 |
| 333 | Ga0590077_004059 | 3300059426 | Archaea | 3015 |
| 334 | Ga0501082_0070752 | 3300060353 | Unclassified | 3004 |
| 335 | Ga0501082_0175754 | 3300060353 | Bacteria | 1862 |
| 336 | Ga0501082_0579322 | 3300060353 | Bacteria | 982 |
| 337 | Ga0530510_0008601 | 3300061734 | Bacteria | 7131 |
| 338 | Ga0530510_0012854 | 3300061734 | Bacteria | 5886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10993366 | Ga0105243_109933661 | 162 |
| 2 | 3300009176 | Ga0105242_11138395 | Ga0105242_111383951 | 162 |
| 3 | 3300026089 | Ga0207648_10838015 | Ga0207648_108380151 | 162 |
| 4 | 3300005336 | Ga0070680_100634381 | Ga0070680_1006343812 | 163 |
| 5 | 3300005459 | Ga0068867_100052454 | Ga0068867_1000524542 | 163 |
| 6 | 3300025917 | Ga0207660_10583027 | Ga0207660_105830272 | 163 |
| 7 | 3300042436 | Ga0439435_0081410 | Ga0439435_0081410_201_725 | 163 |
| 8 | 3300005334 | Ga0068869_101062449 | Ga0068869_1010624491 | 164 |
| 9 | 3300005353 | Ga0070669_101148869 | Ga0070669_1011488691 | 167 |
| 10 | 3300006846 | Ga0075430_100203465 | Ga0075430_1002034653 | 167 |
| 11 | 3300006880 | Ga0075429_100077719 | Ga0075429_1000777191 | 167 |
| 12 | 3300025925 | Ga0207650_11132772 | Ga0207650_111327721 | 167 |
| 13 | 3300050509 | nmdc:mga0qj67_439723_c1 | nmdc:mga0qj67_439723_c1_481_993 | 167 |
| 14 | 3300005445 | Ga0070708_100328802 | Ga0070708_1003288022 | 168 |
| 15 | 3300005456 | Ga0070678_100989972 | Ga0070678_1009899721 | 168 |
| 16 | 3300006844 | Ga0075428_100671468 | Ga0075428_1006714682 | 168 |
| 17 | 3300006844 | Ga0075428_101464908 | Ga0075428_1014649081 | 168 |
| 18 | 3300006846 | Ga0075430_100072323 | Ga0075430_1000723233 | 168 |
| 19 | 3300006847 | Ga0075431_100201612 | Ga0075431_1002016123 | 168 |
| 20 | 3300006852 | Ga0075433_10144408 | Ga0075433_101444082 | 168 |
| 21 | 3300006871 | Ga0075434_100004694 | Ga0075434_10000469410 | 168 |
| 22 | 3300006880 | Ga0075429_100065541 | Ga0075429_1000655412 | 168 |
| 23 | 3300007076 | Ga0075435_100017219 | Ga0075435_1000172193 | 168 |
| 24 | 3300009147 | Ga0114129_10145870 | Ga0114129_101458702 | 168 |
| 25 | 3300031852 | Ga0307410_11018738 | Ga0307410_110187381 | 168 |
| 26 | 3300042993 | Ga0439440_0135693 | Ga0439440_0135693_83_604 | 168 |
| 27 | 3300049572 | Ga0501036_1049852 | Ga0501036_1049852_96_617 | 168 |
| 28 | 3300049582 | Ga0501048_0613684 | Ga0501048_0613684_86_703 | 168 |
| 29 | 3300050507 | nmdc:mga05p37_309126_c1 | nmdc:mga05p37_309126_c1_829_1344 | 168 |
| 30 | 3300050508 | nmdc:mga09592_29441_c1 | nmdc:mga09592_29441_c1_502_1017 | 168 |
| 31 | 3300050509 | nmdc:mga0qj67_110324_c1 | nmdc:mga0qj67_110324_c1_995_1510 | 168 |
| 32 | 3300050510 | nmdc:mga06r32_232201_c1 | nmdc:mga06r32_232201_c1_376_891 | 168 |
| 33 | 3300050510 | nmdc:mga06r32_265920_c1 | nmdc:mga06r32_265920_c1_475_990 | 168 |
| 34 | 3300050512 | nmdc:mga0n895_372_c1 | nmdc:mga0n895_372_c1_8029_8544 | 168 |
| 35 | 3300050515 | nmdc:mga0a205_312_c1 | nmdc:mga0a205_312_c1_24579_25094 | 168 |
| 36 | 3300005295 | Ga0065707_10236718 | Ga0065707_102367182 | 169 |
| 37 | 3300005295 | Ga0065707_10878050 | Ga0065707_108780501 | 169 |
| 38 | 3300005336 | Ga0070680_100522991 | Ga0070680_1005229911 | 169 |
| 39 | 3300005336 | Ga0070680_100527872 | Ga0070680_1005278721 | 169 |
| 40 | 3300005340 | Ga0070689_100166529 | Ga0070689_1001665292 | 169 |
| 41 | 3300005347 | Ga0070668_100105418 | Ga0070668_1001054182 | 169 |
