F413700

General Info

Members Datasets Scaffolds Average Seq Length
338 215 676 131

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0108937|Ga0496122_0108937_23_436
Length 137
Sequence VRDKKMSRQQVFTGSPWEPLVGYCRAIRVGNRVEVAGTTAMQDGVVVGAGDPYVQTKFILQTIEKALKELGADMADVVRTRMFVTDITQWEEVGRAHGEFFGQIQPAATMVEVNALIDPLLMVEIEAEAIIDTSEEV

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
198 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
199 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
200 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
201 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
202 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
203 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
204 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
205 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
206 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
207 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
208 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
209 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
210 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
211 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
212 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
213 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
214 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
215 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 0
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0.3
Rhizoplane 1.18
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 14.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0108937 3300048925 Bacteria 1825
2 MBSR1b_contig_10352852 2162886012 Bacteria 1715
3 JGI25406J46586_10034966 3300003203 Unclassified 1838
4 rootH1_10016221 3300003316 Bacteria 1411
5 Ga0070690_100739462 3300005330 Unclassified 758
6 Ga0070670_100022639 3300005331 Bacteria 5408
7 Ga0068869_100003817 3300005334 Bacteria 9292
8 Ga0070666_10054367 3300005335 Bacteria 2701
9 Ga0070680_100063773 3300005336 Bacteria 3019
10 Ga0070680_100686166 3300005336 Bacteria 881
11 Ga0068868_100341066 3300005338 Bacteria 1281
12 Ga0070691_10522927 3300005341 Unclassified 689
13 Ga0070661_100151681 3300005344 Bacteria 1752
14 Ga0070668_100097451 3300005347 Bacteria 2326
15 Ga0070669_100000032 3300005353 Bacteria 153549
16 Ga0070669_100306721 3300005353 Unclassified 1278
17 Ga0070675_100000385 3300005354 Bacteria 29879
18 Ga0070675_100436644 3300005354 Bacteria 1172
19 Ga0070675_100619649 3300005354 Bacteria 982
20 Ga0070674_100002612 3300005356 Bacteria 9966
21 Ga0070674_100086275 3300005356 Bacteria 2254
22 Ga0070674_100119931 3300005356 Bacteria 1946
23 Ga0070673_100030665 3300005364 Bacteria 4028
24 Ga0070673_100090553 3300005364 Bacteria 2499
25 Ga0070673_100342130 3300005364 Bacteria 1326
26 Ga0070667_100052890 3300005367 Bacteria 3427
27 Ga0070703_10043160 3300005406 Bacteria 1413
28 Ga0070711_100202064 3300005439 Unclassified 1534
29 Ga0070705_100002149 3300005440 Bacteria 10020
30 Ga0070708_101670997 3300005445 Unclassified 592
31 Ga0070663_100039766 3300005455 Bacteria 3289
32 Ga0070663_101021720 3300005455 Bacteria 720
33 Ga0070663_101401591 3300005455 Bacteria 619
34 Ga0070678_100021852 3300005456 Bacteria 4229
35 Ga0070678_100590190 3300005456 Bacteria 991
36 Ga0070662_100000040 3300005457 Bacteria 73497
