F413615

General Info

Members Datasets Scaffolds Average Seq Length
338 236 676 227

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0630793|Ga0436360_0630793_28_765
Length 245
Sequence VTVKPGSLPLHILVVDDEPPIRRFLRTSLGAAGYRVVEAENAAGGLRMVAAEKPDVVILDLGLPDKSGLEAITELRRHSAVPVIVLSARDDERSKVEALDLGADDYVSKPFGMAELMARLRAALRHAFQAQGELPVFVSGDLAVDLVRRHVTRGGEEVKLSPKEFDLLRHLVMHAGKVLTHRHLLREVWGPAQAEEVQYLRVFIRGLRQKLEPDPTRPTHILTELGVGYRLQLPPEQRAPAAPGP

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
212 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
213 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
228 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
229 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
230 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
231 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
232 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
233 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
234 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
235 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
236 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.58
Nodule 0
Rhizoplane 3.85
Rhizosphere 78.7
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0630793 3300039438 Bacteria 819
2 SwRhRL2b_contig_560298 2162886007 Bacteria 4757
3 JGI25153J46596_10000010 3300003215 Bacteria 337769
4 Ga0065704_10000376 3300005289 Bacteria 38995
5 Ga0070658_10004898 3300005327 Bacteria 10909
6 Ga0070658_10082835 3300005327 Bacteria 2636
7 Ga0070676_10003851 3300005328 Bacteria 7879
8 Ga0070683_100057411 3300005329 Bacteria 3616
9 Ga0070683_100808136 3300005329 Bacteria 899
10 Ga0070680_100003620 3300005336 Bacteria 11540
11 Ga0070680_100328786 3300005336 Bacteria 1298
12 Ga0070660_100129229 3300005339 Bacteria 2020
13 Ga0070691_10005266 3300005341 Bacteria 5875
14 Ga0070691_10043473 3300005341 Bacteria 2128
15 Ga0070687_100057811 3300005343 Bacteria 2035
16 Ga0070668_100135367 3300005347 Bacteria 1981
17 Ga0070668_100498233 3300005347 Bacteria 1054
18 Ga0070669_100000623 3300005353 Bacteria 26208
19 Ga0070669_100012753 3300005353 Bacteria 5966
20 Ga0070671_100000452 3300005355 Bacteria 28550
21 Ga0070671_100014564 3300005355 Bacteria 6360
22 Ga0070673_100022573 3300005364 Bacteria 4584
23 Ga0070659_100021047 3300005366 Bacteria 4961
24 Ga0070667_100002463 3300005367 Bacteria 16161
25 Ga0070714_100465369 3300005435 Bacteria 1202
26 Ga0070714_100659716 3300005435 Bacteria 1007
27 Ga0070713_100021656 3300005436 Bacteria 4950
28 Ga0070710_10002314 3300005437 Bacteria 9009
29 Ga0070705_100020735 3300005440 Bacteria 3485
30 Ga0070700_100006955 3300005441 Bacteria 6073
31 Ga0070694_100078452 3300005444 Bacteria 2291
32 Ga0070708_100552066 3300005445 Bacteria 1086
33 Ga0070681_10001491 3300005458 Bacteria 20687
34 Ga0070681_10033079 3300005458 Bacteria 5190
35 Ga0070681_10170096 3300005458 Bacteria 2101
36 Ga0068867_100003438 3300005459 Bacteria 11137
37 Ga0070706_100073060 3300005467 Bacteria 3174
38 Ga0070707_100195240 3300005468 Bacteria 1973
39 Ga0070707_100333763 3300005468 Unclassified 1473
40 Ga0070698_100034662 3300005471 Bacteria 5224
41 Ga0070699_100138105 3300005518 Bacteria 2151
42 Ga0070699_100239356 3300005518 Bacteria 1619
43 Ga0070697_100808554 3300005536 Bacteria 830
