F413710

General Info

Members Datasets Scaffolds Average Seq Length
338 153 338 173

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0613684|Ga0501048_0613684_86_703
Length 205
Sequence MTIRRSYRSPGPLVVHSRRPHGFTADEISRTLRETPVKSIRAWLGLDRPEAPEPAPLRDVLGALDHLEPVRARYLAAFAYLLGRVAHADQHVSPEETRAMEAALVEHGELTEEQAMLVTQLAKTNNLLFGGTANFLVAREFAETATYEQKLALLRCIFAVSASDEAISLSEESEIHRLARELRIDPPDLLALRVEHQRHLPGRNR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
106 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
107 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
111 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
116 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10115089 3300005293 Unclassified 2427
2 Ga0065707_10236718 3300005295 Unclassified 1170
3 Ga0065707_10394504 3300005295 Bacteria 860
4 Ga0065707_10878050 3300005295 Unclassified 573
5 Ga0070670_100036223 3300005331 Bacteria 4247
6 Ga0068869_101062449 3300005334 Bacteria 707
7 Ga0070680_100522991 3300005336 Bacteria 1016
8 Ga0070680_100527872 3300005336 Bacteria 1011
9 Ga0070680_100634381 3300005336 Unclassified 918
10 Ga0070660_100954734 3300005339 Bacteria 724
11 Ga0070689_100166529 3300005340 Bacteria 1784
12 Ga0070668_100105418 3300005347 Bacteria 2239
13 Ga0070668_100129130 3300005347 Unclassified 2027
14 Ga0070669_100016667 3300005353 Bacteria 5244
15 Ga0070669_100021630 3300005353 Bacteria 4597
16 Ga0070669_101148869 3300005353 Unclassified 670
17 Ga0070675_100000624 3300005354 Bacteria 24512
18 Ga0070675_100037255 3300005354 Bacteria 3961
19 Ga0070675_100115211 3300005354 Bacteria 2278
20 Ga0070675_100426159 3300005354 Bacteria 1187
21 Ga0070674_100033673 3300005356 Bacteria 3413
22 Ga0070674_100344237 3300005356 Bacteria 1202
23 Ga0070673_100237846 3300005364 Archaea 1582
24 Ga0070673_100772156 3300005364 Unclassified 886
25 Ga0070688_100044284 3300005365 Bacteria 2746
26 Ga0070688_100221308 3300005365 Unclassified 1334
27 Ga0070688_101040981 3300005365 Archaea 652
28 Ga0070703_10010124 3300005406 Unclassified 2659
29 Ga0070701_10008116 3300005438 Unclassified 4522
30 Ga0070705_100035975 3300005440 Bacteria 2780
31 Ga0070700_100036688 3300005441 Bacteria 2975
32 Ga0070700_100163976 3300005441 Bacteria 1533
33 Ga0070694_100013544 3300005444 Bacteria 5095
34 Ga0070694_100075184 3300005444 Bacteria 2336
35 Ga0070708_100328802 3300005445 Unclassified 1440
36 Ga0070678_100316957 3300005456 Bacteria 1330
37 Ga0070678_100989972 3300005456 Unclassified 772
38 Ga0070662_100057781 3300005457 Unclassified 2820
39 Ga0070662_100089241 3300005457 Bacteria 2312
40 Ga0070662_100332301 3300005457 Unclassified 1242
41 Ga0068867_100001807 3300005459 Bacteria 14891
42 Ga0068867_100052454 3300005459 Unclassified 3010
43 Ga0070685_10192062 3300005466 Bacteria 1322
44 Ga0070685_10269968 3300005466 Unclassified 1135
45 Ga0070685_10603816 3300005466 Bacteria 790
46 Ga0070707_100215740 3300005468 Bacteria 1870
47 Ga0070698_100020190 3300005471 Bacteria 6986
48 Ga0070698_100680904 3300005471 Unclassified 970
49 Ga0070672_100032496 3300005543 Bacteria 3938
50 Ga0070672_100068873 3300005543 Bacteria 2808
51 Ga0070686_100160142 3300005544 Bacteria 1584
52 Ga0070695_100039370 3300005545 Bacteria 2988
53 Ga0070704_100126052 3300005549 Bacteria 1976
54 Ga0070704_100432930 3300005549 Unclassified 1129
55 Ga0070664_100315374 3300005564 Bacteria 1416
56 Ga0068857_100051519 3300005577 Unclassified 3653
57 Ga0068857_100153027 3300005577 Unclassified 2091
58 Ga0068859_100048538 3300005617 Bacteria 4264
59 Ga0068859_100225248 3300005617 Unclassified 1963
60 Ga0068859_100397755 3300005617 Bacteria 1473
61 Ga0068859_101213206 3300005617 Bacteria 831
62 Ga0068859_101762183 3300005617 Archaea 684
63 Ga0068866_10319595 3300005718 Bacteria 976
64 Ga0068861_100186676 3300005719 Unclassified 1730
65 Ga0068861_100264202 3300005719 Bacteria 1475
66 Ga0068861_100403312 3300005719 Archaea 1214
67 Ga0068870_10000592 3300005840 Bacteria 13792
68 Ga0068870_10044109 3300005840 Bacteria 2329
69 Ga0068863_100736999 3300005841 Bacteria 981
70 Ga0068862_100002885 3300005844 Bacteria 15044
71 Ga0068862_100005392 3300005844 Bacteria 10699
72 Ga0075432_10042962 3300006058 Bacteria 1583
73 Ga0068871_100249551 3300006358 Unclassified 1545
74 Ga0068871_100347523 3300006358 Unclassified 1311
75 Ga0068871_100481525 3300006358 Unclassified 1116
76 Ga0075428_100001326 3300006844 Bacteria 26221
77 Ga0075428_100109691 3300006844 Bacteria 3006
78 Ga0075428_100168868 3300006844 Bacteria 2372
79 Ga0075428_100250508 3300006844 Bacteria 1909
80 Ga0075428_100356216 3300006844 Bacteria 1570
81 Ga0075428_100671468 3300006844 Bacteria 1104
82 Ga0075428_101464908 3300006844 Unclassified 716
83 Ga0075430_100001560 3300006846 Bacteria 18746
84 Ga0075430_100036822 3300006846 Bacteria 4147
85 Ga0075430_100072323 3300006846 Unclassified 2892
86 Ga0075430_100140824 3300006846 Bacteria 2009
87 Ga0075430_100203465 3300006846 Bacteria 1644
88 Ga0075431_100003659 3300006847 Bacteria 14913