37 Ga0070681_10260524 3300005458 Unclassified 1646
38 Ga0068867_100000144 3300005459 Bacteria 45710
39 Ga0068867_100753641 3300005459 Bacteria 864
40 Ga0070685_10560054 3300005466 Unclassified 817
41 Ga0070706_100001919 3300005467 Bacteria 21420
42 Ga0070706_101970209 3300005467 Bacteria 529
43 Ga0070707_100150654 3300005468 Bacteria 2265
44 Ga0070707_100220829 3300005468 Bacteria 1846
45 Ga0070698_100011471 3300005471 Bacteria 9404
46 Ga0070698_100156728 3300005471 Bacteria 2223
47 Ga0070698_101939439 3300005471 Unclassified 542
48 Ga0070699_100194791 3300005518 Bacteria 1801
49 Ga0070679_101206250 3300005530 Bacteria 702
50 Ga0070697_101005754 3300005536 Bacteria 741
51 Ga0070697_101084045 3300005536 Bacteria 713
52 Ga0068853_100090470 3300005539 Bacteria 2690
53 Ga0070672_100031147 3300005543 Bacteria 4013
54 Ga0070672_100493747 3300005543 Bacteria 1058
55 Ga0070686_100022322 3300005544 Bacteria 3768
56 Ga0070695_100000533 3300005545 Bacteria 20122
57 Ga0070695_100748240 3300005545 Bacteria 779
58 Ga0070696_100083249 3300005546 Bacteria 2269
59 Ga0070693_101133048 3300005547 Bacteria 598
60 Ga0070665_100973755 3300005548 Bacteria 861
61 Ga0068855_100097773 3300005563 Bacteria 3382
62 Ga0068855_101576434 3300005563 Unclassified 672
63 Ga0070664_100007187 3300005564 Bacteria 8978
64 Ga0070664_100063401 3300005564 Bacteria 3151
65 Ga0068857_100099874 3300005577 Unclassified 2603
66 Ga0068854_100000896 3300005578 Bacteria 17906
67 Ga0068856_102515277 3300005614 Bacteria 521
68 Ga0070702_100015560 3300005615 Bacteria 3886
69 Ga0068859_100015638 3300005617 Bacteria 7625
70 Ga0068859_100085161 3300005617 Bacteria 3206
71 Ga0068859_102012762 3300005617 Unclassified 638
72 Ga0068864_100005594 3300005618 Bacteria 10304
73 Ga0068864_100021615 3300005618 Bacteria 5388
74 Ga0068864_100216249 3300005618 Bacteria 1767
75 Ga0068864_100902823 3300005618 Bacteria 872
76 Ga0068866_10005341 3300005718 Bacteria 5298
77 Ga0068861_100033792 3300005719 Bacteria 3776
78 Ga0068870_10216920 3300005840 Bacteria 1169
79 Ga0068870_10681225 3300005840 Unclassified 707
80 Ga0068863_100028617 3300005841 Bacteria 5320
81 Ga0068863_100298698 3300005841 Bacteria 1562
82 Ga0068858_100023240 3300005842 Bacteria 5779
83 Ga0068858_100124976 3300005842 Bacteria 2407
84 Ga0068860_100024718 3300005843 Bacteria 5802
85 Ga0068860_100432568 3300005843 Unclassified 1306
86 Ga0068860_101507397 3300005843 Bacteria 694
87 Ga0068862_101263285 3300005844 Bacteria 739
88 Ga0081539_10009703 3300005985 Bacteria 7970
89 Ga0068871_100010675 3300006358 Bacteria 6716
90 Ga0075428_100000041 3300006844 Bacteria 102565
91 Ga0075428_100008657 3300006844 Bacteria 11287
92 Ga0075428_100015640 3300006844 Bacteria 8409
93 Ga0075428_100290611 3300006844 Bacteria 1758
94 Ga0075428_101461065 3300006844 Bacteria 717
95 Ga0075430_101038564 3300006846 Bacteria 675
96 Ga0075431_100002546 3300006847 Bacteria 17595
97 Ga0075431_100010825 3300006847 Bacteria 9173
98 Ga0075431_100065710 3300006847 Unclassified 3745
99 Ga0075431_100066895 3300006847 Bacteria 3710
100 Ga0075431_100134418 3300006847 Bacteria 2549
101 Ga0075431_100442157 3300006847 Bacteria 1297
102 Ga0075434_102274255 3300006871 Unclassified 545
103 Ga0075434_102579764 3300006871 Bacteria 509
104 Ga0075429_100000878 3300006880 Bacteria 23738
105 Ga0075429_100032629 3300006880 Bacteria 4526