44 Ga0070695_100230272 3300005545 Bacteria 1339
45 Ga0070696_100011696 3300005546 Bacteria 5882
46 Ga0070696_100071352 3300005546 Bacteria 2444
47 Ga0070665_100015117 3300005548 Bacteria 7748
48 Ga0070665_100628578 3300005548 Bacteria 1087
49 Ga0070665_100729168 3300005548 Bacteria 1004
50 Ga0070704_100018594 3300005549 Bacteria 4448
51 Ga0068855_100036529 3300005563 Bacteria 5847
52 Ga0070664_100604438 3300005564 Bacteria 1017
53 Ga0068857_100070400 3300005577 Bacteria 3116
54 Ga0068854_100004135 3300005578 Bacteria 9119
55 Ga0068854_100103985 3300005578 Bacteria 2133
56 Ga0068856_100071605 3300005614 Bacteria 3432
57 Ga0068856_100124642 3300005614 Bacteria 2579
58 Ga0068856_100157702 3300005614 Bacteria 2279
59 Ga0070702_100005801 3300005615 Bacteria 5790
60 Ga0068852_100000273 3300005616 Bacteria 34348
61 Ga0068859_100438021 3300005617 Bacteria 1403
62 Ga0068861_100002061 3300005719 Bacteria 13036
63 Ga0068860_100082509 3300005843 Bacteria 3057
64 Ga0068862_100004598 3300005844 Bacteria 11629
65 Ga0068862_100584327 3300005844 Bacteria 1070
66 Ga0081455_10362821 3300005937 Bacteria 1018
67 Ga0081540_1002454 3300005983 Bacteria 15098
68 Ga0081539_10032155 3300005985 Bacteria 3218
69 Ga0070717_10029167 3300006028 Bacteria 4423
70 Ga0070716_100051550 3300006173 Bacteria 2340
71 Ga0070712_100192058 3300006175 Bacteria 1598
72 Ga0075430_100050903 3300006846 Bacteria 3492
73 Ga0075430_100439882 3300006846 Bacteria 1076
74 Ga0068865_100060955 3300006881 Bacteria 2643
75 Ga0075436_100109796 3300006914 Bacteria 1924
76 Ga0075436_100422459 3300006914 Bacteria 968
77 Ga0097620_100437981 3300006931 Bacteria 1403
78 Ga0075435_100274613 3300007076 Bacteria 1438
79 Ga0105250_10005456 3300009092 Bacteria 5696
80 Ga0105240_10022919 3300009093 Bacteria 8272
81 Ga0105240_10043377 3300009093 Bacteria 5724
82 Ga0105240_10452639 3300009093 Bacteria 1436
83 Ga0111539_10002499 3300009094 Bacteria 24388
84 Ga0111539_10142250 3300009094 Bacteria 2808
85 Ga0114129_10319079 3300009147 Bacteria 2066
86 Ga0105243_10004930 3300009148 Bacteria 10458
87 Ga0105242_10030691 3300009176 Bacteria 4292
88 Ga0105242_10382531 3300009176 Bacteria 1309
89 Ga0105237_10044953 3300009545 Bacteria 4446
90 Ga0105237_10061817 3300009545 Bacteria 3744
91 Ga0105238_10004619 3300009551 Bacteria 13631
92 Ga0105238_10495543 3300009551 Bacteria 1222
93 Ga0105249_10050277 3300009553 Bacteria 3801
94 Ga0105239_10003769 3300010375 Bacteria 18441
95 Ga0105246_10183147 3300011119 Bacteria 1614
96 Ga0157378_10095586 3300013297 Bacteria 2706
97 Ga0163162_10026658 3300013306 Bacteria 5713
98 Ga0163162_10916646 3300013306 Bacteria 989
99 Ga0213873_10004853 3300021358 Bacteria 2539
100 Ga0213872_10095514 3300021361 Bacteria 1328
101 Ga0213871_10039251 3300021441 Bacteria 1267
102 Ga0213871_10060970 3300021441 Bacteria 1051
103 Ga0228598_1031855 3300024227 Bacteria 1039
104 Ga0209758_1000033 3300025297 Bacteria 469998
105 Ga0209050_1005275 3300025298 Bacteria 8225
106 Ga0209257_1000428 3300025304 Bacteria 80856
107 Ga0209257_1040623 3300025304 Bacteria 1386
108 Ga0207696_1010388 3300025711 Bacteria 3413
109 Ga0207692_10009594 3300025898 Bacteria 4049
110 Ga0207642_10130163 3300025899 Bacteria 1312
111 Ga0207642_10195264 3300025899 Bacteria 1114
112 Ga0207688_10299217 3300025901 Bacteria 983