89 Ga0075431_100024673 3300006847 Bacteria 6165
90 Ga0075431_100097282 3300006847 Bacteria 3039
91 Ga0075431_100201612 3300006847 Bacteria 2035
92 Ga0075431_100215172 3300006847 Unclassified 1961
93 Ga0075433_10144408 3300006852 Unclassified 2115
94 Ga0075433_11022118 3300006852 Bacteria 720
95 Ga0075434_100004694 3300006871 Bacteria 12346
96 Ga0075429_100055255 3300006880 Unclassified 3455
97 Ga0075429_100065541 3300006880 Unclassified 3162
98 Ga0075429_100077719 3300006880 Unclassified 2892
99 Ga0075429_100085329 3300006880 Bacteria 2753
100 Ga0075429_100214065 3300006880 Unclassified 1688
101 Ga0068865_100758199 3300006881 Bacteria 834
102 Ga0097620_100048540 3300006931 Bacteria 4264
103 Ga0097620_100225251 3300006931 Unclassified 1963
104 Ga0097620_100397765 3300006931 Bacteria 1473
105 Ga0097620_100770336 3300006931 Bacteria 1051
106 Ga0097620_101213270 3300006931 Bacteria 831
107 Ga0097620_101762509 3300006931 Archaea 684
108 Ga0075435_100017219 3300007076 Bacteria 5464
109 Ga0111539_10001033 3300009094 Bacteria 36485
110 Ga0111539_10008361 3300009094 Bacteria 13167
111 Ga0111539_10014801 3300009094 Bacteria 9730
112 Ga0111539_10068870 3300009094 Bacteria 4178
113 Ga0111539_10100686 3300009094 Unclassified 3392
114 Ga0111539_10189730 3300009094 Unclassified 2399
115 Ga0111539_10335411 3300009094 Bacteria 1760
116 Ga0111539_10885256 3300009094 Bacteria 1039
117 Ga0114129_10145870 3300009147 Bacteria 3242
118 Ga0114129_10165428 3300009147 Bacteria 3019
119 Ga0114129_10168710 3300009147 Bacteria 2985
120 Ga0114129_10203067 3300009147 Bacteria 2683
121 Ga0114129_12207342 3300009147 Unclassified 662
122 Ga0105243_10237479 3300009148 Bacteria 1620
123 Ga0105243_10993366 3300009148 Bacteria 841
124 Ga0105243_11449735 3300009148 Unclassified 709
125 Ga0105242_10865207 3300009176 Bacteria 901
126 Ga0105242_11138395 3300009176 Bacteria 796
127 Ga0105242_12084353 3300009176 Bacteria 611
128 Ga0105248_10178299 3300009177 Bacteria 2395
129 Ga0105248_11473483 3300009177 Bacteria 770
130 Ga0105249_10005648 3300009553 Bacteria 10825
131 Ga0105249_10539625 3300009553 Bacteria 1216
132 Ga0157374_10025807 3300013296 Bacteria 5282
133 Ga0157378_10373711 3300013297 Unclassified 1398
134 Ga0163162_10965279 3300013306 Bacteria 963
135 Ga0157375_10009491 3300013308 Bacteria 8543
136 Ga0157375_11511254 3300013308 Unclassified 793
137 Ga0157375_11773481 3300013308 Unclassified 731
138 Ga0157375_12364008 3300013308 Archaea 634
139 Ga0157380_10024876 3300014326 Bacteria 4536
140 Ga0157380_10170426 3300014326 Unclassified 1902
141 Ga0157380_10183411 3300014326 Bacteria 1841
142 Ga0157380_10415812 3300014326 Bacteria 1281
143 Ga0157377_10023668 3300014745 Bacteria 3258
144 Ga0207653_10057164 3300025885 Unclassified 1309
145 Ga0207647_10313635 3300025904 Unclassified 891
146 Ga0207645_10031400 3300025907 Unclassified 3418
147 Ga0207643_10000979 3300025908 Bacteria 17142
148 Ga0207643_10051890 3300025908 Bacteria 2328
149 Ga0207660_10583027 3300025917 Unclassified 910
150 Ga0207662_10001870 3300025918 Bacteria 10352
151 Ga0207662_10090476 3300025918 Bacteria 1881
152 Ga0207657_10761437 3300025919 Unclassified 750
153 Ga0207681_10013169 3300025923 Bacteria 5113
154 Ga0207681_10240290 3300025923 Unclassified 1409
155 Ga0207650_11132772 3300025925 Bacteria 666
156 Ga0207659_10001383 3300025926 Bacteria 14470
157 Ga0207659_10009248 3300025926 Bacteria 6153
158 Ga0207659_10064752 3300025926 Bacteria 2647
159 Ga0207659_10148059 3300025926 Bacteria 1830
160 Ga0207659_10187158 3300025926 Bacteria 1645
161 Ga0207659_10381158 3300025926 Bacteria 1176
162 Ga0207706_10022872 3300025933 Bacteria 5609
163 Ga0207706_10378068 3300025933 Unclassified 1229
164 Ga0207709_10017291 3300025935 Bacteria 4024
165 Ga0207670_10011218 3300025936 Bacteria 5194
166 Ga0207670_10054746 3300025936 Bacteria 2693
167 Ga0207669_10037248 3300025937 Bacteria 2788
168 Ga0207669_10168879 3300025937 Bacteria 1555
169 Ga0207669_10280854 3300025937 Unclassified 1256
170 Ga0207704_10069445 3300025938 Unclassified 2226
171 Ga0207691_10044680 3300025940 Bacteria 4076
172 Ga0207691_10180139 3300025940 Bacteria 1847
173 Ga0207689_10052055 3300025942 Bacteria 3374
174 Ga0207689_10085971 3300025942 Unclassified 2585
175 Ga0207689_10093131 3300025942 Bacteria 2475
176 Ga0207651_10023970 3300025960 Bacteria 3765
177 Ga0207651_10976197 3300025960 Archaea 756
178 Ga0207712_10004018 3300025961 Bacteria 9290
179 Ga0207712_10656012 3300025961 Unclassified 912
180 Ga0207712_11217853 3300025961 Bacteria 672
181 Ga0207668_10151811 3300025972 Bacteria 1794
182 Ga0207668_10297190 3300025972 Bacteria 1331
183 Ga0207668_10682650 3300025972 Bacteria 901
184 Ga0207640_10100513 3300025981 Bacteria 2027
185 Ga0207677_10382876 3300026023 Unclassified 1188
186 Ga0207677_10662056 3300026023 Bacteria 923
187 Ga0207708_10058226 3300026075 Bacteria 2948
188 Ga0207708_10062965 3300026075 Unclassified 2834
189 Ga0207708_10441532 3300026075 Bacteria 1082
190 Ga0207708_10719922 3300026075 Unclassified 854