| 42 | 3300005353 | Ga0070669_100021630 | Ga0070669_1000216303 | 169 |
| 43 | 3300005354 | Ga0070675_100037255 | Ga0070675_1000372552 | 169 |
| 44 | 3300005354 | Ga0070675_100115211 | Ga0070675_1001152112 | 169 |
| 45 | 3300005354 | Ga0070675_100426159 | Ga0070675_1004261592 | 169 |
| 46 | 3300005364 | Ga0070673_100237846 | Ga0070673_1002378462 | 169 |
| 47 | 3300005364 | Ga0070673_100772156 | Ga0070673_1007721562 | 169 |
| 48 | 3300005365 | Ga0070688_100044284 | Ga0070688_1000442843 | 169 |
| 49 | 3300005365 | Ga0070688_101040981 | Ga0070688_1010409811 | 169 |
| 50 | 3300005441 | Ga0070700_100036688 | Ga0070700_1000366882 | 169 |
| 51 | 3300005444 | Ga0070694_100075184 | Ga0070694_1000751842 | 169 |
| 52 | 3300005457 | Ga0070662_100089241 | Ga0070662_1000892413 | 169 |
| 53 | 3300005466 | Ga0070685_10192062 | Ga0070685_101920621 | 169 |
| 54 | 3300005468 | Ga0070707_100215740 | Ga0070707_1002157403 | 169 |
| 55 | 3300005471 | Ga0070698_100680904 | Ga0070698_1006809041 | 169 |
| 56 | 3300005543 | Ga0070672_100068873 | Ga0070672_1000688733 | 169 |
| 57 | 3300005545 | Ga0070695_100039370 | Ga0070695_1000393704 | 169 |
| 58 | 3300005549 | Ga0070704_100126052 | Ga0070704_1001260524 | 169 |
| 59 | 3300005549 | Ga0070704_100432930 | Ga0070704_1004329302 | 169 |
| 60 | 3300005617 | Ga0068859_100225248 | Ga0068859_1002252482 | 169 |
| 61 | 3300005617 | Ga0068859_100397755 | Ga0068859_1003977552 | 169 |
| 62 | 3300005617 | Ga0068859_101213206 | Ga0068859_1012132061 | 169 |
| 63 | 3300005617 | Ga0068859_101762183 | Ga0068859_1017621832 | 169 |
| 64 | 3300005718 | Ga0068866_10319595 | Ga0068866_103195952 | 169 |
| 65 | 3300005719 | Ga0068861_100264202 | Ga0068861_1002642021 | 169 |
| 66 | 3300005719 | Ga0068861_100403312 | Ga0068861_1004033121 | 169 |
| 67 | 3300005841 | Ga0068863_100736999 | Ga0068863_1007369991 | 169 |
| 68 | 3300005844 | Ga0068862_100005392 | Ga0068862_10000539213 | 169 |
| 69 | 3300006358 | Ga0068871_100347523 | Ga0068871_1003475232 | 169 |
| 70 | 3300006844 | Ga0075428_100109691 | Ga0075428_1001096912 | 169 |
| 71 | 3300006844 | Ga0075428_100168868 | Ga0075428_1001688681 | 169 |
| 72 | 3300006846 | Ga0075430_100036822 | Ga0075430_1000368223 | 169 |
| 73 | 3300006846 | Ga0075430_100140824 | Ga0075430_1001408242 | 169 |
| 74 | 3300006847 | Ga0075431_100097282 | Ga0075431_1000972822 | 169 |
| 75 | 3300006847 | Ga0075431_100215172 | Ga0075431_1002151722 | 169 |
| 76 | 3300006852 | Ga0075433_11022118 | Ga0075433_110221182 | 169 |
| 77 | 3300006880 | Ga0075429_100085329 | Ga0075429_1000853292 | 169 |
| 78 | 3300006880 | Ga0075429_100214065 | Ga0075429_1002140654 | 169 |
| 79 | 3300006881 | Ga0068865_100758199 | Ga0068865_1007581992 | 169 |
| 80 | 3300006931 | Ga0097620_100225251 | Ga0097620_1002252512 | 169 |
| 81 | 3300006931 | Ga0097620_100397765 | Ga0097620_1003977652 | 169 |
| 82 | 3300006931 | Ga0097620_101213270 | Ga0097620_1012132701 | 169 |
| 83 | 3300006931 | Ga0097620_101762509 | Ga0097620_1017625092 | 169 |
| 84 | 3300009094 | Ga0111539_10001033 | Ga0111539_1000103319 | 169 |
| 85 | 3300009094 | Ga0111539_10008361 | Ga0111539_100083619 | 169 |
| 86 | 3300009094 | Ga0111539_10068870 | Ga0111539_100688703 | 169 |
| 87 | 3300009094 | Ga0111539_10100686 | Ga0111539_101006862 | 169 |
| 88 | 3300009094 | Ga0111539_10885256 | Ga0111539_108852562 | 169 |