113 Ga0207647_10005167 3300025904 Bacteria 9600
114 Ga0207699_10023145 3300025906 Bacteria 3378
115 Ga0207699_10211108 3300025906 Bacteria 1320
116 Ga0207645_10001470 3300025907 Bacteria 19250
117 Ga0207705_10000155 3300025909 Bacteria 73779
118 Ga0207705_10160315 3300025909 Bacteria 1690
119 Ga0207707_10168848 3300025912 Bacteria 1912
120 Ga0207695_10024927 3300025913 Bacteria 6712
121 Ga0207695_10031641 3300025913 Bacteria 5798
122 Ga0207671_10034752 3300025914 Bacteria 3744
123 Ga0207693_10016096 3300025915 Bacteria 5985
124 Ga0207693_10463413 3300025915 Bacteria 990
125 Ga0207663_10283645 3300025916 Bacteria 1231
126 Ga0207660_10258658 3300025917 Bacteria 1376
127 Ga0207660_10579397 3300025917 Bacteria 913
128 Ga0207652_10738837 3300025921 Bacteria 876
129 Ga0207646_10003498 3300025922 Bacteria 17706
130 Ga0207646_10432862 3300025922 Unclassified 1187
131 Ga0207681_10001141 3300025923 Bacteria 17142
132 Ga0207681_10015797 3300025923 Bacteria 4713
133 Ga0207694_10188256 3300025924 Bacteria 1676
134 Ga0207664_10095123 3300025929 Bacteria 2450
135 Ga0207644_10019778 3300025931 Bacteria 4571
136 Ga0207644_10020198 3300025931 Bacteria 4526
137 Ga0207686_10585140 3300025934 Bacteria 876
138 Ga0207709_10101386 3300025935 Bacteria 1904
139 Ga0207665_10072049 3300025939 Bacteria 2359
140 Ga0207665_10106151 3300025939 Bacteria 1968
141 Ga0207665_10824961 3300025939 Bacteria 733
142 Ga0207661_10193174 3300025944 Bacteria 1786
143 Ga0207679_10562869 3300025945 Bacteria 1024
144 Ga0207667_10017637 3300025949 Bacteria 8031
145 Ga0207712_10067411 3300025961 Bacteria 2561
146 Ga0207668_10015780 3300025972 Bacteria 4701
147 Ga0207640_10000314 3300025981 Bacteria 32442
148 Ga0207640_10023076 3300025981 Bacteria 3736
149 Ga0207658_10001776 3300025986 Bacteria 16176
150 Ga0207708_10003328 3300026075 Bacteria 11835
151 Ga0207702_10009959 3300026078 Bacteria 7969
152 Ga0207702_10032209 3300026078 Bacteria 4374
153 Ga0207702_10265780 3300026078 Bacteria 1617
154 Ga0207702_10872033 3300026078 Bacteria 891
155 Ga0207641_10150841 3300026088 Bacteria 2105
156 Ga0207648_10003785 3300026089 Bacteria 15805
157 Ga0207674_10070066 3300026116 Bacteria 3525
158 Ga0207675_100521693 3300026118 Bacteria 1184
159 Ga0207698_10000179 3300026142 Bacteria 38793
160 Ga0268266_10007444 3300028379 Bacteria 9878
161 Ga0268265_10005409 3300028380 Bacteria 8740
162 Ga0268265_10059540 3300028380 Bacteria 2922
163 Ga0268264_10063614 3300028381 Bacteria 3102
164 Ga0307405_10538384 3300031731 Bacteria 943
165 Ga0307406_10132543 3300031901 Bacteria 1752
166 Ga0307409_101181854 3300031995 Bacteria 788
167 Ga0307416_101285979 3300032002 Bacteria 837
168 Ga0373926_0003129 3300035083 Bacteria 5310
169 Ga0373934_0056112 3300035086 Bacteria 1566
170 Ga0373953_0014580 3300035117 Bacteria 2830
171 Ga0373956_0008818 3300035119 Bacteria 4087
172 Ga0373956_0148806 3300035119 Bacteria 1101
173 Ga0373957_0006072 3300035120 Bacteria 3784
174 Ga0373943_0061787 3300035170 Bacteria 1874
175 Ga0373955_0119491 3300035172 Bacteria 1531
176 Ga0373955_0240500 3300035172 Bacteria 1084
177 Ga0373935_0112168 3300035692 Bacteria 1811
178 Ga0373935_0214874 3300035692 Bacteria 1334
179 Ga0373927_0016511 3300035695 Bacteria 4869
180 Ga0373927_0098686 3300035695 Bacteria 1899
181 Ga0373933_0048116 3300035724 Bacteria 2538