191 Ga0207641_11069947 3300026088 Unclassified 805
192 Ga0207648_10001577 3300026089 Bacteria 24995
193 Ga0207648_10838015 3300026089 Bacteria 857
194 Ga0207676_10261564 3300026095 Bacteria 1563
195 Ga0207676_10386696 3300026095 Unclassified 1304
196 Ga0207674_10028000 3300026116 Bacteria 5955
197 Ga0207674_10037062 3300026116 Bacteria 5074
198 Ga0207674_11219040 3300026116 Archaea 722
199 Ga0207674_11644517 3300026116 Unclassified 611
200 Ga0207675_100001310 3300026118 Bacteria 24930
201 Ga0207675_100616132 3300026118 Unclassified 1089
202 Ga0207683_10179733 3300026121 Bacteria 1918
203 Ga0209974_10109478 3300027876 Bacteria 971
204 Ga0207428_10003027 3300027907 Bacteria 16548
205 Ga0207428_10005576 3300027907 Bacteria 11705
206 Ga0207428_10014571 3300027907 Bacteria 6819
207 Ga0207428_10032357 3300027907 Bacteria 4302
208 Ga0207428_10064978 3300027907 Unclassified 2880
209 Ga0268265_10001704 3300028380 Bacteria 17888
210 Ga0307408_100002035 3300031548 Bacteria 14554
211 Ga0307408_100013047 3300031548 Bacteria 5512
212 Ga0307408_100923797 3300031548 Bacteria 800
213 Ga0307405_10005971 3300031731 Bacteria 5942
214 Ga0307405_10067262 3300031731 Bacteria 2288
215 Ga0307405_10091380 3300031731 Unclassified 2017
216 Ga0307405_10350193 3300031731 Bacteria 1139
217 Ga0307413_10075518 3300031824 Bacteria 2139
218 Ga0307413_10553281 3300031824 Unclassified 934
219 Ga0307410_10001753 3300031852 Bacteria 10033
220 Ga0307410_10370267 3300031852 Unclassified 1150
221 Ga0307410_10990263 3300031852 Bacteria 724
222 Ga0307410_11018738 3300031852 Unclassified 715
223 Ga0307407_10002997 3300031903 Bacteria 6784
224 Ga0307412_10005870 3300031911 Bacteria 6915
225 Ga0307412_10499214 3300031911 Bacteria 1013
226 Ga0307412_10595752 3300031911 Archaea 935
227 Ga0307409_100128711 3300031995 Bacteria 2159
228 Ga0307409_100182538 3300031995 Unclassified 1859
229 Ga0307409_100539264 3300031995 Unclassified 1143
230 Ga0307409_100938009 3300031995 Bacteria 881
231 Ga0307416_100189064 3300032002 Bacteria 1939
232 Ga0307416_100368527 3300032002 Bacteria 1461
233 Ga0307416_100531719 3300032002 Bacteria 1246
234 Ga0307411_10002325 3300032005 Bacteria 8351
235 Ga0307411_10041684 3300032005 Bacteria 2923
236 Ga0307411_10470581 3300032005 Unclassified 1056
237 Ga0307415_100017876 3300032126 Bacteria 4264
238 Ga0373948_0025329 3300034817 Unclassified 1163
239 Ga0373941_0382097 3300035115 Archaea 579
240 Ga0439433_0012187 3300041999 Unclassified 1885
241 Ga0439433_0057926 3300041999 Bacteria 921
242 Ga0439462_0024350 3300042015 Unclassified 1590
243 Ga0450923_029898 3300042125 Bacteria 1106
244 Ga0439434_0008784 3300042435 Bacteria 2968
245 Ga0439434_0027171 3300042435 Unclassified 1730
246 Ga0439435_0081410 3300042436 Bacteria 972
247 Ga0439444_0059275 3300042437 Unclassified 796
248 Ga0439440_0135693 3300042993 Unclassified 695
249 Ga0495629_0574474 3300046459 Bacteria 755
250 Ga0495658_0037810 3300046683 Bacteria 2670
251 Ga0495676_0866276 3300047321 Bacteria 580
252 Ga0501296_030837 3300049519 Unclassified 722
253 Ga0501299_093138 3300049522 Archaea 688
254 Ga0501036_0878950 3300049572 Bacteria 736
255 Ga0501036_1049852 3300049572 Unclassified 666
256 Ga0501039_0028741 3300049575 Bacteria 4281
257 Ga0501039_0084573 3300049575 Unclassified 2471
258 Ga0501040_0007557 3300049576 Bacteria 7029
259 Ga0501040_0091234 3300049576 Bacteria 2118
260 Ga0501041_0387578 3300049577 Unclassified 884
261 Ga0501042_0051935 3300049578 Unclassified 2924
262 Ga0501042_0110922 3300049578 Bacteria 1975
263 Ga0501042_0422482 3300049578 Bacteria 966
264 Ga0501046_0133923 3300049580 Bacteria 1878
265 Ga0501048_0013656 3300049582 Bacteria 6026
266 Ga0501048_0272529 3300049582 Bacteria 1203
267 Ga0501048_0613684 3300049582 Bacteria 781
268 Ga0501071_0077183 3300049587 Bacteria 2433
269 Ga0501072_0298540 3300049588 Unclassified 1281
270 Ga0501072_0607628 3300049588 Bacteria 862
271 Ga0501074_0091867 3300049590 Bacteria 2174
272 Ga0501075_0059974 3300049591 Unclassified 2867
273 Ga0501075_0100432 3300049591 Bacteria 2197
274 Ga0501075_0473972 3300049591 Bacteria 955
275 Ga0501076_0681827 3300049592 Bacteria 848
276 Ga0501077_0041368 3300049593 Unclassified 2934
277 Ga0501077_0149735 3300049593 Bacteria 1481
278 Ga0501216_056906 3300049660 Unclassified 780
279 Ga0501223_036772 3300049663 Unclassified 952
280 Ga0501249_022006 3300049679 Unclassified 1394
281 Ga0501225_0049052 3300049705 Bacteria 1173
282 Ga0501079_0067548 3300049741 Bacteria 2759
283 Ga0501079_0184122 3300049741 Unclassified 1630
284 Ga0501080_0479403 3300049742 Bacteria 1113
285 Ga0501081_0038947 3300049743 Unclassified 3251
286 Ga0501283_034844 3300049779 Unclassified 856
287 Ga0501035_0506005 3300049822 Unclassified 994
288 Ga0501045_0057110 3300049824 Unclassified 2856
289 Ga0501045_0193973 3300049824 Unclassified 1514
290 nmdc:mga00v17_270655_c1 3300050491 Bacteria 1102
291 nmdc:mga0k408_343135_c1 3300050493 Unclassified 890
292 nmdc:mga05p37_11019_c1 3300050507 Bacteria 10738