106 Ga0075429_100066694 3300006880 Bacteria 3133
107 Ga0075429_100128847 3300006880 Bacteria 2213
108 Ga0075429_100764403 3300006880 Bacteria 846
109 Ga0068865_100007654 3300006881 Bacteria 6654
110 Ga0068865_100082400 3300006881 Bacteria 2312
111 Ga0097620_100015638 3300006931 Bacteria 7625
112 Ga0097620_100085160 3300006931 Bacteria 3206
113 Ga0097620_102013089 3300006931 Unclassified 638
114 Ga0099794_10041785 3300007265 Bacteria 2184
115 Ga0099794_10049149 3300007265 Bacteria 2026
116 Ga0105251_10018656 3300009011 Bacteria 3682
117 Ga0105244_10261789 3300009036 Unclassified 805
118 Ga0105240_10330557 3300009093 Bacteria 1734
119 Ga0111539_10400995 3300009094 Bacteria 1597
120 Ga0111539_10657930 3300009094 Bacteria 1220
121 Ga0111539_11673305 3300009094 Unclassified 738
122 Ga0105245_10094053 3300009098 Bacteria 2762
123 Ga0114129_10004393 3300009147 Bacteria 19883
124 Ga0114129_10904132 3300009147 Bacteria 1118
125 Ga0114129_11300964 3300009147 Bacteria 901
126 Ga0105243_10001466 3300009148 Bacteria 20725
127 Ga0105241_10039362 3300009174 Bacteria 3566
128 Ga0105242_10000578 3300009176 Bacteria 29041
129 Ga0105248_10001515 3300009177 Bacteria 25851
130 Ga0105248_10445355 3300009177 Bacteria 1459
131 Ga0105238_10014597 3300009551 Bacteria 7943
132 Ga0105238_11002300 3300009551 Bacteria 856
133 Ga0105249_10095216 3300009553 Bacteria 2791
134 Ga0105249_10465863 3300009553 Bacteria 1304
135 Ga0105249_10793082 3300009553 Bacteria 1011
136 Ga0105239_10057714 3300010375 Bacteria 4258
137 Ga0105239_10288727 3300010375 Bacteria 1847
138 Ga0105246_10000450 3300011119 Bacteria 22062
139 Ga0105246_10269911 3300011119 Bacteria 1359
140 Ga0157371_10867103 3300013102 Unclassified 683
141 Ga0157371_10958150 3300013102 Bacteria 651
142 Ga0157370_10124258 3300013104 Bacteria 2409
143 Ga0157374_10158541 3300013296 Bacteria 2204
144 Ga0157378_10007971 3300013297 Bacteria 9245
145 Ga0163162_10058468 3300013306 Bacteria 3884
146 Ga0163162_10368851 3300013306 Bacteria 1569
147 Ga0163162_10607409 3300013306 Bacteria 1220
148 Ga0163162_10774881 3300013306 Bacteria 1077
149 Ga0157372_10537850 3300013307 Bacteria 1362
150 Ga0157372_10985539 3300013307 Unclassified 976
151 Ga0157372_11529391 3300013307 Bacteria 769
152 Ga0157375_10248042 3300013308 Bacteria 1941
153 Ga0157375_10302846 3300013308 Bacteria 1762
154 Ga0157375_10459963 3300013308 Bacteria 1438
155 Ga0157375_11059729 3300013308 Bacteria 948
156 Ga0157375_11917285 3300013308 Bacteria 703
157 Ga0163163_10022372 3300014325 Bacteria 5984
158 Ga0163163_10172773 3300014325 Bacteria 2208
159 Ga0157380_10035316 3300014326 Bacteria 3861
160 Ga0157380_10316367 3300014326 Bacteria 1445
161 Ga0157380_11802235 3300014326 Bacteria 671
162 Ga0182008_10221822 3300014497 Bacteria 967
163 Ga0157377_10068506 3300014745 Bacteria 2045
164 Ga0157377_10334109 3300014745 Bacteria 1011
165 Ga0157379_10012873 3300014968 Bacteria 7316
166 Ga0157379_10020249 3300014968 Bacteria 5881
167 Ga0157379_10543080 3300014968 Bacteria 1081
168 Ga0157376_10070870 3300014969 Bacteria 2960
169 Ga0163161_10672452 3300017792 Bacteria 860
170 Ga0213875_10003019 3300021388 Bacteria 9772
171 Ga0209437_100740 3300025233 Bacteria 16240
172 Ga0209676_1080563 3300025292 Bacteria 743
173 Ga0207655_1248890 3300025728 Bacteria 505
174 Ga0207713_1108680 3300025735 Bacteria 946