| 89 | 3300009147 | Ga0114129_10165428 | Ga0114129_101654286 | 169 |
| 90 | 3300009147 | Ga0114129_10203067 | Ga0114129_102030672 | 169 |
| 91 | 3300009176 | Ga0105242_10865207 | Ga0105242_108652072 | 169 |
| 92 | 3300009177 | Ga0105248_11473483 | Ga0105248_114734831 | 169 |
| 93 | 3300013308 | Ga0157375_11511254 | Ga0157375_115112542 | 169 |
| 94 | 3300013308 | Ga0157375_11773481 | Ga0157375_117734811 | 169 |
| 95 | 3300013308 | Ga0157375_12364008 | Ga0157375_123640081 | 169 |
| 96 | 3300014326 | Ga0157380_10024876 | Ga0157380_100248765 | 169 |
| 97 | 3300014326 | Ga0157380_10415812 | Ga0157380_104158122 | 169 |
| 98 | 3300014745 | Ga0157377_10023668 | Ga0157377_100236682 | 169 |
| 99 | 3300025918 | Ga0207662_10090476 | Ga0207662_100904762 | 169 |
| 100 | 3300025926 | Ga0207659_10009248 | Ga0207659_100092482 | 169 |
| 101 | 3300025926 | Ga0207659_10064752 | Ga0207659_100647523 | 169 |
| 102 | 3300025926 | Ga0207659_10148059 | Ga0207659_101480592 | 169 |
| 103 | 3300025926 | Ga0207659_10381158 | Ga0207659_103811582 | 169 |
| 104 | 3300025933 | Ga0207706_10378068 | Ga0207706_103780682 | 169 |
| 105 | 3300025936 | Ga0207670_10054746 | Ga0207670_100547463 | 169 |
| 106 | 3300025937 | Ga0207669_10168879 | Ga0207669_101688792 | 169 |
| 107 | 3300025940 | Ga0207691_10180139 | Ga0207691_101801392 | 169 |
| 108 | 3300025942 | Ga0207689_10052055 | Ga0207689_100520554 | 169 |
| 109 | 3300025960 | Ga0207651_10023970 | Ga0207651_100239703 | 169 |
| 110 | 3300025960 | Ga0207651_10976197 | Ga0207651_109761971 | 169 |
| 111 | 3300025961 | Ga0207712_10656012 | Ga0207712_106560121 | 169 |
| 112 | 3300025972 | Ga0207668_10151811 | Ga0207668_101518113 | 169 |
| 113 | 3300025972 | Ga0207668_10297190 | Ga0207668_102971901 | 169 |
| 114 | 3300026023 | Ga0207677_10662056 | Ga0207677_106620562 | 169 |
| 115 | 3300026075 | Ga0207708_10058226 | Ga0207708_100582262 | 169 |
| 116 | 3300026075 | Ga0207708_10441532 | Ga0207708_104415322 | 169 |
| 117 | 3300026088 | Ga0207641_11069947 | Ga0207641_110699471 | 169 |
| 118 | 3300026095 | Ga0207676_10261564 | Ga0207676_102615641 | 169 |
| 119 | 3300026116 | Ga0207674_11219040 | Ga0207674_112190401 | 169 |
| 120 | 3300026116 | Ga0207674_11644517 | Ga0207674_116445171 | 169 |
| 121 | 3300026118 | Ga0207675_100616132 | Ga0207675_1006161321 | 169 |
| 122 | 3300027876 | Ga0209974_10109478 | Ga0209974_101094781 | 169 |
| 123 | 3300027907 | Ga0207428_10003027 | Ga0207428_100030276 | 169 |
| 124 | 3300027907 | Ga0207428_10032357 | Ga0207428_100323573 | 169 |
| 125 | 3300027907 | Ga0207428_10064978 | Ga0207428_100649784 | 169 |
| 126 | 3300031824 | Ga0307413_10553281 | Ga0307413_105532812 | 169 |
| 127 | 3300031852 | Ga0307410_10370267 | Ga0307410_103702672 | 169 |
| 128 | 3300031852 | Ga0307410_10990263 | Ga0307410_109902631 | 169 |
| 129 | 3300031995 | Ga0307409_100182538 | Ga0307409_1001825382 | 169 |
| 130 | 3300031995 | Ga0307409_100539264 | Ga0307409_1005392642 | 169 |
| 131 | 3300031995 | Ga0307409_100938009 | Ga0307409_1009380092 | 169 |
| 132 | 3300032005 | Ga0307411_10470581 | Ga0307411_104705811 | 169 |
| 133 | 3300034817 | Ga0373948_0025329 | Ga0373948_0025329_621_1139 | 169 |
| 134 | 3300035115 | Ga0373941_0382097 | Ga0373941_0382097_11_529 | 169 |
| 135 | 3300041999 | Ga0439433_0012187 | Ga0439433_0012187_748_1266 | 169 |
| 136 | 3300042125 | Ga0450923_029898 | Ga0450923_029898_516_1034 | 169 |