293 nmdc:mga05p37_309126_c1 3300050507 Bacteria 1874
294 nmdc:mga05p37_494120_c1 3300050507 Bacteria 1406
295 nmdc:mga05p37_499995_c1 3300050507 Unclassified 1396
296 nmdc:mga05p37_504696_c1 3300050507 Bacteria 1387
297 nmdc:mga05p37_89993_c1 3300050507 Bacteria 3782
298 nmdc:mga09592_101793_c1 3300050508 Unclassified 2461
299 nmdc:mga09592_1092054_c1 3300050508 Unclassified 663
300 nmdc:mga09592_145924_c1 3300050508 Bacteria 2040
301 nmdc:mga09592_216034_c1 3300050508 Unclassified 1661
302 nmdc:mga09592_225923_c1 3300050508 Bacteria 1622
303 nmdc:mga09592_29441_c1 3300050508 Unclassified 4567
304 nmdc:mga09592_493262_c1 3300050508 Bacteria 1055
305 nmdc:mga09592_747435_c1 3300050508 Unclassified 830
306 nmdc:mga0qj67_110324_c1 3300050509 Unclassified 2221
307 nmdc:mga0qj67_146566_c1 3300050509 Bacteria 1914
308 nmdc:mga0qj67_19217_c1 3300050509 Bacteria 5219
309 nmdc:mga0qj67_26818_c1 3300050509 Bacteria 4461
310 nmdc:mga0qj67_439723_c1 3300050509 Unclassified 1051
311 nmdc:mga06r32_155729_c1 3300050510 Unclassified 2266
312 nmdc:mga06r32_19615_c1 3300050510 Bacteria 6209
313 nmdc:mga06r32_232201_c1 3300050510 Bacteria 1833
314 nmdc:mga06r32_248210_c1 3300050510 Bacteria 1767
315 nmdc:mga06r32_265920_c1 3300050510 Unclassified 1702
316 nmdc:mga06r32_516189_c1 3300050510 Bacteria 1171
317 nmdc:mga06r32_637175_c1 3300050510 Bacteria 1035
318 nmdc:mga08y16_164527_c1 3300050511 Bacteria 2304
319 nmdc:mga08y16_2241_c1 3300050511 Bacteria 19824
320 nmdc:mga08y16_382557_c1 3300050511 Bacteria 1442
321 nmdc:mga08y16_445_c1 3300050511 Bacteria 38283
322 nmdc:mga08y16_69072_c1 3300050511 Bacteria 3684
323 nmdc:mga08y16_693695_c1 3300050511 Archaea 1019
324 nmdc:mga08y16_7225_c1 3300050511 Bacteria 11655
325 nmdc:mga0n895_372_c1 3300050512 Bacteria 30333
326 nmdc:mga0a205_129161_c1 3300050515 Bacteria 2427
327 nmdc:mga0a205_153512_c1 3300050515 Bacteria 2201
328 nmdc:mga0a205_312_c1 3300050515 Bacteria 36141
329 Ga0501084_0072886 3300054114 Bacteria 2876
330 Ga0501084_0127962 3300054114 Bacteria 2138
331 Ga0590071_000678 3300059421 Bacteria 9665
332 Ga0590077_000535 3300059426 Bacteria 10510
333 Ga0590077_004059 3300059426 Archaea 3015
334 Ga0501082_0070752 3300060353 Unclassified 3004
335 Ga0501082_0175754 3300060353 Bacteria 1862
336 Ga0501082_0579322 3300060353 Bacteria 982
337 Ga0530510_0008601 3300061734 Bacteria 7131
338 Ga0530510_0012854 3300061734 Bacteria 5886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10993366 Ga0105243_109933661 162
2 3300009176 Ga0105242_11138395 Ga0105242_111383951 162
3 3300026089 Ga0207648_10838015 Ga0207648_108380151 162
4 3300005336 Ga0070680_100634381 Ga0070680_1006343812 163
5 3300005459 Ga0068867_100052454 Ga0068867_1000524542 163
6 3300025917 Ga0207660_10583027 Ga0207660_105830272 163
7 3300042436 Ga0439435_0081410 Ga0439435_0081410_201_725 163
8 3300005334 Ga0068869_101062449 Ga0068869_1010624491 164
9 3300005353 Ga0070669_101148869 Ga0070669_1011488691 167
10 3300006846 Ga0075430_100203465 Ga0075430_1002034653 167
11 3300006880 Ga0075429_100077719 Ga0075429_1000777191 167
12 3300025925 Ga0207650_11132772 Ga0207650_111327721 167
13 3300050509 nmdc:mga0qj67_439723_c1 nmdc:mga0qj67_439723_c1_481_993 167
14 3300005445 Ga0070708_100328802 Ga0070708_1003288022 168
15 3300005456 Ga0070678_100989972 Ga0070678_1009899721 168
16 3300006844 Ga0075428_100671468 Ga0075428_1006714682 168
17 3300006844 Ga0075428_101464908 Ga0075428_1014649081 168
18 3300006846 Ga0075430_100072323 Ga0075430_1000723233 168
19 3300006847 Ga0075431_100201612 Ga0075431_1002016123 168
20 3300006852 Ga0075433_10144408 Ga0075433_101444082 168
21 3300006871 Ga0075434_100004694 Ga0075434_10000469410 168
22 3300006880 Ga0075429_100065541 Ga0075429_1000655412 168
23 3300007076 Ga0075435_100017219 Ga0075435_1000172193 168
24 3300009147 Ga0114129_10145870 Ga0114129_101458702 168
25 3300031852 Ga0307410_11018738 Ga0307410_110187381 168
26 3300042993 Ga0439440_0135693 Ga0439440_0135693_83_604 168
27 3300049572 Ga0501036_1049852 Ga0501036_1049852_96_617 168
28 3300049582 Ga0501048_0613684 Ga0501048_0613684_86_703 168
29 3300050507 nmdc:mga05p37_309126_c1 nmdc:mga05p37_309126_c1_829_1344 168
30 3300050508 nmdc:mga09592_29441_c1 nmdc:mga09592_29441_c1_502_1017 168
31 3300050509 nmdc:mga0qj67_110324_c1 nmdc:mga0qj67_110324_c1_995_1510 168
32 3300050510 nmdc:mga06r32_232201_c1 nmdc:mga06r32_232201_c1_376_891 168
33 3300050510 nmdc:mga06r32_265920_c1 nmdc:mga06r32_265920_c1_475_990 168
34 3300050512 nmdc:mga0n895_372_c1 nmdc:mga0n895_372_c1_8029_8544 168
35 3300050515 nmdc:mga0a205_312_c1 nmdc:mga0a205_312_c1_24579_25094 168
36 3300005295 Ga0065707_10236718 Ga0065707_102367182 169
37 3300005295 Ga0065707_10878050 Ga0065707_108780501 169
38 3300005336 Ga0070680_100522991 Ga0070680_1005229911 169
39 3300005336 Ga0070680_100527872 Ga0070680_1005278721 169
40 3300005340 Ga0070689_100166529 Ga0070689_1001665292 169
41 3300005347 Ga0070668_100105418 Ga0070668_1001054182 169
42 3300005353 Ga0070669_100021630 Ga0070669_1000216303 169