175 Ga0207653_10012198 3300025885 Bacteria 2684
176 Ga0207653_10094148 3300025885 Bacteria 1053
177 Ga0207692_10407558 3300025898 Bacteria 849
178 Ga0207642_10000594 3300025899 Bacteria 11131
179 Ga0207680_10011135 3300025903 Bacteria 4531
180 Ga0207647_10242825 3300025904 Bacteria 1034
181 Ga0207645_10000321 3300025907 Bacteria 39983
182 Ga0207684_10017749 3300025910 Bacteria 6104
183 Ga0207654_10601102 3300025911 Unclassified 785
184 Ga0207707_10422950 3300025912 Bacteria 1142
185 Ga0207707_11138554 3300025912 Bacteria 634
186 Ga0207663_10717479 3300025916 Bacteria 792
187 Ga0207660_10840114 3300025917 Bacteria 749
188 Ga0207649_10511984 3300025920 Bacteria 914
189 Ga0207652_10643357 3300025921 Unclassified 949
190 Ga0207646_10334922 3300025922 Bacteria 1367
191 Ga0207646_11774064 3300025922 Bacteria 528
192 Ga0207681_10000052 3300025923 Bacteria 112273
193 Ga0207681_10515450 3300025923 Unclassified 981
194 Ga0207681_10857061 3300025923 Bacteria 760
195 Ga0207650_10001613 3300025925 Bacteria 16089
196 Ga0207659_10084137 3300025926 Bacteria 2360
197 Ga0207659_10122222 3300025926 Bacteria 1996
198 Ga0207659_10222581 3300025926 Unclassified 1518
199 Ga0207659_10372931 3300025926 Bacteria 1189
200 Ga0207687_10057100 3300025927 Bacteria 2741
201 Ga0207706_10000005 3300025933 Bacteria 224460
202 Ga0207686_10000138 3300025934 Bacteria 57684
203 Ga0207709_10006980 3300025935 Bacteria 6314
204 Ga0207709_10080007 3300025935 Bacteria 2103
205 Ga0207709_10941424 3300025935 Bacteria 704
206 Ga0207670_11225390 3300025936 Bacteria 635
207 Ga0207669_10002480 3300025937 Bacteria 7868
208 Ga0207669_10096969 3300025937 Bacteria 1937
209 Ga0207704_10005756 3300025938 Bacteria 5731
210 Ga0207691_10195696 3300025940 Bacteria 1761
211 Ga0207691_10422949 3300025940 Bacteria 1135
212 Ga0207711_10001937 3300025941 Bacteria 18789
213 Ga0207689_10002089 3300025942 Bacteria 18836
214 Ga0207679_10265634 3300025945 Bacteria 1465
215 Ga0207667_10152516 3300025949 Bacteria 2378
216 Ga0207667_10225766 3300025949 Bacteria 1918
217 Ga0207667_11068289 3300025949 Unclassified 792
218 Ga0207667_11320029 3300025949 Unclassified 697
219 Ga0207651_10048012 3300025960 Bacteria 2883
220 Ga0207651_10213414 3300025960 Bacteria 1555
221 Ga0207651_10279409 3300025960 Bacteria 1379
222 Ga0207712_10009479 3300025961 Bacteria 6160
223 Ga0207668_10218746 3300025972 Bacteria 1528
224 Ga0207640_10006771 3300025981 Bacteria 6306
225 Ga0207658_10041081 3300025986 Bacteria 3347
226 Ga0207703_10158259 3300026035 Bacteria 1982
227 Ga0207703_10279735 3300026035 Bacteria 1515
228 Ga0207703_10337274 3300026035 Bacteria 1384
229 Ga0207639_10090196 3300026041 Bacteria 2451
230 Ga0207678_10047647 3300026067 Bacteria 3706
231 Ga0207678_10257068 3300026067 Bacteria 1496
232 Ga0207708_11325744 3300026075 Bacteria 631
233 Ga0207641_10062164 3300026088 Bacteria 3186
234 Ga0207641_10424506 3300026088 Bacteria 1281
235 Ga0207648_10000021 3300026089 Bacteria 139257
236 Ga0207648_10565746 3300026089 Bacteria 1045
237 Ga0207676_10055207 3300026095 Bacteria 3117
238 Ga0207676_10216302 3300026095 Bacteria 1703
239 Ga0207676_10227159 3300026095 Bacteria 1666
240 Ga0207674_10002911 3300026116 Bacteria 21255
241 Ga0207674_10725877 3300026116 Unclassified 959
242 Ga0207675_100026181 3300026118 Bacteria 5430
243 Ga0207675_101055891 3300026118 Bacteria 831