| 137 | 3300042435 | Ga0439434_0027171 | Ga0439434_0027171_578_1096 | 169 |
| 138 | 3300047321 | Ga0495676_0866276 | Ga0495676_0866276_13_531 | 169 |
| 139 | 3300049519 | Ga0501296_030837 | Ga0501296_030837_146_664 | 169 |
| 140 | 3300049572 | Ga0501036_0878950 | Ga0501036_0878950_38_556 | 169 |
| 141 | 3300049578 | Ga0501042_0422482 | Ga0501042_0422482_194_712 | 169 |
| 142 | 3300049582 | Ga0501048_0272529 | Ga0501048_0272529_110_628 | 169 |
| 143 | 3300049587 | Ga0501071_0077183 | Ga0501071_0077183_158_679 | 169 |
| 144 | 3300049590 | Ga0501074_0091867 | Ga0501074_0091867_1299_1817 | 169 |
| 145 | 3300049591 | Ga0501075_0473972 | Ga0501075_0473972_34_552 | 169 |
| 146 | 3300049592 | Ga0501076_0681827 | Ga0501076_0681827_146_667 | 169 |
| 147 | 3300049593 | Ga0501077_0149735 | Ga0501077_0149735_528_1046 | 169 |
| 148 | 3300049660 | Ga0501216_056906 | Ga0501216_056906_47_565 | 169 |
| 149 | 3300049663 | Ga0501223_036772 | Ga0501223_036772_143_661 | 169 |
| 150 | 3300049679 | Ga0501249_022006 | Ga0501249_022006_353_871 | 169 |
| 151 | 3300049705 | Ga0501225_0049052 | Ga0501225_0049052_533_1051 | 169 |
| 152 | 3300049779 | Ga0501283_034844 | Ga0501283_034844_94_612 | 169 |
| 153 | 3300050507 | nmdc:mga05p37_11019_c1 | nmdc:mga05p37_11019_c1_3699_4217 | 169 |
| 154 | 3300050507 | nmdc:mga05p37_494120_c1 | nmdc:mga05p37_494120_c1_155_673 | 169 |
| 155 | 3300050507 | nmdc:mga05p37_504696_c1 | nmdc:mga05p37_504696_c1_430_948 | 169 |
| 156 | 3300050507 | nmdc:mga05p37_89993_c1 | nmdc:mga05p37_89993_c1_2533_3051 | 169 |
| 157 | 3300050508 | nmdc:mga09592_101793_c1 | nmdc:mga09592_101793_c1_1317_1835 | 169 |
| 158 | 3300050508 | nmdc:mga09592_145924_c1 | nmdc:mga09592_145924_c1_1050_1568 | 169 |
| 159 | 3300050508 | nmdc:mga09592_216034_c1 | nmdc:mga09592_216034_c1_195_713 | 169 |
| 160 | 3300050508 | nmdc:mga09592_225923_c1 | nmdc:mga09592_225923_c1_608_1126 | 169 |
| 161 | 3300050509 | nmdc:mga0qj67_146566_c1 | nmdc:mga0qj67_146566_c1_105_623 | 169 |
| 162 | 3300050510 | nmdc:mga06r32_155729_c1 | nmdc:mga06r32_155729_c1_1170_1688 | 169 |
| 163 | 3300050510 | nmdc:mga06r32_516189_c1 | nmdc:mga06r32_516189_c1_49_567 | 169 |
| 164 | 3300050510 | nmdc:mga06r32_637175_c1 | nmdc:mga06r32_637175_c1_14_532 | 169 |
| 165 | 3300050511 | nmdc:mga08y16_164527_c1 | nmdc:mga08y16_164527_c1_1051_1569 | 169 |
| 166 | 3300050511 | nmdc:mga08y16_445_c1 | nmdc:mga08y16_445_c1_18104_18622 | 169 |
| 167 | 3300050511 | nmdc:mga08y16_69072_c1 | nmdc:mga08y16_69072_c1_2880_3398 | 169 |
| 168 | 3300050511 | nmdc:mga08y16_693695_c1 | nmdc:mga08y16_693695_c1_346_864 | 169 |
| 169 | 3300050515 | nmdc:mga0a205_129161_c1 | nmdc:mga0a205_129161_c1_160_678 | 169 |
| 170 | 3300050515 | nmdc:mga0a205_153512_c1 | nmdc:mga0a205_153512_c1_918_1436 | 169 |
| 171 | 3300054114 | Ga0501084_0127962 | Ga0501084_0127962_1267_1785 | 169 |
| 172 | 3300059421 | Ga0590071_000678 | Ga0590071_000678_4982_5500 | 169 |
| 173 | 3300059426 | Ga0590077_000535 | Ga0590077_000535_4073_4591 | 169 |
| 174 | 3300059426 | Ga0590077_004059 | Ga0590077_004059_2196_2756 | 169 |
| 175 | 3300060353 | Ga0501082_0579322 | Ga0501082_0579322_106_624 | 169 |
| 176 | 3300009147 | Ga0114129_10168710 | Ga0114129_101687105 | 170 |
| 177 | 3300009176 | Ga0105242_12084353 | Ga0105242_120843531 | 170 |
| 178 | 3300049575 | Ga0501039_0084573 | Ga0501039_0084573_793_1320 | 170 |