43 3300005354 Ga0070675_100037255 Ga0070675_1000372552 169
44 3300005354 Ga0070675_100115211 Ga0070675_1001152112 169
45 3300005354 Ga0070675_100426159 Ga0070675_1004261592 169
46 3300005364 Ga0070673_100237846 Ga0070673_1002378462 169
47 3300005364 Ga0070673_100772156 Ga0070673_1007721562 169
48 3300005365 Ga0070688_100044284 Ga0070688_1000442843 169
49 3300005365 Ga0070688_101040981 Ga0070688_1010409811 169
50 3300005441 Ga0070700_100036688 Ga0070700_1000366882 169
51 3300005444 Ga0070694_100075184 Ga0070694_1000751842 169
52 3300005457 Ga0070662_100089241 Ga0070662_1000892413 169
53 3300005466 Ga0070685_10192062 Ga0070685_101920621 169
54 3300005468 Ga0070707_100215740 Ga0070707_1002157403 169
55 3300005471 Ga0070698_100680904 Ga0070698_1006809041 169
56 3300005543 Ga0070672_100068873 Ga0070672_1000688733 169
57 3300005545 Ga0070695_100039370 Ga0070695_1000393704 169
58 3300005549 Ga0070704_100126052 Ga0070704_1001260524 169
59 3300005549 Ga0070704_100432930 Ga0070704_1004329302 169
60 3300005617 Ga0068859_100225248 Ga0068859_1002252482 169
61 3300005617 Ga0068859_100397755 Ga0068859_1003977552 169
62 3300005617 Ga0068859_101213206 Ga0068859_1012132061 169
63 3300005617 Ga0068859_101762183 Ga0068859_1017621832 169
64 3300005718 Ga0068866_10319595 Ga0068866_103195952 169
65 3300005719 Ga0068861_100264202 Ga0068861_1002642021 169
66 3300005719 Ga0068861_100403312 Ga0068861_1004033121 169
67 3300005841 Ga0068863_100736999 Ga0068863_1007369991 169
68 3300005844 Ga0068862_100005392 Ga0068862_10000539213 169
69 3300006358 Ga0068871_100347523 Ga0068871_1003475232 169
70 3300006844 Ga0075428_100109691 Ga0075428_1001096912 169
71 3300006844 Ga0075428_100168868 Ga0075428_1001688681 169
72 3300006846 Ga0075430_100036822 Ga0075430_1000368223 169
73 3300006846 Ga0075430_100140824 Ga0075430_1001408242 169
74 3300006847 Ga0075431_100097282 Ga0075431_1000972822 169
75 3300006847 Ga0075431_100215172 Ga0075431_1002151722 169
76 3300006852 Ga0075433_11022118 Ga0075433_110221182 169
77 3300006880 Ga0075429_100085329 Ga0075429_1000853292 169
78 3300006880 Ga0075429_100214065 Ga0075429_1002140654 169
79 3300006881 Ga0068865_100758199 Ga0068865_1007581992 169
80 3300006931 Ga0097620_100225251 Ga0097620_1002252512 169
81 3300006931 Ga0097620_100397765 Ga0097620_1003977652 169
82 3300006931 Ga0097620_101213270 Ga0097620_1012132701 169
83 3300006931 Ga0097620_101762509 Ga0097620_1017625092 169
84 3300009094 Ga0111539_10001033 Ga0111539_1000103319 169
85 3300009094 Ga0111539_10008361 Ga0111539_100083619 169
86 3300009094 Ga0111539_10068870 Ga0111539_100688703 169
87 3300009094 Ga0111539_10100686 Ga0111539_101006862 169
88 3300009094 Ga0111539_10885256 Ga0111539_108852562 169
89 3300009147 Ga0114129_10165428 Ga0114129_101654286 169
90 3300009147 Ga0114129_10203067 Ga0114129_102030672 169
91 3300009176 Ga0105242_10865207 Ga0105242_108652072 169
92 3300009177 Ga0105248_11473483 Ga0105248_114734831 169
93 3300013308 Ga0157375_11511254 Ga0157375_115112542 169
94 3300013308 Ga0157375_11773481 Ga0157375_117734811 169
95 3300013308 Ga0157375_12364008 Ga0157375_123640081 169
96 3300014326 Ga0157380_10024876 Ga0157380_100248765 169
97 3300014326 Ga0157380_10415812 Ga0157380_104158122 169
98 3300014745 Ga0157377_10023668 Ga0157377_100236682 169
99 3300025918 Ga0207662_10090476 Ga0207662_100904762 169
100 3300025926 Ga0207659_10009248 Ga0207659_100092482 169
101 3300025926 Ga0207659_10064752 Ga0207659_100647523 169
102 3300025926 Ga0207659_10148059 Ga0207659_101480592 169
103 3300025926 Ga0207659_10381158 Ga0207659_103811582 169
104 3300025933 Ga0207706_10378068 Ga0207706_103780682 169
105 3300025936 Ga0207670_10054746 Ga0207670_100547463 169
106 3300025937 Ga0207669_10168879 Ga0207669_101688792 169
107 3300025940 Ga0207691_10180139 Ga0207691_101801392 169
108 3300025942 Ga0207689_10052055 Ga0207689_100520554 169
109 3300025960 Ga0207651_10023970 Ga0207651_100239703 169
110 3300025960 Ga0207651_10976197 Ga0207651_109761971 169
111 3300025961 Ga0207712_10656012 Ga0207712_106560121 169
112 3300025972 Ga0207668_10151811 Ga0207668_101518113 169
113 3300025972 Ga0207668_10297190 Ga0207668_102971901 169
114 3300026023 Ga0207677_10662056 Ga0207677_106620562 169
115 3300026075 Ga0207708_10058226 Ga0207708_100582262 169
116 3300026075 Ga0207708_10441532 Ga0207708_104415322 169
117 3300026088 Ga0207641_11069947 Ga0207641_110699471 169
118 3300026095 Ga0207676_10261564 Ga0207676_102615641 169
119 3300026116 Ga0207674_11219040 Ga0207674_112190401 169
120 3300026116 Ga0207674_11644517 Ga0207674_116445171 169
121 3300026118 Ga0207675_100616132 Ga0207675_1006161321 169
122 3300027876 Ga0209974_10109478 Ga0209974_101094781 169
123 3300027907 Ga0207428_10003027 Ga0207428_100030276 169
124 3300027907 Ga0207428_10032357 Ga0207428_100323573 169
125 3300027907 Ga0207428_10064978 Ga0207428_100649784 169
126 3300031824 Ga0307413_10553281 Ga0307413_105532812 169
127 3300031852 Ga0307410_10370267 Ga0307410_103702672 169