244 Ga0207683_10222797 3300026121 Bacteria 1719
245 Ga0210000_1071687 3300027462 Unclassified 565
246 Ga0209588_1015925 3300027671 Bacteria 2316
247 Ga0209588_1226232 3300027671 Unclassified 577
248 Ga0207428_10338963 3300027907 Bacteria 1108
249 Ga0268266_10889287 3300028379 Bacteria 861
250 Ga0268265_11104242 3300028380 Bacteria 787
251 Ga0268264_10018776 3300028381 Bacteria 5653
252 Ga0268264_11053261 3300028381 Unclassified 821
253 Ga0307408_100434354 3300031548 Bacteria 1135
254 Ga0307405_10063548 3300031731 Bacteria 2342
255 Ga0307413_10083168 3300031824 Bacteria 2059
256 Ga0307410_10288548 3300031852 Bacteria 1290
257 Ga0307406_10026140 3300031901 Unclassified 3502
258 Ga0307416_101070475 3300032002 Unclassified 910
259 Ga0307414_10500160 3300032004 Bacteria 1075
260 Ga0307411_10108521 3300032005 Bacteria 1980
261 Ga0307411_10897829 3300032005 Bacteria 787
262 Ga0307415_100098868 3300032126 Bacteria 2134
263 Ga0307415_100690289 3300032126 Bacteria 920
264 Ga0373941_0385070 3300035115 Unclassified 577
265 Ga0373935_0998695 3300035692 Unclassified 622
266 Ga0436364_0733263 3300037853 Bacteria 19120
267 Ga0451577_0014363 3300042876 Bacteria 7384
268 Ga0451577_0405368 3300042876 Unclassified 1238
269 Ga0453684_0114431 3300044712 Unclassified 3270
270 Ga0466957_0777553 3300044842 Unclassified 679
271 Ga0466960_0781500 3300044901 Bacteria 577
272 Ga0451576_0013076 3300045051 Bacteria 9296
273 Ga0451576_0372369 3300045051 Bacteria 1496
274 Ga0495603_0053144 3300046455 Bacteria 2404
275 Ga0495603_0105080 3300046455 Bacteria 1648
276 Ga0495580_0008233 3300046472 Bacteria 8297
277 Ga0495580_0296564 3300046472 Bacteria 1101
278 Ga0495639_0235635 3300046475 Unclassified 902
279 Ga0495594_0009938 3300046499 Bacteria 4925
280 Ga0495643_0000043 3300046522 Bacteria 226821
281 Ga0495633_0480130 3300046558 Bacteria 561
282 Ga0495656_0216577 3300046615 Unclassified 956
283 Ga0495647_0367371 3300046681 Bacteria 657
284 Ga0495670_0810521 3300046691 Bacteria 511
285 Ga0495649_0052883 3300046694 Unclassified 2200
286 Ga0495636_0022177 3300047318 Bacteria 2566
287 Ga0495684_0505735 3300047471 Bacteria 830
288 Ga0496101_0332286 3300048904 Bacteria 1193
289 Ga0496112_0288172 3300048915 Bacteria 1588
290 Ga0496114_0036372 3300048917 Bacteria 4070
291 Ga0496114_1080113 3300048917 Unclassified 687
292 Ga0496116_0035190 3300048919 Bacteria 3520
293 Ga0496122_0045517 3300048925 Bacteria 3410
294 Ga0496122_0229309 3300048925 Bacteria 1057
295 Ga0496124_0057940 3300048927 Bacteria 3261
296 Ga0496125_0023964 3300048928 Bacteria 5623
297 Ga0496125_0086019 3300048928 Bacteria 2380
298 Ga0501042_1191304 3300049578 Unclassified 555
299 Ga0501067_0400207 3300049583 Unclassified 766
300 Ga0501069_0303818 3300049585 Unclassified 936
301 Ga0501072_0501584 3300049588 Bacteria 960
302 Ga0501239_001255 3300049672 Bacteria 2152
303 Ga0501079_1250540 3300049741 Unclassified 585
304 nmdc:mga05p37_525582_c1 3300050507 Bacteria 1352
305 nmdc:mga05p37_9077_c1 3300050507 Bacteria 11753
306 nmdc:mga09592_20459_c1 3300050508 Bacteria 5441
307 nmdc:mga09592_29849_c1 3300050508 Bacteria 4535
308 nmdc:mga09592_854_c1 3300050508 Bacteria 23738
309 nmdc:mga09592_963582_c1 3300050508 Unclassified 715
310 nmdc:mga0qj67_426304_c1 3300050509 Bacteria 1069
311 nmdc:mga0qj67_950503_c1 3300050509 Bacteria 676
312 nmdc:mga06r32_163820_c1 3300050510 Bacteria 2206