| 179 | 3300049576 | Ga0501040_0007557 | Ga0501040_0007557_1314_1841 | 170 |
| 180 | 3300049578 | Ga0501042_0051935 | Ga0501042_0051935_1769_2296 | 170 |
| 181 | 3300049582 | Ga0501048_0013656 | Ga0501048_0013656_4532_5059 | 170 |
| 182 | 3300049588 | Ga0501072_0607628 | Ga0501072_0607628_143_661 | 170 |
| 183 | 3300049591 | Ga0501075_0059974 | Ga0501075_0059974_1839_2366 | 170 |
| 184 | 3300049593 | Ga0501077_0041368 | Ga0501077_0041368_1622_2149 | 170 |
| 185 | 3300049741 | Ga0501079_0184122 | Ga0501079_0184122_470_997 | 170 |
| 186 | 3300049743 | Ga0501081_0038947 | Ga0501081_0038947_1779_2306 | 170 |
| 187 | 3300049822 | Ga0501035_0506005 | Ga0501035_0506005_137_658 | 170 |
| 188 | 3300049824 | Ga0501045_0057110 | Ga0501045_0057110_1945_2472 | 170 |
| 189 | 3300060353 | Ga0501082_0070752 | Ga0501082_0070752_1779_2306 | 170 |
| 190 | 3300061734 | Ga0530510_0012854 | Ga0530510_0012854_1657_2184 | 170 |
| 191 | 3300005293 | Ga0065715_10115089 | Ga0065715_101150892 | 171 |
| 192 | 3300005295 | Ga0065707_10394504 | Ga0065707_103945042 | 171 |
| 193 | 3300005331 | Ga0070670_100036223 | Ga0070670_1000362232 | 171 |
| 194 | 3300005339 | Ga0070660_100954734 | Ga0070660_1009547341 | 171 |
| 195 | 3300005347 | Ga0070668_100129130 | Ga0070668_1001291304 | 171 |
| 196 | 3300005353 | Ga0070669_100016667 | Ga0070669_1000166675 | 171 |
| 197 | 3300005354 | Ga0070675_100000624 | Ga0070675_10000062418 | 171 |
| 198 | 3300005356 | Ga0070674_100033673 | Ga0070674_1000336736 | 171 |
| 199 | 3300005356 | Ga0070674_100344237 | Ga0070674_1003442372 | 171 |
| 200 | 3300005365 | Ga0070688_100221308 | Ga0070688_1002213082 | 171 |
| 201 | 3300005406 | Ga0070703_10010124 | Ga0070703_100101243 | 171 |
| 202 | 3300005438 | Ga0070701_10008116 | Ga0070701_100081163 | 171 |
| 203 | 3300005440 | Ga0070705_100035975 | Ga0070705_1000359753 | 171 |
| 204 | 3300005441 | Ga0070700_100163976 | Ga0070700_1001639761 | 171 |
| 205 | 3300005444 | Ga0070694_100013544 | Ga0070694_1000135444 | 171 |
| 206 | 3300005456 | Ga0070678_100316957 | Ga0070678_1003169572 | 171 |
| 207 | 3300005457 | Ga0070662_100057781 | Ga0070662_1000577812 | 171 |
| 208 | 3300005457 | Ga0070662_100332301 | Ga0070662_1003323012 | 171 |
| 209 | 3300005459 | Ga0068867_100001807 | Ga0068867_1000018077 | 171 |
| 210 | 3300005466 | Ga0070685_10269968 | Ga0070685_102699682 | 171 |
| 211 | 3300005466 | Ga0070685_10603816 | Ga0070685_106038161 | 171 |
| 212 | 3300005471 | Ga0070698_100020190 | Ga0070698_1000201904 | 171 |
| 213 | 3300005543 | Ga0070672_100032496 | Ga0070672_1000324963 | 171 |
| 214 | 3300005544 | Ga0070686_100160142 | Ga0070686_1001601422 | 171 |
| 215 | 3300005564 | Ga0070664_100315374 | Ga0070664_1003153742 | 171 |
| 216 | 3300005577 | Ga0068857_100051519 | Ga0068857_1000515193 | 171 |
| 217 | 3300005577 | Ga0068857_100153027 | Ga0068857_1001530272 | 171 |
| 218 | 3300005617 | Ga0068859_100048538 | Ga0068859_1000485384 | 171 |
| 219 | 3300005719 | Ga0068861_100186676 | Ga0068861_1001866762 | 171 |
| 220 | 3300005840 | Ga0068870_10000592 | Ga0068870_100005926 | 171 |
| 221 | 3300005840 | Ga0068870_10044109 | Ga0068870_100441092 | 171 |
| 222 | 3300005844 | Ga0068862_100002885 | Ga0068862_1000028857 | 171 |
| 223 | 3300006058 | Ga0075432_10042962 | Ga0075432_100429622 | 171 |
| 224 | 3300006358 | Ga0068871_100249551 | Ga0068871_1002495512 | 171 |