182 Ga0373933_0149102 3300035724 Bacteria 1480
183 Ga0373947_0018841 3300035725 Bacteria 3976
184 Ga0373947_0056188 3300035725 Bacteria 2379
185 Ga0373947_0094740 3300035725 Bacteria 1868
186 Ga0373947_0107392 3300035725 Bacteria 1760
187 Ga0373937_0024290 3300036401 Bacteria 5464
188 Ga0373937_0043635 3300036401 Bacteria 4094
189 Ga0373937_0382686 3300036401 Bacteria 1334
190 Ga0373925_0087922 3300037068 Bacteria 2372
191 Ga0395898_0750714 3300037466 Bacteria 917
192 Ga0436364_0070174 3300037853 Bacteria 6085
193 Ga0436364_0565196 3300037853 Bacteria 1395
194 Ga0436364_0651637 3300037853 Bacteria 848
195 Ga0436364_1288293 3300037853 Bacteria 8442
196 Ga0436364_1328083 3300037853 Bacteria 822
197 Ga0436365_1001746 3300039437 Bacteria 2225
198 Ga0436360_0798400 3300039438 Bacteria 2798
199 Ga0436360_0913148 3300039438 Bacteria 1628
200 Ga0436360_1251565 3300039438 Bacteria 1328
201 Ga0436361_0284157 3300039447 Bacteria 2855
202 Ga0436361_0373109 3300039447 Bacteria 4640
203 Ga0436361_0543870 3300039447 Plasmid 2810
204 Ga0436361_0605505 3300039447 Bacteria 974
205 Ga0436361_0736121 3300039447 Bacteria 1184
206 Ga0436363_0028985 3300039450 Bacteria 743
207 Ga0436363_1394341 3300039450 Bacteria 1519
208 Ga0436363_1443420 3300039450 Bacteria 2719
209 Ga0436363_1462457 3300039450 Bacteria 873
210 Ga0436363_1660869 3300039450 Bacteria 838
211 Ga0436362_0981381 3300039453 Bacteria 1761
212 Ga0436362_1046067 3300039453 Bacteria 7226
213 Ga0436362_1110692 3300039453 Bacteria 1381
214 Ga0451795_0067404 3300041456 Bacteria 1382
215 Ga0451577_0002058 3300042876 Bacteria 24851
216 Ga0453684_0000614 3300044712 Bacteria 130471
217 Ga0453684_0000662 3300044712 Bacteria 123698
218 Ga0453684_0604286 3300044712 Unclassified 1202
219 Ga0453684_0630847 3300044712 Bacteria 1171
220 Ga0451576_0496302 3300045051 Bacteria 1282
221 Ga0451576_0707639 3300045051 Bacteria 1058
222 Ga0466958_0147707 3300045836 Bacteria 1482
223 Ga0495592_0112353 3300046454 Bacteria 1926
224 Ga0495580_0553669 3300046472 Bacteria 763
225 Ga0495628_0303053 3300046516 Unclassified 1182
226 Ga0495637_0073938 3300046520 Bacteria 1370
227 Ga0495667_0026201 3300046559 Bacteria 3927
228 Ga0495667_0243420 3300046559 Bacteria 1145
229 Ga0495634_0180644 3300046642 Bacteria 1321
230 Ga0495635_0005317 3300046663 Bacteria 8962
231 Ga0495635_0404406 3300046663 Bacteria 907
232 Ga0495599_0118039 3300046678 Bacteria 1650
233 Ga0495669_0044399 3300046684 Bacteria 1980
234 Ga0495680_0018541 3300047322 Bacteria 5901
235 Ga0495680_0064005 3300047322 Bacteria 2822
236 Ga0495684_0229487 3300047471 Bacteria 1358
237 Ga0495686_0362364 3300047472 Bacteria 786
238 Ga0496102_0001383 3300048905 Bacteria 21626
239 Ga0496103_0000038 3300048906 Bacteria 178822
240 Ga0496104_0190069 3300048907 Bacteria 1964
241 Ga0496105_0008519 3300048908 Bacteria 7966
242 Ga0496106_0223625 3300048909 Bacteria 1502
243 Ga0496107_0048281 3300048910 Bacteria 3066
244 Ga0496109_0835700 3300048912 Bacteria 859
245 Ga0496110_0261301 3300048913 Bacteria 1576
246 Ga0496112_0170834 3300048915 Bacteria 2139
247 Ga0496113_0000168 3300048916 Bacteria 29010
248 Ga0496113_0357672 3300048916 Bacteria 1171
249 Ga0496115_0219625 3300048918 Bacteria 1568
250 Ga0496116_0079968 3300048919 Bacteria 2031
251 Ga0496117_0000629 3300048920 Bacteria 57168