128 3300031852 Ga0307410_10990263 Ga0307410_109902631 169
129 3300031995 Ga0307409_100182538 Ga0307409_1001825382 169
130 3300031995 Ga0307409_100539264 Ga0307409_1005392642 169
131 3300031995 Ga0307409_100938009 Ga0307409_1009380092 169
132 3300032005 Ga0307411_10470581 Ga0307411_104705811 169
133 3300034817 Ga0373948_0025329 Ga0373948_0025329_621_1139 169
134 3300035115 Ga0373941_0382097 Ga0373941_0382097_11_529 169
135 3300041999 Ga0439433_0012187 Ga0439433_0012187_748_1266 169
136 3300042125 Ga0450923_029898 Ga0450923_029898_516_1034 169
137 3300042435 Ga0439434_0027171 Ga0439434_0027171_578_1096 169
138 3300047321 Ga0495676_0866276 Ga0495676_0866276_13_531 169
139 3300049519 Ga0501296_030837 Ga0501296_030837_146_664 169
140 3300049572 Ga0501036_0878950 Ga0501036_0878950_38_556 169
141 3300049578 Ga0501042_0422482 Ga0501042_0422482_194_712 169
142 3300049582 Ga0501048_0272529 Ga0501048_0272529_110_628 169
143 3300049587 Ga0501071_0077183 Ga0501071_0077183_158_679 169
144 3300049590 Ga0501074_0091867 Ga0501074_0091867_1299_1817 169
145 3300049591 Ga0501075_0473972 Ga0501075_0473972_34_552 169
146 3300049592 Ga0501076_0681827 Ga0501076_0681827_146_667 169
147 3300049593 Ga0501077_0149735 Ga0501077_0149735_528_1046 169
148 3300049660 Ga0501216_056906 Ga0501216_056906_47_565 169
149 3300049663 Ga0501223_036772 Ga0501223_036772_143_661 169
150 3300049679 Ga0501249_022006 Ga0501249_022006_353_871 169
151 3300049705 Ga0501225_0049052 Ga0501225_0049052_533_1051 169
152 3300049779 Ga0501283_034844 Ga0501283_034844_94_612 169
153 3300050507 nmdc:mga05p37_11019_c1 nmdc:mga05p37_11019_c1_3699_4217 169
154 3300050507 nmdc:mga05p37_494120_c1 nmdc:mga05p37_494120_c1_155_673 169
155 3300050507 nmdc:mga05p37_504696_c1 nmdc:mga05p37_504696_c1_430_948 169
156 3300050507 nmdc:mga05p37_89993_c1 nmdc:mga05p37_89993_c1_2533_3051 169
157 3300050508 nmdc:mga09592_101793_c1 nmdc:mga09592_101793_c1_1317_1835 169
158 3300050508 nmdc:mga09592_145924_c1 nmdc:mga09592_145924_c1_1050_1568 169
159 3300050508 nmdc:mga09592_216034_c1 nmdc:mga09592_216034_c1_195_713 169
160 3300050508 nmdc:mga09592_225923_c1 nmdc:mga09592_225923_c1_608_1126 169
161 3300050509 nmdc:mga0qj67_146566_c1 nmdc:mga0qj67_146566_c1_105_623 169
162 3300050510 nmdc:mga06r32_155729_c1 nmdc:mga06r32_155729_c1_1170_1688 169
163 3300050510 nmdc:mga06r32_516189_c1 nmdc:mga06r32_516189_c1_49_567 169
164 3300050510 nmdc:mga06r32_637175_c1 nmdc:mga06r32_637175_c1_14_532 169
165 3300050511 nmdc:mga08y16_164527_c1 nmdc:mga08y16_164527_c1_1051_1569 169
166 3300050511 nmdc:mga08y16_445_c1 nmdc:mga08y16_445_c1_18104_18622 169
167 3300050511 nmdc:mga08y16_69072_c1 nmdc:mga08y16_69072_c1_2880_3398 169
168 3300050511 nmdc:mga08y16_693695_c1 nmdc:mga08y16_693695_c1_346_864 169
169 3300050515 nmdc:mga0a205_129161_c1 nmdc:mga0a205_129161_c1_160_678 169
170 3300050515 nmdc:mga0a205_153512_c1 nmdc:mga0a205_153512_c1_918_1436 169
171 3300054114 Ga0501084_0127962 Ga0501084_0127962_1267_1785 169
172 3300059421 Ga0590071_000678 Ga0590071_000678_4982_5500 169
173 3300059426 Ga0590077_000535 Ga0590077_000535_4073_4591 169
174 3300059426 Ga0590077_004059 Ga0590077_004059_2196_2756 169
175 3300060353 Ga0501082_0579322 Ga0501082_0579322_106_624 169
176 3300009147 Ga0114129_10168710 Ga0114129_101687105 170
177 3300009176 Ga0105242_12084353 Ga0105242_120843531 170
178 3300049575 Ga0501039_0084573 Ga0501039_0084573_793_1320 170
179 3300049576 Ga0501040_0007557 Ga0501040_0007557_1314_1841 170
180 3300049578 Ga0501042_0051935 Ga0501042_0051935_1769_2296 170
181 3300049582 Ga0501048_0013656 Ga0501048_0013656_4532_5059 170
182 3300049588 Ga0501072_0607628 Ga0501072_0607628_143_661 170
183 3300049591 Ga0501075_0059974 Ga0501075_0059974_1839_2366 170
184 3300049593 Ga0501077_0041368 Ga0501077_0041368_1622_2149 170
185 3300049741 Ga0501079_0184122 Ga0501079_0184122_470_997 170
186 3300049743 Ga0501081_0038947 Ga0501081_0038947_1779_2306 170
187 3300049822 Ga0501035_0506005 Ga0501035_0506005_137_658 170
188 3300049824 Ga0501045_0057110 Ga0501045_0057110_1945_2472 170
189 3300060353 Ga0501082_0070752 Ga0501082_0070752_1779_2306 170
190 3300061734 Ga0530510_0012854 Ga0530510_0012854_1657_2184 170
191 3300005293 Ga0065715_10115089 Ga0065715_101150892 171
192 3300005295 Ga0065707_10394504 Ga0065707_103945042 171
193 3300005331 Ga0070670_100036223 Ga0070670_1000362232 171
194 3300005339 Ga0070660_100954734 Ga0070660_1009547341 171
195 3300005347 Ga0070668_100129130 Ga0070668_1001291304 171
196 3300005353 Ga0070669_100016667 Ga0070669_1000166675 171
197 3300005354 Ga0070675_100000624 Ga0070675_10000062418 171
198 3300005356 Ga0070674_100033673 Ga0070674_1000336736 171
199 3300005356 Ga0070674_100344237 Ga0070674_1003442372 171
200 3300005365 Ga0070688_100221308 Ga0070688_1002213082 171
201 3300005406 Ga0070703_10010124 Ga0070703_100101243 171
202 3300005438 Ga0070701_10008116 Ga0070701_100081163 171
203 3300005440 Ga0070705_100035975 Ga0070705_1000359753 171
204 3300005441 Ga0070700_100163976 Ga0070700_1001639761 171