313 nmdc:mga06r32_432204_c1 3300050510 Bacteria 1297
314 nmdc:mga06r32_482_c2 3300050510 Bacteria 32195
315 nmdc:mga06r32_95642_c1 3300050510 Bacteria 1227
316 nmdc:mga08y16_1220391_c1 3300050511 Bacteria 722
317 nmdc:mga08y16_1335966_c1 3300050511 Unclassified 682
318 nmdc:mga08y16_319923_c1 3300050511 Bacteria 1597
319 Ga0590071_126547 3300059421 Bacteria 655
320 2512640038 2512564013 Bacteria 6286191
321 2643737797 2643221543 Bacteria 6628015
322 2821117499 2821111986 Bacteria 6894338
323 2864738403 2864733723 Bacteria 6770668
324 2885528602 2885526491 Bacteria 7164189
325 2888579967 2888578766 Bacteria 6743310
326 2889043104 2889042446 Bacteria 7618936
327 2889051425 2889049205 Bacteria 7524325
328 2904168536 2904162308 Bacteria 7086713
329 2904496052 2904490793 Bacteria 7046938
330 2907202666 2907202186 Bacteria 6632024
331 2915603263 2915597211 Bacteria 6475886
332 2919164688 2919160200 Bacteria 6929020
333 2919427214 2919425241 Bacteria 8055701
334 2929188344 2929183550 Bacteria 6377511
335 2931386527 2931384279 Bacteria 7299545
336 2939684531 2939679117 Bacteria 6921672
337 2945994908 2945991243 Bacteria 7008369
338 2946057620 2946053406 Bacteria 6978655
339 Ga0496122_0108937
340 MBSR1b_contig_10352852
341 JGI25406J46586_10034966
342 rootH1_10016221
343 Ga0070690_100739462
344 Ga0070670_100022639
345 Ga0068869_100003817
346 Ga0070666_10054367
347 Ga0070680_100063773
348 Ga0070680_100686166
349 Ga0068868_100341066
350 Ga0070691_10522927
351 Ga0070661_100151681
352 Ga0070668_100097451
353 Ga0070669_100000032
354 Ga0070669_100306721
355 Ga0070675_100000385
356 Ga0070675_100436644
357 Ga0070675_100619649
358 Ga0070674_100002612
359 Ga0070674_100086275
360 Ga0070674_100119931
361 Ga0070673_100030665
362 Ga0070673_100090553
363 Ga0070673_100342130
364 Ga0070667_100052890
365 Ga0070703_10043160
366 Ga0070711_100202064
367 Ga0070705_100002149
368 Ga0070708_101670997
369 Ga0070663_100039766
370 Ga0070663_101021720
371 Ga0070663_101401591
372 Ga0070678_100021852
373 Ga0070678_100590190
374 Ga0070662_100000040
375 Ga0070681_10260524
376 Ga0068867_100000144
377 Ga0068867_100753641
378 Ga0070685_10560054
379 Ga0070706_100001919
380 Ga0070706_101970209
381 Ga0070707_100150654
382 Ga0070707_100220829
383 Ga0070698_100011471
384 Ga0070698_100156728
385 Ga0070698_101939439
386 Ga0070699_100194791
387 Ga0070679_101206250
388 Ga0070697_101005754
389 Ga0070697_101084045
390 Ga0068853_100090470
391 Ga0070672_100031147
392 Ga0070672_100493747
393 Ga0070686_100022322
394 Ga0070695_100000533
395 Ga0070695_100748240
396 Ga0070696_100083249
397 Ga0070693_101133048
398 Ga0070665_100973755
399 Ga0068855_100097773
400 Ga0068855_101576434
401 Ga0070664_100007187
402 Ga0070664_100063401
403 Ga0068857_100099874
404 Ga0068854_100000896
405 Ga0068856_102515277
406 Ga0070702_100015560
407 Ga0068859_100015638
408 Ga0068859_100085161
409 Ga0068859_102012762
410 Ga0068864_100005594
411 Ga0068864_100021615
412 Ga0068864_100216249
413 Ga0068864_100902823
414 Ga0068866_10005341
415 Ga0068861_100033792
416 Ga0068870_10216920
417 Ga0068870_10681225
418 Ga0068863_100028617
419 Ga0068863_100298698
420 Ga0068858_100023240
421 Ga0068858_100124976
422 Ga0068860_100024718
423 Ga0068860_100432568
424 Ga0068860_101507397
425 Ga0068862_101263285
426 Ga0081539_10009703
427 Ga0068871_100010675
428 Ga0075428_100000041