252 Ga0496119_0003881 3300048922 Bacteria 15227
253 Ga0496120_0009797 3300048923 Bacteria 6754
254 Ga0496121_0038106 3300048924 Bacteria 4262
255 Ga0496121_0276731 3300048924 Bacteria 1150
256 Ga0496122_0033035 3300048925 Bacteria 4263
257 Ga0496124_0000988 3300048927 Bacteria 45089
258 Ga0496125_0018764 3300048928 Bacteria 6555
259 Ga0496126_0000066 3300048929 Bacteria 252188
260 Ga0496126_0602252 3300048929 Bacteria 866
261 Ga0501031_0285106 3300049568 Bacteria 1071
262 Ga0501033_0142732 3300049570 Bacteria 1731
263 Ga0501034_0505611 3300049571 Bacteria 1122
264 Ga0501034_0536044 3300049571 Bacteria 1081
265 Ga0501034_0640003 3300049571 Bacteria 966
266 Ga0501038_0085422 3300049574 Bacteria 2654
267 Ga0501042_0261997 3300049578 Bacteria 1248
268 Ga0501043_0433505 3300049579 Bacteria 990
269 Ga0501047_0001864 3300049581 Bacteria 20298
270 Ga0501048_0431513 3300049582 Bacteria 943
271 Ga0501068_0114752 3300049584 Bacteria 1677
272 Ga0501070_0009654 3300049586 Bacteria 8158
273 Ga0501072_0270401 3300049588 Unclassified 1352
274 Ga0501072_0311073 3300049588 Bacteria 1252
275 Ga0501074_0396736 3300049590 Bacteria 978
276 Ga0501076_0264991 3300049592 Unclassified 1407
277 Ga0501080_0007100 3300049742 Bacteria 10115
278 Ga0501080_0030083 3300049742 Bacteria 5058
279 Ga0501080_0076960 3300049742 Bacteria 3102
280 Ga0501080_0162583 3300049742 Bacteria 2061
281 Ga0501083_0012145 3300049744 Bacteria 6028
282 Ga0501083_0036298 3300049744 Bacteria 3362
283 Ga0501083_0340673 3300049744 Bacteria 975
284 Ga0501035_0209306 3300049822 Bacteria 1669
285 Ga0501044_0218658 3300049823 Bacteria 1856
286 Ga0501045_0031956 3300049824 Bacteria 3813
287 nmdc:mga0qj67_553128_c1 3300050509 Bacteria 923
288 nmdc:mga08y16_32823_c1 3300050511 Bacteria 5458
289 nmdc:mga0n895_210919_c1 3300050512 Bacteria 1972
290 nmdc:mga0n895_712180_c1 3300050512 Bacteria 999
291 nmdc:mga0rr50_105191_c1 3300050513 Bacteria 2225
292 nmdc:mga0rr50_975950_c1 3300050513 Bacteria 722
293 Ga0495601_0002122 3300053077 Bacteria 11150
294 Ga0495601_0020138 3300053077 Bacteria 4073
295 Ga0495612_0094250 3300053078 Bacteria 1271
296 Ga0495595_0041344 3300053084 Bacteria 2109
297 Ga0495619_0031356 3300053085 Bacteria 3445
298 Ga0495619_0043561 3300053085 Bacteria 2943
299 Ga0495619_0131179 3300053085 Bacteria 1722
300 Ga0495619_0859304 3300053085 Bacteria 612
301 Ga0500647_0054342 3300053091 Bacteria 1927
302 Ga0500583_0090010 3300053092 Bacteria 1493
303 Ga0500651_0001567 3300053093 Bacteria 11600
304 Ga0500651_0068357 3300053093 Bacteria 2212
305 Ga0500651_0129545 3300053093 Bacteria 1526
306 Ga0500566_0065723 3300053094 Bacteria 2045
307 Ga0500641_0000649 3300053096 Bacteria 12547
308 Ga0500555_007151 3300053103 Bacteria 3173
309 Ga0500595_002812 3300053119 Bacteria 8368
310 Ga0500597_004309 3300053120 Bacteria 4387
311 Ga0500614_129913 3300053123 Bacteria 747
312 Ga0500618_003893 3300053125 Bacteria 4967
313 Ga0500642_0000769 3300053130 Bacteria 9410
314 Ga0500642_0003804 3300053130 Bacteria 4626
315 Ga0500655_000030 3300053133 Bacteria 39615
316 Ga0500568_0045616 3300053139 Bacteria 1743
317 Ga0500588_0078736 3300053146 Bacteria 1098
318 Ga0500590_004627 3300053148 Bacteria 6520
319 Ga0500616_0000891 3300053153 Bacteria 32780
320 Ga0500622_0033054 3300053156 Bacteria 2712