205 3300005444 Ga0070694_100013544 Ga0070694_1000135444 171
206 3300005456 Ga0070678_100316957 Ga0070678_1003169572 171
207 3300005457 Ga0070662_100057781 Ga0070662_1000577812 171
208 3300005457 Ga0070662_100332301 Ga0070662_1003323012 171
209 3300005459 Ga0068867_100001807 Ga0068867_1000018077 171
210 3300005466 Ga0070685_10269968 Ga0070685_102699682 171
211 3300005466 Ga0070685_10603816 Ga0070685_106038161 171
212 3300005471 Ga0070698_100020190 Ga0070698_1000201904 171
213 3300005543 Ga0070672_100032496 Ga0070672_1000324963 171
214 3300005544 Ga0070686_100160142 Ga0070686_1001601422 171
215 3300005564 Ga0070664_100315374 Ga0070664_1003153742 171
216 3300005577 Ga0068857_100051519 Ga0068857_1000515193 171
217 3300005577 Ga0068857_100153027 Ga0068857_1001530272 171
218 3300005617 Ga0068859_100048538 Ga0068859_1000485384 171
219 3300005719 Ga0068861_100186676 Ga0068861_1001866762 171
220 3300005840 Ga0068870_10000592 Ga0068870_100005926 171
221 3300005840 Ga0068870_10044109 Ga0068870_100441092 171
222 3300005844 Ga0068862_100002885 Ga0068862_1000028857 171
223 3300006058 Ga0075432_10042962 Ga0075432_100429622 171
224 3300006358 Ga0068871_100249551 Ga0068871_1002495512 171
225 3300006358 Ga0068871_100481525 Ga0068871_1004815252 171
226 3300006844 Ga0075428_100001326 Ga0075428_10000132610 171
227 3300006844 Ga0075428_100250508 Ga0075428_1002505082 171
228 3300006844 Ga0075428_100356216 Ga0075428_1003562162 171
229 3300006846 Ga0075430_100001560 Ga0075430_1000015605 171
230 3300006847 Ga0075431_100003659 Ga0075431_1000036594 171
231 3300006847 Ga0075431_100024673 Ga0075431_1000246736 171
232 3300006880 Ga0075429_100055255 Ga0075429_1000552552 171
233 3300006931 Ga0097620_100048540 Ga0097620_1000485404 171
234 3300006931 Ga0097620_100770336 Ga0097620_1007703362 171
235 3300009094 Ga0111539_10014801 Ga0111539_100148018 171
236 3300009094 Ga0111539_10189730 Ga0111539_101897303 171
237 3300009094 Ga0111539_10335411 Ga0111539_103354112 171
238 3300009147 Ga0114129_12207342 Ga0114129_122073421 171
239 3300009148 Ga0105243_10237479 Ga0105243_102374792 171
240 3300009148 Ga0105243_11449735 Ga0105243_114497351 171
241 3300009177 Ga0105248_10178299 Ga0105248_101782992 171
242 3300009553 Ga0105249_10005648 Ga0105249_100056484 171
243 3300009553 Ga0105249_10539625 Ga0105249_105396252 171
244 3300013296 Ga0157374_10025807 Ga0157374_100258072 171
245 3300013297 Ga0157378_10373711 Ga0157378_103737112 171
246 3300013306 Ga0163162_10965279 Ga0163162_109652791 171
247 3300013308 Ga0157375_10009491 Ga0157375_100094914 171
248 3300014326 Ga0157380_10170426 Ga0157380_101704263 171
249 3300014326 Ga0157380_10183411 Ga0157380_101834112 171
250 3300025885 Ga0207653_10057164 Ga0207653_100571641 171
251 3300025904 Ga0207647_10313635 Ga0207647_103136352 171
252 3300025907 Ga0207645_10031400 Ga0207645_100314002 171
253 3300025908 Ga0207643_10000979 Ga0207643_100009796 171
254 3300025908 Ga0207643_10051890 Ga0207643_100518902 171
255 3300025918 Ga0207662_10001870 Ga0207662_100018704 171
256 3300025919 Ga0207657_10761437 Ga0207657_107614371 171
257 3300025923 Ga0207681_10013169 Ga0207681_100131692 171
258 3300025923 Ga0207681_10240290 Ga0207681_102402902 171
259 3300025926 Ga0207659_10001383 Ga0207659_100013832 171
260 3300025926 Ga0207659_10187158 Ga0207659_101871582 171
261 3300025933 Ga0207706_10022872 Ga0207706_100228724 171
262 3300025935 Ga0207709_10017291 Ga0207709_100172913 171
263 3300025936 Ga0207670_10011218 Ga0207670_100112182 171
264 3300025937 Ga0207669_10037248 Ga0207669_100372482 171
265 3300025937 Ga0207669_10280854 Ga0207669_102808542 171
266 3300025938 Ga0207704_10069445 Ga0207704_100694452 171
267 3300025940 Ga0207691_10044680 Ga0207691_100446803 171
268 3300025942 Ga0207689_10085971 Ga0207689_100859712 171
269 3300025942 Ga0207689_10093131 Ga0207689_100931312 171
270 3300025961 Ga0207712_10004018 Ga0207712_100040182 171
271 3300025961 Ga0207712_11217853 Ga0207712_112178531 171
272 3300025972 Ga0207668_10682650 Ga0207668_106826502 171
273 3300025981 Ga0207640_10100513 Ga0207640_101005132 171
274 3300026023 Ga0207677_10382876 Ga0207677_103828762 171
275 3300026075 Ga0207708_10062965 Ga0207708_100629653 171
276 3300026075 Ga0207708_10719922 Ga0207708_107199221 171
277 3300026089 Ga0207648_10001577 Ga0207648_100015774 171
278 3300026095 Ga0207676_10386696 Ga0207676_103866962 171
279 3300026116 Ga0207674_10028000 Ga0207674_100280004 171
280 3300026116 Ga0207674_10037062 Ga0207674_100370623 171
281 3300026118 Ga0207675_100001310 Ga0207675_10000131015 171
282 3300026121 Ga0207683_10179733 Ga0207683_101797332 171
283 3300027907 Ga0207428_10005576 Ga0207428_100055767 171
284 3300027907 Ga0207428_10014571 Ga0207428_100145713 171
285 3300028380 Ga0268265_10001704 Ga0268265_100017048 171
286 3300031548 Ga0307408_100002035 Ga0307408_10000203510 171
287 3300031548 Ga0307408_100013047 Ga0307408_1000130472 171
288 3300031548 Ga0307408_100923797 Ga0307408_1009237972 171
289 3300031731 Ga0307405_10005971 Ga0307405_100059713 171