429 Ga0075428_100008657
430 Ga0075428_100015640
431 Ga0075428_100290611
432 Ga0075428_101461065
433 Ga0075430_101038564
434 Ga0075431_100002546
435 Ga0075431_100010825
436 Ga0075431_100065710
437 Ga0075431_100066895
438 Ga0075431_100134418
439 Ga0075431_100442157
440 Ga0075434_102274255
441 Ga0075434_102579764
442 Ga0075429_100000878
443 Ga0075429_100032629
444 Ga0075429_100066694
445 Ga0075429_100128847
446 Ga0075429_100764403
447 Ga0068865_100007654
448 Ga0068865_100082400
449 Ga0097620_100015638
450 Ga0097620_100085160
451 Ga0097620_102013089
452 Ga0099794_10041785
453 Ga0099794_10049149
454 Ga0105251_10018656
455 Ga0105244_10261789
456 Ga0105240_10330557
457 Ga0111539_10400995
458 Ga0111539_10657930
459 Ga0111539_11673305
460 Ga0105245_10094053
461 Ga0114129_10004393
462 Ga0114129_10904132
463 Ga0114129_11300964
464 Ga0105243_10001466
465 Ga0105241_10039362
466 Ga0105242_10000578
467 Ga0105248_10001515
468 Ga0105248_10445355
469 Ga0105238_10014597
470 Ga0105238_11002300
471 Ga0105249_10095216
472 Ga0105249_10465863
473 Ga0105249_10793082
474 Ga0105239_10057714
475 Ga0105239_10288727
476 Ga0105246_10000450
477 Ga0105246_10269911
478 Ga0157371_10867103
479 Ga0157371_10958150
480 Ga0157370_10124258
481 Ga0157374_10158541
482 Ga0157378_10007971
483 Ga0163162_10058468
484 Ga0163162_10368851
485 Ga0163162_10607409
486 Ga0163162_10774881
487 Ga0157372_10537850
488 Ga0157372_10985539
489 Ga0157372_11529391
490 Ga0157375_10248042
491 Ga0157375_10302846
492 Ga0157375_10459963
493 Ga0157375_11059729
494 Ga0157375_11917285
495 Ga0163163_10022372
496 Ga0163163_10172773
497 Ga0157380_10035316
498 Ga0157380_10316367
499 Ga0157380_11802235
500 Ga0182008_10221822
501 Ga0157377_10068506
502 Ga0157377_10334109
503 Ga0157379_10012873
504 Ga0157379_10020249
505 Ga0157379_10543080
506 Ga0157376_10070870
507 Ga0163161_10672452
508 Ga0213875_10003019
509 Ga0209437_100740
510 Ga0209676_1080563
511 Ga0207655_1248890
512 Ga0207713_1108680
513 Ga0207653_10012198
514 Ga0207653_10094148
515 Ga0207692_10407558
516 Ga0207642_10000594
517 Ga0207680_10011135
518 Ga0207647_10242825
519 Ga0207645_10000321
520 Ga0207684_10017749
521 Ga0207654_10601102
522 Ga0207707_10422950
523 Ga0207707_11138554
524 Ga0207663_10717479
525 Ga0207660_10840114
526 Ga0207649_10511984
527 Ga0207652_10643357
528 Ga0207646_10334922
529 Ga0207646_11774064
530 Ga0207681_10000052
531 Ga0207681_10515450
532 Ga0207681_10857061
533 Ga0207650_10001613
534 Ga0207659_10084137
535 Ga0207659_10122222
536 Ga0207659_10222581
537 Ga0207659_10372931
538 Ga0207687_10057100
539 Ga0207706_10000005
540 Ga0207686_10000138
541 Ga0207709_10006980
542 Ga0207709_10080007
543 Ga0207709_10941424
544 Ga0207670_11225390
545 Ga0207669_10002480
546 Ga0207669_10096969
547 Ga0207704_10005756
548 Ga0207691_10195696
549 Ga0207691_10422949
550 Ga0207711_10001937
551 Ga0207689_10002089
552 Ga0207679_10265634
553 Ga0207667_10152516
554 Ga0207667_10225766
555 Ga0207667_11068289
556 Ga0207667_11320029
557 Ga0207651_10048012
558 Ga0207651_10213414
559 Ga0207651_10279409
560 Ga0207712_10009479
561 Ga0207668_10218746
562 Ga0207640_10006771
563 Ga0207658_10041081
564 Ga0207703_10158259
565 Ga0207703_10279735
566 Ga0207703_10337274
567 Ga0207639_10090196
568 Ga0207678_10047647
569 Ga0207678_10257068
570 Ga0207708_11325744
571 Ga0207641_10062164
572 Ga0207641_10424506
573 Ga0207648_10000021