321 Ga0500624_000078 3300053157 Bacteria 51436
322 Ga0500636_0062951 3300053177 Bacteria 2163
323 Ga0500637_0000050 3300053178 Bacteria 43067
324 Ga0500645_086763 3300053730 Bacteria 890
325 Ga0501084_0016831 3300054114 Bacteria 6074
326 Ga0501084_0056236 3300054114 Bacteria 3292
327 Ga0501084_0729166 3300054114 Bacteria 835
328 Ga0501082_0020198 3300060353 Bacteria 5740
329 2585262519 2582581305 Bacteria 4895574
330 2738710307 2738541275 Bacteria 4830863
331 2738848732 2738541301 Bacteria 4834102
332 2738864461 2738541304 Bacteria 4833665
333 2739296979 2738543022 Bacteria 4835059
334 2739358657 2738543033 Bacteria 4833336
335 2848297164 2848297114 Bacteria 3608511
336 2928101953 2928100450 Bacteria 4837635
337 2928960044 2928959182 Bacteria 4725774
338 2996315360 2996310559 Bacteria 6357320
339 Ga0436360_0630793
340 SwRhRL2b_contig_560298
341 JGI25153J46596_10000010
342 Ga0065704_10000376
343 Ga0070658_10004898
344 Ga0070658_10082835
345 Ga0070676_10003851
346 Ga0070683_100057411
347 Ga0070683_100808136
348 Ga0070680_100003620
349 Ga0070680_100328786
350 Ga0070660_100129229
351 Ga0070691_10005266
352 Ga0070691_10043473
353 Ga0070687_100057811
354 Ga0070668_100135367
355 Ga0070668_100498233
356 Ga0070669_100000623
357 Ga0070669_100012753
358 Ga0070671_100000452
359 Ga0070671_100014564
360 Ga0070673_100022573
361 Ga0070659_100021047
362 Ga0070667_100002463
363 Ga0070714_100465369
364 Ga0070714_100659716
365 Ga0070713_100021656
366 Ga0070710_10002314
367 Ga0070705_100020735
368 Ga0070700_100006955
369 Ga0070694_100078452
370 Ga0070708_100552066
371 Ga0070681_10001491
372 Ga0070681_10033079
373 Ga0070681_10170096
374 Ga0068867_100003438
375 Ga0070706_100073060
376 Ga0070707_100195240
377 Ga0070707_100333763
378 Ga0070698_100034662
379 Ga0070699_100138105
380 Ga0070699_100239356
381 Ga0070697_100808554
382 Ga0070695_100230272
383 Ga0070696_100011696
384 Ga0070696_100071352
385 Ga0070665_100015117
386 Ga0070665_100628578
387 Ga0070665_100729168
388 Ga0070704_100018594
389 Ga0068855_100036529
390 Ga0070664_100604438
391 Ga0068857_100070400
392 Ga0068854_100004135
393 Ga0068854_100103985
394 Ga0068856_100071605
395 Ga0068856_100124642
396 Ga0068856_100157702
397 Ga0070702_100005801
398 Ga0068852_100000273
399 Ga0068859_100438021
400 Ga0068861_100002061
401 Ga0068860_100082509
402 Ga0068862_100004598
403 Ga0068862_100584327
404 Ga0081455_10362821
405 Ga0081540_1002454
406 Ga0081539_10032155
407 Ga0070717_10029167
408 Ga0070716_100051550
409 Ga0070712_100192058
410 Ga0075430_100050903
411 Ga0075430_100439882
412 Ga0068865_100060955
413 Ga0075436_100109796
414 Ga0075436_100422459
415 Ga0097620_100437981
416 Ga0075435_100274613
417 Ga0105250_10005456
418 Ga0105240_10022919
419 Ga0105240_10043377
420 Ga0105240_10452639
421 Ga0111539_10002499
422 Ga0111539_10142250
423 Ga0114129_10319079
424 Ga0105243_10004930
425 Ga0105242_10030691
426 Ga0105242_10382531
427 Ga0105237_10044953
428 Ga0105237_10061817
429 Ga0105238_10004619
430 Ga0105238_10495543
431 Ga0105249_10050277
432 Ga0105239_10003769
433 Ga0105246_10183147
434 Ga0157378_10095586
435 Ga0163162_10026658
436 Ga0163162_10916646
437 Ga0213873_10004853
438 Ga0213872_10095514
439 Ga0213871_10039251
440 Ga0213871_10060970
441 Ga0228598_1031855
442 Ga0209758_1000033
443 Ga0209050_1005275