| 225 | 3300006358 | Ga0068871_100481525 | Ga0068871_1004815252 | 171 |
| 226 | 3300006844 | Ga0075428_100001326 | Ga0075428_10000132610 | 171 |
| 227 | 3300006844 | Ga0075428_100250508 | Ga0075428_1002505082 | 171 |
| 228 | 3300006844 | Ga0075428_100356216 | Ga0075428_1003562162 | 171 |
| 229 | 3300006846 | Ga0075430_100001560 | Ga0075430_1000015605 | 171 |
| 230 | 3300006847 | Ga0075431_100003659 | Ga0075431_1000036594 | 171 |
| 231 | 3300006847 | Ga0075431_100024673 | Ga0075431_1000246736 | 171 |
| 232 | 3300006880 | Ga0075429_100055255 | Ga0075429_1000552552 | 171 |
| 233 | 3300006931 | Ga0097620_100048540 | Ga0097620_1000485404 | 171 |
| 234 | 3300006931 | Ga0097620_100770336 | Ga0097620_1007703362 | 171 |
| 235 | 3300009094 | Ga0111539_10014801 | Ga0111539_100148018 | 171 |
| 236 | 3300009094 | Ga0111539_10189730 | Ga0111539_101897303 | 171 |
| 237 | 3300009094 | Ga0111539_10335411 | Ga0111539_103354112 | 171 |
| 238 | 3300009147 | Ga0114129_12207342 | Ga0114129_122073421 | 171 |
| 239 | 3300009148 | Ga0105243_10237479 | Ga0105243_102374792 | 171 |
| 240 | 3300009148 | Ga0105243_11449735 | Ga0105243_114497351 | 171 |
| 241 | 3300009177 | Ga0105248_10178299 | Ga0105248_101782992 | 171 |
| 242 | 3300009553 | Ga0105249_10005648 | Ga0105249_100056484 | 171 |
| 243 | 3300009553 | Ga0105249_10539625 | Ga0105249_105396252 | 171 |
| 244 | 3300013296 | Ga0157374_10025807 | Ga0157374_100258072 | 171 |
| 245 | 3300013297 | Ga0157378_10373711 | Ga0157378_103737112 | 171 |
| 246 | 3300013306 | Ga0163162_10965279 | Ga0163162_109652791 | 171 |
| 247 | 3300013308 | Ga0157375_10009491 | Ga0157375_100094914 | 171 |
| 248 | 3300014326 | Ga0157380_10170426 | Ga0157380_101704263 | 171 |
| 249 | 3300014326 | Ga0157380_10183411 | Ga0157380_101834112 | 171 |
| 250 | 3300025885 | Ga0207653_10057164 | Ga0207653_100571641 | 171 |
| 251 | 3300025904 | Ga0207647_10313635 | Ga0207647_103136352 | 171 |
| 252 | 3300025907 | Ga0207645_10031400 | Ga0207645_100314002 | 171 |
| 253 | 3300025908 | Ga0207643_10000979 | Ga0207643_100009796 | 171 |
| 254 | 3300025908 | Ga0207643_10051890 | Ga0207643_100518902 | 171 |
| 255 | 3300025918 | Ga0207662_10001870 | Ga0207662_100018704 | 171 |
| 256 | 3300025919 | Ga0207657_10761437 | Ga0207657_107614371 | 171 |
| 257 | 3300025923 | Ga0207681_10013169 | Ga0207681_100131692 | 171 |
| 258 | 3300025923 | Ga0207681_10240290 | Ga0207681_102402902 | 171 |
| 259 | 3300025926 | Ga0207659_10001383 | Ga0207659_100013832 | 171 |
| 260 | 3300025926 | Ga0207659_10187158 | Ga0207659_101871582 | 171 |
| 261 | 3300025933 | Ga0207706_10022872 | Ga0207706_100228724 | 171 |
| 262 | 3300025935 | Ga0207709_10017291 | Ga0207709_100172913 | 171 |
| 263 | 3300025936 | Ga0207670_10011218 | Ga0207670_100112182 | 171 |
| 264 | 3300025937 | Ga0207669_10037248 | Ga0207669_100372482 | 171 |
| 265 | 3300025937 | Ga0207669_10280854 | Ga0207669_102808542 | 171 |
| 266 | 3300025938 | Ga0207704_10069445 | Ga0207704_100694452 | 171 |
| 267 | 3300025940 | Ga0207691_10044680 | Ga0207691_100446803 | 171 |
| 268 | 3300025942 | Ga0207689_10085971 | Ga0207689_100859712 | 171 |
| 269 | 3300025942 | Ga0207689_10093131 | Ga0207689_100931312 | 171 |
| 270 | 3300025961 | Ga0207712_10004018 | Ga0207712_100040182 | 171 |
| 271 | 3300025961 | Ga0207712_11217853 | Ga0207712_112178531 | 171 |
| 272 | 3300025972 | Ga0207668_10682650 | Ga0207668_106826502 | 171 |