290 3300031731 Ga0307405_10067262 Ga0307405_100672623 171
291 3300031731 Ga0307405_10091380 Ga0307405_100913802 171
292 3300031731 Ga0307405_10350193 Ga0307405_103501932 171
293 3300031824 Ga0307413_10075518 Ga0307413_100755182 171
294 3300031852 Ga0307410_10001753 Ga0307410_1000175310 171
295 3300031903 Ga0307407_10002997 Ga0307407_100029973 171
296 3300031911 Ga0307412_10005870 Ga0307412_100058705 171
297 3300031911 Ga0307412_10499214 Ga0307412_104992141 171
298 3300031911 Ga0307412_10595752 Ga0307412_105957522 171
299 3300031995 Ga0307409_100128711 Ga0307409_1001287112 171
300 3300032002 Ga0307416_100189064 Ga0307416_1001890641 171
301 3300032002 Ga0307416_100368527 Ga0307416_1003685271 171
302 3300032002 Ga0307416_100531719 Ga0307416_1005317192 171
303 3300032005 Ga0307411_10002325 Ga0307411_1000232510 171
304 3300032005 Ga0307411_10041684 Ga0307411_100416842 171
305 3300032126 Ga0307415_100017876 Ga0307415_1000178763 171
306 3300041999 Ga0439433_0057926 Ga0439433_0057926_193_723 171
307 3300042015 Ga0439462_0024350 Ga0439462_0024350_742_1272 171
308 3300042435 Ga0439434_0008784 Ga0439434_0008784_1936_2466 171
309 3300042437 Ga0439444_0059275 Ga0439444_0059275_65_601 171
310 3300046459 Ga0495629_0574474 Ga0495629_0574474_42_566 171
311 3300046683 Ga0495658_0037810 Ga0495658_0037810_1911_2435 171
312 3300049522 Ga0501299_093138 Ga0501299_093138_120_656 171
313 3300049575 Ga0501039_0028741 Ga0501039_0028741_2770_3318 171
314 3300049576 Ga0501040_0091234 Ga0501040_0091234_1330_1878 171
315 3300049577 Ga0501041_0387578 Ga0501041_0387578_226_774 171
316 3300049578 Ga0501042_0110922 Ga0501042_0110922_739_1287 171
317 3300049580 Ga0501046_0133923 Ga0501046_0133923_1126_1674 171
318 3300049588 Ga0501072_0298540 Ga0501072_0298540_220_768 171
319 3300049591 Ga0501075_0100432 Ga0501075_0100432_1476_2024 171
320 3300049741 Ga0501079_0067548 Ga0501079_0067548_1103_1651 171
321 3300049742 Ga0501080_0479403 Ga0501080_0479403_77_625 171
322 3300049824 Ga0501045_0193973 Ga0501045_0193973_580_1116 171
323 3300050491 nmdc:mga00v17_270655_c1 nmdc:mga00v17_270655_c1_479_1009 171
324 3300050493 nmdc:mga0k408_343135_c1 nmdc:mga0k408_343135_c1_207_743 171
325 3300050507 nmdc:mga05p37_499995_c1 nmdc:mga05p37_499995_c1_33_566 171
326 3300050508 nmdc:mga09592_1092054_c1 nmdc:mga09592_1092054_c1_113_643 171
327 3300050508 nmdc:mga09592_493262_c1 nmdc:mga09592_493262_c1_110_625 171
328 3300050508 nmdc:mga09592_747435_c1 nmdc:mga09592_747435_c1_112_627 171
329 3300050509 nmdc:mga0qj67_19217_c1 nmdc:mga0qj67_19217_c1_2444_2977 171
330 3300050509 nmdc:mga0qj67_26818_c1 nmdc:mga0qj67_26818_c1_2959_3489 171
331 3300050510 nmdc:mga06r32_19615_c1 nmdc:mga06r32_19615_c1_2314_2835 171
332 3300050510 nmdc:mga06r32_248210_c1 nmdc:mga06r32_248210_c1_1174_1722 171
333 3300050511 nmdc:mga08y16_2241_c1 nmdc:mga08y16_2241_c1_15707_16222 171
334 3300050511 nmdc:mga08y16_382557_c1 nmdc:mga08y16_382557_c1_652_1176 171
335 3300050511 nmdc:mga08y16_7225_c1 nmdc:mga08y16_7225_c1_6877_7410 171
336 3300054114 Ga0501084_0072886 Ga0501084_0072886_1417_1965 171
337 3300060353 Ga0501082_0175754 Ga0501082_0175754_826_1374 171
338 3300061734 Ga0530510_0008601 Ga0530510_0008601_3115_3663 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05099

TerB

Tellurite resistance protein TerB

75

194

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h5n-assembly1.cif.gz_A crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.7284 36 160
2h5n-assembly1.cif.gz_C crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.7206 36 160
2h5n-assembly1.cif.gz_B crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.7109 37 155
2ou3-assembly1.cif.gz_B crystal structure of a tellurite resistance protein of cog3793 (npun_f6341) from nostoc punctiforme pcc 73102 at 1.85 a resolution 0.6969 38 160
2h5n-assembly1.cif.gz_C crystal structure of protein of unknown function pg1108 from porphyromonas gingivalis w83 0.6769 36 160
ID Description Score Start End Superfamily
af_P31680_36_183_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7318 20 160 1.10.3680.10
2h5nA01 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7312 36 160 1.10.3680.10
2h5nA01 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.7105 36 160 1.10.3680.10
af_P31680_36_183_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.6843 20 160 1.10.3680.10
af_Q91WU4_1_181_1.10.3680.10 Mainly Alpha;Orthogonal Bundle;TerB-like;TerB-like 0.5129 11 160 1.10.3680.10
ID Description Score Start End GO Terms
AF-A0A535VRG5-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9954 31 163
AF-A0A7C2SAB0-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9878 20 163
AF-A0A382CU70-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9874 39 164
AF-A0A6L7WKB9-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9721 55 163
AF-A0A0B4C2F6-F1-model_v4 Co-chaperone DjlA N-terminal domain-containing protein 0.9647 37 160

Feature Viewer

pLDDT pTM Quality
84.64 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map