444 Ga0209257_1000428
445 Ga0209257_1040623
446 Ga0207696_1010388
447 Ga0207692_10009594
448 Ga0207642_10130163
449 Ga0207642_10195264
450 Ga0207688_10299217
451 Ga0207647_10005167
452 Ga0207699_10023145
453 Ga0207699_10211108
454 Ga0207645_10001470
455 Ga0207705_10000155
456 Ga0207705_10160315
457 Ga0207707_10168848
458 Ga0207695_10024927
459 Ga0207695_10031641
460 Ga0207671_10034752
461 Ga0207693_10016096
462 Ga0207693_10463413
463 Ga0207663_10283645
464 Ga0207660_10258658
465 Ga0207660_10579397
466 Ga0207652_10738837
467 Ga0207646_10003498
468 Ga0207646_10432862
469 Ga0207681_10001141
470 Ga0207681_10015797
471 Ga0207694_10188256
472 Ga0207664_10095123
473 Ga0207644_10019778
474 Ga0207644_10020198
475 Ga0207686_10585140
476 Ga0207709_10101386
477 Ga0207665_10072049
478 Ga0207665_10106151
479 Ga0207665_10824961
480 Ga0207661_10193174
481 Ga0207679_10562869
482 Ga0207667_10017637
483 Ga0207712_10067411
484 Ga0207668_10015780
485 Ga0207640_10000314
486 Ga0207640_10023076
487 Ga0207658_10001776
488 Ga0207708_10003328
489 Ga0207702_10009959
490 Ga0207702_10032209
491 Ga0207702_10265780
492 Ga0207702_10872033
493 Ga0207641_10150841
494 Ga0207648_10003785
495 Ga0207674_10070066
496 Ga0207675_100521693
497 Ga0207698_10000179
498 Ga0268266_10007444
499 Ga0268265_10005409
500 Ga0268265_10059540
501 Ga0268264_10063614
502 Ga0307405_10538384
503 Ga0307406_10132543
504 Ga0307409_101181854
505 Ga0307416_101285979
506 Ga0373926_0003129
507 Ga0373934_0056112
508 Ga0373953_0014580
509 Ga0373956_0008818
510 Ga0373956_0148806
511 Ga0373957_0006072
512 Ga0373943_0061787
513 Ga0373955_0119491
514 Ga0373955_0240500
515 Ga0373935_0112168
516 Ga0373935_0214874
517 Ga0373927_0016511
518 Ga0373927_0098686
519 Ga0373933_0048116
520 Ga0373933_0149102
521 Ga0373947_0018841
522 Ga0373947_0056188
523 Ga0373947_0094740
524 Ga0373947_0107392
525 Ga0373937_0024290
526 Ga0373937_0043635
527 Ga0373937_0382686
528 Ga0373925_0087922
529 Ga0395898_0750714
530 Ga0436364_0070174
531 Ga0436364_0565196
532 Ga0436364_0651637
533 Ga0436364_1288293
534 Ga0436364_1328083
535 Ga0436365_1001746
536 Ga0436360_0798400
537 Ga0436360_0913148
538 Ga0436360_1251565
539 Ga0436361_0284157
540 Ga0436361_0373109
541 Ga0436361_0543870
542 Ga0436361_0605505
543 Ga0436361_0736121
544 Ga0436363_0028985
545 Ga0436363_1394341
546 Ga0436363_1443420
547 Ga0436363_1462457
548 Ga0436363_1660869
549 Ga0436362_0981381
550 Ga0436362_1046067
551 Ga0436362_1110692
552 Ga0451795_0067404
553 Ga0451577_0002058
554 Ga0453684_0000614
555 Ga0453684_0000662
556 Ga0453684_0604286
557 Ga0453684_0630847
558 Ga0451576_0496302
559 Ga0451576_0707639
560 Ga0466958_0147707
561 Ga0495592_0112353
562 Ga0495580_0553669
563 Ga0495628_0303053
564 Ga0495637_0073938
565 Ga0495667_0026201
566 Ga0495667_0243420
567 Ga0495634_0180644
568 Ga0495635_0005317
569 Ga0495635_0404406
570 Ga0495599_0118039
571 Ga0495669_0044399
572 Ga0495680_0018541
573 Ga0495680_0064005
574 Ga0495684_0229487
575 Ga0495686_0362364
576 Ga0496102_0001383
577 Ga0496103_0000038
578 Ga0496104_0190069
579 Ga0496105_0008519
580 Ga0496106_0223625
581 Ga0496107_0048281
582 Ga0496109_0835700
583 Ga0496110_0261301
584 Ga0496112_0170834
585 Ga0496113_0000168
586 Ga0496113_0357672
587 Ga0496115_0219625
588 Ga0496116_0079968
589 Ga0496117_0000629
590 Ga0496119_0003881