574 Ga0207648_10565746
575 Ga0207676_10055207
576 Ga0207676_10216302
577 Ga0207676_10227159
578 Ga0207674_10002911
579 Ga0207674_10725877
580 Ga0207675_100026181
581 Ga0207675_101055891
582 Ga0207683_10222797
583 Ga0210000_1071687
584 Ga0209588_1015925
585 Ga0209588_1226232
586 Ga0207428_10338963
587 Ga0268266_10889287
588 Ga0268265_11104242
589 Ga0268264_10018776
590 Ga0268264_11053261
591 Ga0307408_100434354
592 Ga0307405_10063548
593 Ga0307413_10083168
594 Ga0307410_10288548
595 Ga0307406_10026140
596 Ga0307416_101070475
597 Ga0307414_10500160
598 Ga0307411_10108521
599 Ga0307411_10897829
600 Ga0307415_100098868
601 Ga0307415_100690289
602 Ga0373941_0385070
603 Ga0373935_0998695
604 Ga0436364_0733263
605 Ga0451577_0014363
606 Ga0451577_0405368
607 Ga0453684_0114431
608 Ga0466957_0777553
609 Ga0466960_0781500
610 Ga0451576_0013076
611 Ga0451576_0372369
612 Ga0495603_0053144
613 Ga0495603_0105080
614 Ga0495580_0008233
615 Ga0495580_0296564
616 Ga0495639_0235635
617 Ga0495594_0009938
618 Ga0495643_0000043
619 Ga0495633_0480130
620 Ga0495656_0216577
621 Ga0495647_0367371
622 Ga0495670_0810521
623 Ga0495649_0052883
624 Ga0495636_0022177
625 Ga0495684_0505735
626 Ga0496101_0332286
627 Ga0496112_0288172
628 Ga0496114_0036372
629 Ga0496114_1080113
630 Ga0496116_0035190
631 Ga0496122_0045517
632 Ga0496122_0229309
633 Ga0496124_0057940
634 Ga0496125_0023964
635 Ga0496125_0086019
636 Ga0501042_1191304
637 Ga0501067_0400207
638 Ga0501069_0303818
639 Ga0501072_0501584
640 Ga0501239_001255
641 Ga0501079_1250540
642 nmdc:mga05p37_525582_c1
643 nmdc:mga05p37_9077_c1
644 nmdc:mga09592_20459_c1
645 nmdc:mga09592_29849_c1
646 nmdc:mga09592_854_c1
647 nmdc:mga09592_963582_c1
648 nmdc:mga0qj67_426304_c1
649 nmdc:mga0qj67_950503_c1
650 nmdc:mga06r32_163820_c1
651 nmdc:mga06r32_432204_c1
652 nmdc:mga06r32_482_c2
653 nmdc:mga06r32_95642_c1
654 nmdc:mga08y16_1220391_c1
655 nmdc:mga08y16_1335966_c1
656 nmdc:mga08y16_319923_c1
657 Ga0590071_126547
658 2512640038
659 2643737797
660 2821117499
661 2864738403
662 2885528602
663 2888579967
664 2889043104
665 2889051425
666 2904168536
667 2904496052
668 2907202666
669 2915603263
670 2919164688
671 2919427214
672 2929188344
673 2931386527
674 2939684531
675 2945994908
676 2946057620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

13

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9732 2 127
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9651 2 127
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9557 18 128
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9506 18 128
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9505 19 127
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9732 2 127 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9651 2 127 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9557 18 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9492 19 127 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9408 19 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7I7WJP0-F1-model_v4 Enamine deaminase RidA 1.001 64 128
AF-A0A2S9F7I4-F1-model_v4 RidA family protein 1 56 128
AF-A0A381V5Z9-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9909 36 125 GO:0005525
GO:0006777
GO:0016779
AF-A0A2N1URX0-F1-model_v4 Enamine deaminase RidA 0.986 2 127
AF-A0A6M0SFC9-F1-model_v4 RidA family protein 0.9852 1 128

Map