| 273 | 3300025981 | Ga0207640_10100513 | Ga0207640_101005132 | 171 |
| 274 | 3300026023 | Ga0207677_10382876 | Ga0207677_103828762 | 171 |
| 275 | 3300026075 | Ga0207708_10062965 | Ga0207708_100629653 | 171 |
| 276 | 3300026075 | Ga0207708_10719922 | Ga0207708_107199221 | 171 |
| 277 | 3300026089 | Ga0207648_10001577 | Ga0207648_100015774 | 171 |
| 278 | 3300026095 | Ga0207676_10386696 | Ga0207676_103866962 | 171 |
| 279 | 3300026116 | Ga0207674_10028000 | Ga0207674_100280004 | 171 |
| 280 | 3300026116 | Ga0207674_10037062 | Ga0207674_100370623 | 171 |
| 281 | 3300026118 | Ga0207675_100001310 | Ga0207675_10000131015 | 171 |
| 282 | 3300026121 | Ga0207683_10179733 | Ga0207683_101797332 | 171 |
| 283 | 3300027907 | Ga0207428_10005576 | Ga0207428_100055767 | 171 |
| 284 | 3300027907 | Ga0207428_10014571 | Ga0207428_100145713 | 171 |
| 285 | 3300028380 | Ga0268265_10001704 | Ga0268265_100017048 | 171 |
| 286 | 3300031548 | Ga0307408_100002035 | Ga0307408_10000203510 | 171 |
| 287 | 3300031548 | Ga0307408_100013047 | Ga0307408_1000130472 | 171 |
| 288 | 3300031548 | Ga0307408_100923797 | Ga0307408_1009237972 | 171 |
| 289 | 3300031731 | Ga0307405_10005971 | Ga0307405_100059713 | 171 |
| 290 | 3300031731 | Ga0307405_10067262 | Ga0307405_100672623 | 171 |
| 291 | 3300031731 | Ga0307405_10091380 | Ga0307405_100913802 | 171 |
| 292 | 3300031731 | Ga0307405_10350193 | Ga0307405_103501932 | 171 |
| 293 | 3300031824 | Ga0307413_10075518 | Ga0307413_100755182 | 171 |
| 294 | 3300031852 | Ga0307410_10001753 | Ga0307410_1000175310 | 171 |
| 295 | 3300031903 | Ga0307407_10002997 | Ga0307407_100029973 | 171 |
| 296 | 3300031911 | Ga0307412_10005870 | Ga0307412_100058705 | 171 |
| 297 | 3300031911 | Ga0307412_10499214 | Ga0307412_104992141 | 171 |
| 298 | 3300031911 | Ga0307412_10595752 | Ga0307412_105957522 | 171 |
| 299 | 3300031995 | Ga0307409_100128711 | Ga0307409_1001287112 | 171 |
| 300 | 3300032002 | Ga0307416_100189064 | Ga0307416_1001890641 | 171 |
| 301 | 3300032002 | Ga0307416_100368527 | Ga0307416_1003685271 | 171 |
| 302 | 3300032002 | Ga0307416_100531719 | Ga0307416_1005317192 | 171 |
| 303 | 3300032005 | Ga0307411_10002325 | Ga0307411_1000232510 | 171 |
| 304 | 3300032005 | Ga0307411_10041684 | Ga0307411_100416842 | 171 |
| 305 | 3300032126 | Ga0307415_100017876 | Ga0307415_1000178763 | 171 |
| 306 | 3300041999 | Ga0439433_0057926 | Ga0439433_0057926_193_723 | 171 |
| 307 | 3300042015 | Ga0439462_0024350 | Ga0439462_0024350_742_1272 | 171 |
| 308 | 3300042435 | Ga0439434_0008784 | Ga0439434_0008784_1936_2466 | 171 |
| 309 | 3300042437 | Ga0439444_0059275 | Ga0439444_0059275_65_601 | 171 |
| 310 | 3300046459 | Ga0495629_0574474 | Ga0495629_0574474_42_566 | 171 |
| 311 | 3300046683 | Ga0495658_0037810 | Ga0495658_0037810_1911_2435 | 171 |
| 312 | 3300049522 | Ga0501299_093138 | Ga0501299_093138_120_656 | 171 |
| 313 | 3300049575 | Ga0501039_0028741 | Ga0501039_0028741_2770_3318 | 171 |
| 314 | 3300049576 | Ga0501040_0091234 | Ga0501040_0091234_1330_1878 | 171 |
| 315 | 3300049577 | Ga0501041_0387578 | Ga0501041_0387578_226_774 | 171 |
| 316 | 3300049578 | Ga0501042_0110922 | Ga0501042_0110922_739_1287 | 171 |
| 317 | 3300049580 | Ga0501046_0133923 | Ga0501046_0133923_1126_1674 | 171 |
| 318 | 3300049588 | Ga0501072_0298540 | Ga0501072_0298540_220_768 | 171 |