591 Ga0496120_0009797
592 Ga0496121_0038106
593 Ga0496121_0276731
594 Ga0496122_0033035
595 Ga0496124_0000988
596 Ga0496125_0018764
597 Ga0496126_0000066
598 Ga0496126_0602252
599 Ga0501031_0285106
600 Ga0501033_0142732
601 Ga0501034_0505611
602 Ga0501034_0536044
603 Ga0501034_0640003
604 Ga0501038_0085422
605 Ga0501042_0261997
606 Ga0501043_0433505
607 Ga0501047_0001864
608 Ga0501048_0431513
609 Ga0501068_0114752
610 Ga0501070_0009654
611 Ga0501072_0270401
612 Ga0501072_0311073
613 Ga0501074_0396736
614 Ga0501076_0264991
615 Ga0501080_0007100
616 Ga0501080_0030083
617 Ga0501080_0076960
618 Ga0501080_0162583
619 Ga0501083_0012145
620 Ga0501083_0036298
621 Ga0501083_0340673
622 Ga0501035_0209306
623 Ga0501044_0218658
624 Ga0501045_0031956
625 nmdc:mga0qj67_553128_c1
626 nmdc:mga08y16_32823_c1
627 nmdc:mga0n895_210919_c1
628 nmdc:mga0n895_712180_c1
629 nmdc:mga0rr50_105191_c1
630 nmdc:mga0rr50_975950_c1
631 Ga0495601_0002122
632 Ga0495601_0020138
633 Ga0495612_0094250
634 Ga0495595_0041344
635 Ga0495619_0031356
636 Ga0495619_0043561
637 Ga0495619_0131179
638 Ga0495619_0859304
639 Ga0500647_0054342
640 Ga0500583_0090010
641 Ga0500651_0001567
642 Ga0500651_0068357
643 Ga0500651_0129545
644 Ga0500566_0065723
645 Ga0500641_0000649
646 Ga0500555_007151
647 Ga0500595_002812
648 Ga0500597_004309
649 Ga0500614_129913
650 Ga0500618_003893
651 Ga0500642_0000769
652 Ga0500642_0003804
653 Ga0500655_000030
654 Ga0500568_0045616
655 Ga0500588_0078736
656 Ga0500590_004627
657 Ga0500616_0000891
658 Ga0500622_0033054
659 Ga0500624_000078
660 Ga0500636_0062951
661 Ga0500637_0000050
662 Ga0500645_086763
663 Ga0501084_0016831
664 Ga0501084_0056236
665 Ga0501084_0729166
666 Ga0501082_0020198
667 2585262519
668 2738710307
669 2738848732
670 2738864461
671 2739296979
672 2739358657
673 2848297164
674 2928101953
675 2928960044
676 2996315360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

12

121

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

155

231

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9708 6 123
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9673 6 121
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9654 6 120
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9629 6 122
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9629 6 129
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 6 80 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 4 121 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9679 6 83 3.40.50.2300
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9629 6 129 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9619 6 127 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H6A3G5-F1-model_v4 Transcriptional regulatory protein ZraR 0.9396 4 128 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2V7MBL8-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.8892 4 144 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A6L7JHB0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8162 1 228 GO:0000155
GO:0003677
GO:0005524
GO:0006355
AF-A0A6L7JHB0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8099 1 228 GO:0000155
GO:0003677
GO:0005524
GO:0006355
AF-A0A3M1JL48-F1-model_v4 DNA-binding response regulator 0.7716 6 229 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map