| 319 | 3300049591 | Ga0501075_0100432 | Ga0501075_0100432_1476_2024 | 171 |
| 320 | 3300049741 | Ga0501079_0067548 | Ga0501079_0067548_1103_1651 | 171 |
| 321 | 3300049742 | Ga0501080_0479403 | Ga0501080_0479403_77_625 | 171 |
| 322 | 3300049824 | Ga0501045_0193973 | Ga0501045_0193973_580_1116 | 171 |
| 323 | 3300050491 | nmdc:mga00v17_270655_c1 | nmdc:mga00v17_270655_c1_479_1009 | 171 |
| 324 | 3300050493 | nmdc:mga0k408_343135_c1 | nmdc:mga0k408_343135_c1_207_743 | 171 |
| 325 | 3300050507 | nmdc:mga05p37_499995_c1 | nmdc:mga05p37_499995_c1_33_566 | 171 |
| 326 | 3300050508 | nmdc:mga09592_1092054_c1 | nmdc:mga09592_1092054_c1_113_643 | 171 |
| 327 | 3300050508 | nmdc:mga09592_493262_c1 | nmdc:mga09592_493262_c1_110_625 | 171 |
| 328 | 3300050508 | nmdc:mga09592_747435_c1 | nmdc:mga09592_747435_c1_112_627 | 171 |
| 329 | 3300050509 | nmdc:mga0qj67_19217_c1 | nmdc:mga0qj67_19217_c1_2444_2977 | 171 |
| 330 | 3300050509 | nmdc:mga0qj67_26818_c1 | nmdc:mga0qj67_26818_c1_2959_3489 | 171 |
| 331 | 3300050510 | nmdc:mga06r32_19615_c1 | nmdc:mga06r32_19615_c1_2314_2835 | 171 |
| 332 | 3300050510 | nmdc:mga06r32_248210_c1 | nmdc:mga06r32_248210_c1_1174_1722 | 171 |
| 333 | 3300050511 | nmdc:mga08y16_2241_c1 | nmdc:mga08y16_2241_c1_15707_16222 | 171 |
| 334 | 3300050511 | nmdc:mga08y16_382557_c1 | nmdc:mga08y16_382557_c1_652_1176 | 171 |
| 335 | 3300050511 | nmdc:mga08y16_7225_c1 | nmdc:mga08y16_7225_c1_6877_7410 | 171 |
| 336 | 3300054114 | Ga0501084_0072886 | Ga0501084_0072886_1417_1965 | 171 |
| 337 | 3300060353 | Ga0501082_0175754 | Ga0501082_0175754_826_1374 | 171 |
| 338 | 3300061734 | Ga0530510_0008601 | Ga0530510_0008601_3115_3663 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h5n-assembly1.cif.gz_A | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.7284 | 36 | 160 |
| 2h5n-assembly1.cif.gz_C | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.7206 | 36 | 160 |
| 2h5n-assembly1.cif.gz_B | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.7109 | 37 | 155 |
| 2ou3-assembly1.cif.gz_B | crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution | 0.6969 | 38 | 160 |
| 2h5n-assembly1.cif.gz_C | crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 | 0.6769 | 36 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31680_36_183_1.10.3680.10 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.7318 | 20 | 160 | 1.10.3680.10 |
| 2h5nA01 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.7312 | 36 | 160 | 1.10.3680.10 |
| 2h5nA01 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.7105 | 36 | 160 | 1.10.3680.10 |
| af_P31680_36_183_1.10.3680.10 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.6843 | 20 | 160 | 1.10.3680.10 |
| af_Q91WU4_1_181_1.10.3680.10 | Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like | 0.5129 | 11 | 160 | 1.10.3680.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535VRG5-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.9954 | 31 | 163 |
|
| AF-A0A7C2SAB0-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.9878 | 20 | 163 |
|
| AF-A0A382CU70-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.9874 | 39 | 164 |
|
| AF-A0A6L7WKB9-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.9721 | 55 | 163 |
|
| AF-A0A0B4C2F6-F1-model_v4 | Co-chaperone DjlA N-terminal domain-containing protein | 0.9647 | 37 | 160 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar