F413519

General Info

Members Datasets Scaffolds Average Seq Length
338 244 676 214

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10022681|Ga0157379_100226817
Length 259
Sequence VEDLGGAQNVSTSHGPIASPRVARLTRGRREAVVVGAGNREVGGVSLVRVHNFAVSLDGFATGDGQSLEQPFGHAEGRLMDWFFHTRTFRSMHGEPGGGTGVDEALASNWGPGIGAEIMGRNKFGPQRGPWPDDGWQGWWGDNPPFHTPVFVLTHHPRPSIEMAGGTTFHFIDATPAEALRQAREAAGGLDVRIGGGPTTVREFLAADLIDHLHTVVVPIILGRGVRLWDGLEGLETRFTVESVTTPRGVTHVTFTRTR

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2558860280 Kutzneria sp. 744 Isolate Unclassified
233 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
234 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
235 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
236 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
237 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
238 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
239 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
240 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
241 2920879853 Kocuria salina CV6 Isolate Unclassified
242 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
243 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
244 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0.3
Rhizoplane 5.03
Rhizosphere 87.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10022681 3300014968 Bacteria 5562
2 JGI24743J22301_10017074 3300001991 Bacteria 1359
3 JGI24034J26672_10037675 3300002239 Bacteria 805
4 Ga0070683_100487234 3300005329 Bacteria 1177
5 Ga0068869_100099869 3300005334 Bacteria 2194
6 Ga0070666_10010718 3300005335 Bacteria 5737
7 Ga0070666_10238147 3300005335 Bacteria 1286
8 Ga0070680_100291506 3300005336 Bacteria 1383
9 Ga0070682_100115928 3300005337 Bacteria 1792
10 Ga0070682_100235090 3300005337 Bacteria 1312
11 Ga0068868_100015760 3300005338 Bacteria 5599
12 Ga0070691_10165063 3300005341 Bacteria 1144
13 Ga0070687_100002726 3300005343 Bacteria 6694
14 Ga0070687_100057423 3300005343 Bacteria 2041
15 Ga0070692_10038473 3300005345 Bacteria 2438
16 Ga0070668_100036403 3300005347 Bacteria 3756
17 Ga0070668_100043409 3300005347 Bacteria 3448
18 Ga0070674_100172929 3300005356 Bacteria 1648
19 Ga0070673_100040151 3300005364 Bacteria 3588
20 Ga0070659_100072940 3300005366 Bacteria 2732
21 Ga0070703_10024465 3300005406 Bacteria 1785
22 Ga0070709_10072335 3300005434 Bacteria 2228
23 Ga0070714_100011936 3300005435 Bacteria 6911
24 Ga0070714_100038574 3300005435 Bacteria 4016
25 Ga0070713_100037888 3300005436 Bacteria 3901
26 Ga0070713_100051161 3300005436 Bacteria 3416
27 Ga0070710_10307445 3300005437 Bacteria 1036
28 Ga0070701_10226027 3300005438 Bacteria 1118
29 Ga0070711_100219870 3300005439 Bacteria 1476
30 Ga0070705_100003112 3300005440 Bacteria 8159
31 Ga0070694_100007189 3300005444 Bacteria 6778
32 Ga0070663_100132021 3300005455 Bacteria 1897
33 Ga0070678_100673874 3300005456 Bacteria 929
34 Ga0070706_100019488 3300005467 Bacteria 6256
35 Ga0070706_100243105 3300005467 Bacteria 1681
36 Ga0070707_100008700 3300005468 Bacteria 9414
37 Ga0070698_100011728 3300005471 Bacteria 9294
38 Ga0070679_100305240 3300005530 Bacteria 1542
39 Ga0070684_100273403 3300005535 Bacteria 1547
40 Ga0070697_100213097 3300005536 Bacteria 1645
41 Ga0068853_100149602 3300005539 Bacteria 2101
42 Ga0068853_100314510 3300005539 Bacteria 1450
43 Ga0070686_100308735 3300005544 Bacteria 1176
44 Ga0070693_100044132 3300005547 Bacteria 2521
45 Ga0070665_100089615 3300005548 Bacteria 3082
46 Ga0070704_100146783 3300005549 Bacteria 1849
47 Ga0070664_100049427 3300005564 Bacteria 3557
48 Ga0068857_100254931 3300005577 Bacteria 1609
49 Ga0068857_100389906 3300005577 Bacteria 1295
50 Ga0070702_100019778 3300005615 Bacteria 3518
51 Ga0068852_100021116 3300005616 Bacteria 5190
52 Ga0068859_100002525 3300005617 Bacteria 18568
53 Ga0068859_101014203 3300005617 Bacteria 912
54 Ga0068864_100036470 3300005618 Bacteria 4191
55 Ga0068866_10072115 3300005718 Bacteria 1829
56 Ga0068861_100061318 3300005719 Bacteria 2886
57 Ga0068861_100283726 3300005719 Bacteria 1427
58 Ga0068858_100026799 3300005842 Bacteria 5354
59 Ga0068858_100116055 3300005842 Bacteria 2502
60 Ga0068858_100195873 3300005842 Bacteria 1909
61 Ga0068860_100085560 3300005843 Bacteria 3000
62 Ga0068860_101276977 3300005843 Bacteria 755
63 Ga0068862_100517806 3300005844 Bacteria 1135
64 Ga0081540_1001926 3300005983 Bacteria 17391
65 Ga0070717_10021859 3300006028 Bacteria 5047
66 Ga0070717_10035384 3300006028 Bacteria 4042
67 Ga0075432_10213958 3300006058 Bacteria 768
68 Ga0070716_100013087 3300006173 Bacteria 4220
69 Ga0070712_100063250 3300006175 Bacteria 2619
70 Ga0097621_100003863 3300006237 Bacteria 10378
71 Ga0068871_100210963 3300006358 Bacteria 1680
72 Ga0075433_10033597 3300006852 Bacteria 4399
73 Ga0075434_100346925 3300006871 Bacteria 1505
74 Ga0068865_100153960 3300006881 Bacteria 1747
75 Ga0075436_100037542 3300006914 Bacteria 3344
76 Ga0097620_100002525 3300006931 Bacteria 18568
77 Ga0097620_101014194 3300006931 Bacteria 912
78 Ga0075435_100102955 3300007076 Bacteria 2367
79 Ga0105240_10079351 3300009093 Bacteria 4039
80 Ga0111539_11062523 3300009094 Bacteria 941
81 Ga0105245_10009037 3300009098 Bacteria 8685
82 Ga0105245_10331254 3300009098 Bacteria 1503
83 Ga0105247_10000156 3300009101 Bacteria 67016
84 Ga0105247_10190612 3300009101 Bacteria 1372
85 Ga0114129_10732348 3300009147 Bacteria 1268
86 Ga0114129_11162554 3300009147 Bacteria 963
87 Ga0105243_10277471 3300009148 Bacteria 1508
88 Ga0105241_10016217 3300009174 Bacteria 5458
89 Ga0105242_10025910 3300009176 Bacteria 4644
90 Ga0105248_10000763 3300009177 Bacteria 36119
91 Ga0105248_10054653 3300009177 Bacteria 4478
92 Ga0105237_10186058 3300009545 Bacteria 2077
93 Ga0105238_10095266 3300009551 Bacteria 2964
94 Ga0105238_10401764 3300009551 Bacteria 1363
95 Ga0105249_10296897 3300009553 Bacteria 1619
96 Ga0105239_10653365 3300010375 Bacteria 1201
97 Ga0105246_10022505 3300011119 Bacteria 4066
98 Ga0105246_10065355 3300011119 Bacteria 2543
99 Ga0157371_10029675 3300013102 Bacteria 3952
100 Ga0157371_10144512 3300013102 Bacteria 1695
101 Ga0157370_10034554 3300013104 Bacteria 4920
102 Ga0157369_10144751 3300013105 Bacteria 2513
103 Ga0157369_10178582 3300013105 Bacteria 2234
104 Ga0157374_10053691 3300013296 Bacteria 3758
105 Ga0163162_10006435 3300013306 Bacteria 11377
106 Ga0157372_10053216 3300013307 Bacteria 4511
107 Ga0157372_10054849 3300013307 Bacteria 4448
108 Ga0157372_10488424 3300013307 Bacteria 1436
109 Ga0157375_10237444 3300013308 Bacteria 1982
110 Ga0163163_10158259 3300014325 Bacteria 2310
111 Ga0157380_10154145 3300014326 Bacteria 1990
112 Ga0157377_10028705 3300014745 Bacteria 2997
113 Ga0157379_10165749 3300014968 Bacteria 1994
114 Ga0157379_10713461 3300014968 Bacteria 942
115 Ga0157376_10047559 3300014969 Bacteria 3542
116 Ga0163161_10261317 3300017792 Bacteria 1352
117 Ga0207653_10010188 3300025885 Bacteria 2930
118 Ga0207692_10432855 3300025898 Bacteria 825
119 Ga0207642_10015417 3300025899 Bacteria 2847
120 Ga0207710_10000023 3300025900 Bacteria 329909
121 Ga0207710_10000170 3300025900 Bacteria 67024
122 Ga0207710_10148387 3300025900 Bacteria 1136
123 Ga0207688_10002113 3300025901 Bacteria 10690
124 Ga0207680_10058093 3300025903 Bacteria 2343
125 Ga0207684_10011044 3300025910 Bacteria 7911
126 Ga0207654_10014703 3300025911 Bacteria 4048
127 Ga0207671_10184012 3300025914 Bacteria 1627
128 Ga0207693_10006633 3300025915 Bacteria 9562
129 Ga0207663_10209965 3300025916 Bacteria 1410
130 Ga0207663_10245900 3300025916 Bacteria 1314
131 Ga0207660_10283525 3300025917 Bacteria 1315
132 Ga0207662_10003423 3300025918 Bacteria 8162
133 Ga0207657_10339761 3300025919 Bacteria 1185
134 Ga0207652_10274286 3300025921 Bacteria 1521
135 Ga0207646_10010244 3300025922 Bacteria 9176
136 Ga0207681_10251568 3300025923 Bacteria 1380
137 Ga0207694_10344225 3300025924 Bacteria 1233
138 Ga0207687_10130294 3300025927 Bacteria 1894
139 Ga0207687_10644710 3300025927 Bacteria 896
140 Ga0207700_10050288 3300025928 Bacteria 3105
141 Ga0207664_10029004 3300025929 Bacteria 4212
142 Ga0207664_10308741 3300025929 Bacteria 1393
143 Ga0207690_10052455 3300025932 Bacteria 2732
144 Ga0207690_10380174 3300025932 Bacteria 1122
145 Ga0207690_10653168 3300025932 Bacteria 862
146 Ga0207709_10327422 3300025935 Bacteria 1149
147 Ga0207704_10078705 3300025938 Bacteria 2121
148 Ga0207665_10003409 3300025939 Bacteria 10641
149 Ga0207711_10001179 3300025941 Bacteria 24855
150 Ga0207661_10063694 3300025944 Bacteria 2987
151 Ga0207679_10063016 3300025945 Bacteria 2766
152 Ga0207651_10078456 3300025960 Bacteria 2369
153 Ga0207712_10027596 3300025961 Bacteria 3792
154 Ga0207703_10000003 3300026035 Bacteria 532213
155 Ga0207703_10344121 3300026035 Bacteria 1371
156 Ga0207678_10005337 3300026067 Bacteria 11510
157 Ga0207702_10046133 3300026078 Bacteria 3667
158 Ga0207641_10001713 3300026088 Bacteria 21263
159 Ga0207641_10303081 3300026088 Bacteria 1510
160 Ga0207676_10025047 3300026095 Bacteria 4424
161 Ga0207674_10104149 3300026116 Bacteria 2816
162 Ga0207674_10120944 3300026116 Bacteria 2586
163 Ga0207674_10768976 3300026116 Bacteria 930
164 Ga0207675_100014559 3300026118 Bacteria 7331
165 Ga0207675_100251906 3300026118 Bacteria 1709
166 Ga0207683_10002497 3300026121 Bacteria 16045
167 Ga0207698_10297660 3300026142 Bacteria 1500
168 Ga0268266_10029392 3300028379 Bacteria 4673
169 Ga0268265_10048207 3300028380 Bacteria 3197
170 Ga0268264_10524691 3300028381 Bacteria 1158
171 Ga0307517_10113993 3300028786 Bacteria 2036
172 Ga0307512_10028003 3300030522 Bacteria 4947
173 Ga0307508_10000927 3300031616 Bacteria 34076
174 Ga0307413_10232152 3300031824 Bacteria 1356
175 Ga0307413_10572684 3300031824 Bacteria 920
176 Ga0307407_10522900 3300031903 Bacteria 873
177 Ga0307409_100317942 3300031995 Bacteria 1456
178 Ga0307507_10000008 3300033179 Bacteria 266336
179 Ga0373938_0003647 3300034957 Bacteria 2537
180 Ga0373929_0002344 3300035085 Bacteria 3482
181 Ga0373952_0014929 3300035092 Bacteria 1561
182 Ga0373932_0012907 3300035112 Bacteria 2067
183 Ga0373931_0384801 3300035691 Bacteria 885
184 Ga0373935_0248021 3300035692 Bacteria 1245
185 Ga0373927_0040154 3300035695 Bacteria 3037
186 Ga0395900_0046603 3300037418 Bacteria 4465
187 Ga0395898_0008144 3300037466 Bacteria 11099
188 Ga0395905_0578141 3300037471 Bacteria 1025
189 Ga0395901_0009455 3300038443 Bacteria 9890
190 Ga0395901_0343693 3300038443 Bacteria 1541
191 Ga0450918_092351 3300042531 Bacteria 586
192 Ga0466969_0002646 3300044656 Bacteria 9567
193 Ga0466969_0087389 3300044656 Bacteria 1480
194 Ga0466969_0445243 3300044656 Bacteria 589
195 Ga0466972_0151873 3300044658 Bacteria 1089
196 Ga0466966_0069304 3300044684 Bacteria 2213
197 Ga0466966_0150059 3300044684 Bacteria 1422
198 Ga0466966_0259725 3300044684 Bacteria 1046
199 Ga0466961_0011871 3300044693 Bacteria 5568
200 Ga0466961_0020366 3300044693 Bacteria 4266
201 Ga0466961_0181505 3300044693 Bacteria 1307
202 Ga0466961_0329863 3300044693 Bacteria 930
203 Ga0466963_0222601 3300044694 Bacteria 1322
204 Ga0466963_0279606 3300044694 Bacteria 1173
205 Ga0466963_0395246 3300044694 Bacteria 975
206 Ga0466964_0097674 3300044706 Bacteria 1289
207 Ga0466970_0002698 3300044765 Bacteria 8574
208 Ga0466970_0007631 3300044765 Bacteria 5422
209 Ga0466970_0026721 3300044765 Bacteria 3025
210 Ga0466970_0080591 3300044765 Bacteria 1759
211 Ga0466970_0320877 3300044765 Bacteria 876
212 Ga0466957_0032519 3300044842 Bacteria 3124
213 Ga0466960_0015671 3300044901 Bacteria 3273
214 Ga0466960_0092004 3300044901 Bacteria 1548
215 Ga0466959_0005563 3300045049 Bacteria 8653
216 Ga0466959_0116349 3300045049 Bacteria 1904
217 Ga0466959_0267925 3300045049 Bacteria 1175
218 Ga0466959_0468681 3300045049 Bacteria 853
219 Ga0466958_0120076 3300045836 Bacteria 1645
220 Ga0466958_0122499 3300045836 Bacteria 1629
221 Ga0466958_0219753 3300045836 Bacteria 1212
222 Ga0466967_0004267 3300045976 Bacteria 9607
223 Ga0495627_044071 3300046453 Bacteria 1363
224 Ga0495603_0059398 3300046455 Bacteria 2261
225 Ga0495629_0025954 3300046459 Bacteria 4163
226 Ga0495651_0207347 3300046462 Bacteria 1367
227 Ga0495650_0000788 3300046471 Bacteria 38796
228 Ga0495594_0094655 3300046499 Bacteria 1677
229 Ga0495628_0023838 3300046516 Bacteria 5018
230 Ga0495666_0034489 3300046526 Bacteria 2470
231 Ga0495652_0066624 3300046529 Bacteria 3021
232 Ga0495640_0003437 3300046533 Bacteria 12737
233 Ga0495667_0151820 3300046559 Bacteria 1491
234 Ga0495634_0014759 3300046642 Bacteria 5620
235 Ga0495657_0142101 3300046675 Bacteria 1495
236 Ga0495613_0028681 3300046689 Bacteria 4140
237 Ga0495600_0086305 3300046809 Bacteria 2048
238 Ga0495600_0536997 3300046809 Bacteria 716
239 Ga0495604_0020649 3300047317 Bacteria 5258
240 Ga0495676_0013776 3300047321 Bacteria 7250
241 Ga0495675_0085819 3300047444 Bacteria 1979
242 Ga0496100_0024558 3300048903 Bacteria 3677
243 Ga0496102_0017166 3300048905 Bacteria 6338
244 Ga0496102_0233334 3300048905 Bacteria 1734
245 Ga0496104_0036889 3300048907 Bacteria 4570
246 Ga0496104_0325904 3300048907 Bacteria 1449
247 Ga0496105_0025426 3300048908 Bacteria 4819
248 Ga0496106_0096175 3300048909 Bacteria 2291
249 Ga0496108_0000073 3300048911 Bacteria 112479
250 Ga0496108_0154447 3300048911 Bacteria 1981
251 Ga0496109_0071028 3300048912 Bacteria 3195
252 Ga0496110_0115083 3300048913 Bacteria 2420
253 Ga0496111_0056886 3300048914 Bacteria 2830
254 Ga0496112_0039356 3300048915 Bacteria 4620
255 Ga0496113_0083679 3300048916 Bacteria 2448
256 Ga0496113_0769903 3300048916 Bacteria 766
257 Ga0496114_0016153 3300048917 Bacteria 6008
258 Ga0496115_0295230 3300048918 Bacteria 1328
259 Ga0496117_0110028 3300048920 Bacteria 1718
260 Ga0496118_0052735 3300048921 Bacteria 3099
261 Ga0496119_0002056 3300048922 Bacteria 22761
262 Ga0496119_0013567 3300048922 Bacteria 6474
263 Ga0496120_0001296 3300048923 Bacteria 31084
264 Ga0496121_0010301 3300048924 Bacteria 10576
265 Ga0496121_0326452 3300048924 Bacteria 1031
266 Ga0496124_0123718 3300048927 Bacteria 2063
267 Ga0501031_0253405 3300049568 Bacteria 1144
268 Ga0501031_0372897 3300049568 Bacteria 923
269 Ga0501032_0192703 3300049569 Bacteria 1332
270 Ga0501032_0452008 3300049569 Bacteria 823
271 Ga0501033_0078676 3300049570 Bacteria 2420
272 Ga0501033_0153394 3300049570 Bacteria 1661
273 Ga0501033_0392666 3300049570 Bacteria 968
274 Ga0501033_0398218 3300049570 Bacteria 960
275 Ga0501034_0014986 3300049571 Bacteria 7974
276 Ga0501034_0133652 3300049571 Bacteria 2463
277 Ga0501036_0048708 3300049572 Bacteria 3588
278 Ga0501036_0095285 3300049572 Bacteria 2516
279 Ga0501036_0142760 3300049572 Bacteria 2020
280 Ga0501036_0252754 3300049572 Bacteria 1477
281 Ga0501036_0357777 3300049572 Bacteria 1219
282 Ga0501037_0350776 3300049573 Bacteria 1018
283 Ga0501037_0486001 3300049573 Bacteria 839
284 Ga0501038_0202415 3300049574 Bacteria 1593
285 Ga0501038_0245723 3300049574 Bacteria 1419
286 Ga0501038_0428639 3300049574 Bacteria 1019
287 Ga0501046_0167293 3300049580 Bacteria 1651
288 Ga0501047_0007527 3300049581 Bacteria 10253
289 Ga0501047_0046273 3300049581 Bacteria 4205
290 Ga0501047_0094955 3300049581 Bacteria 2861
291 Ga0501047_0184656 3300049581 Bacteria 1951
292 Ga0501048_0027136 3300049582 Bacteria 4165
293 Ga0501069_0001226 3300049585 Bacteria 12530
294 Ga0501070_0064923 3300049586 Bacteria 3022
295 Ga0501070_0100280 3300049586 Bacteria 2396
296 Ga0501071_0105395 3300049587 Bacteria 2081
297 Ga0501071_0602607 3300049587 Bacteria 844
298 Ga0501073_0010003 3300049589 Bacteria 6975
299 Ga0501073_0051682 3300049589 Bacteria 2879
300 Ga0501074_0181563 3300049590 Bacteria 1501
301 Ga0501076_0006544 3300049592 Bacteria 8454
302 Ga0501077_0010951 3300049593 Bacteria 5654
303 Ga0501077_0147451 3300049593 Bacteria 1493
304 Ga0501080_0167784 3300049742 Bacteria 2025
305 Ga0501081_0086290 3300049743 Bacteria 2203
306 Ga0501083_0010812 3300049744 Bacteria 6418
307 Ga0501083_0012663 3300049744 Bacteria 5902
308 Ga0501035_0017438 3300049822 Bacteria 6622
309 Ga0501044_0012425 3300049823 Bacteria 9221
310 Ga0501044_0139704 3300049823 Bacteria 2411
311 Ga0501044_0524055 3300049823 Bacteria 1084
312 Ga0501045_0163628 3300049824 Bacteria 1656
313 nmdc:mga0n895_511701_c1 3300050512 Bacteria 1209
314 nmdc:mga0rr50_35210_c1 3300050513 Bacteria 3594
315 nmdc:mga08x19_246331_c1 3300050514 Bacteria 1233
316 Ga0500568_0000014 3300053139 Bacteria 223550
317 Ga0500573_0004563 3300053140 Bacteria 7317
318 Ga0500573_0059698 3300053140 Bacteria 2185
319 Ga0500577_0025982 3300053142 Bacteria 1988
320 Ga0501084_0023237 3300054114 Bacteria 5176
321 Ga0501084_0119477 3300054114 Bacteria 2215
322 Ga0501082_0024089 3300060353 Bacteria 5250
323 Ga0501082_0284549 3300060353 Bacteria 1439
324 Ga0466962_0218482 3300061719 Bacteria 933
325 Ga0530510_0016088 3300061734 Bacteria 5288
326 2559423833 2558860280 Bacteria 11429938
327 2753270842 2751185782 Bacteria 11227053
328 2774396012 2773857762 Bacteria 5971770
329 2812347854 2811994878 Bacteria 5992952
330 2812373299 2811994882 Bacteria 4688362
331 2857736903 2857733635 Bacteria 3532004
332 2862996012 2862993130 Bacteria 3860849
333 2895434746 2895427314 Bacteria 13147766
334 2919450563 2919446982 Bacteria 3994487
335 2920881164 2920879853 Bacteria 4216831
336 2939659214 2939657138 Bacteria 3740283
337 2964329535 2964326757 Bacteria 3290868
338 8055158545 8055157932 Bacteria 6429399
339 Ga0157379_10022681
340 JGI24743J22301_10017074
341 JGI24034J26672_10037675
342 Ga0070683_100487234
343 Ga0068869_100099869
344 Ga0070666_10010718
345 Ga0070666_10238147
346 Ga0070680_100291506
347 Ga0070682_100115928
348 Ga0070682_100235090
349 Ga0068868_100015760
350 Ga0070691_10165063
351 Ga0070687_100002726
352 Ga0070687_100057423
353 Ga0070692_10038473
354 Ga0070668_100036403
355 Ga0070668_100043409
356 Ga0070674_100172929
357 Ga0070673_100040151
358 Ga0070659_100072940
359 Ga0070703_10024465
360 Ga0070709_10072335
361 Ga0070714_100011936
362 Ga0070714_100038574
363 Ga0070713_100037888
364 Ga0070713_100051161
365 Ga0070710_10307445
366 Ga0070701_10226027
367 Ga0070711_100219870
368 Ga0070705_100003112
369 Ga0070694_100007189
370 Ga0070663_100132021
371 Ga0070678_100673874
372 Ga0070706_100019488
373 Ga0070706_100243105
374 Ga0070707_100008700
375 Ga0070698_100011728
376 Ga0070679_100305240
377 Ga0070684_100273403
378 Ga0070697_100213097
379 Ga0068853_100149602
380 Ga0068853_100314510
381 Ga0070686_100308735
382 Ga0070693_100044132
383 Ga0070665_100089615
384 Ga0070704_100146783
385 Ga0070664_100049427
386 Ga0068857_100254931
387 Ga0068857_100389906
388 Ga0070702_100019778
389 Ga0068852_100021116
390 Ga0068859_100002525
391 Ga0068859_101014203
392 Ga0068864_100036470
393 Ga0068866_10072115
394 Ga0068861_100061318
395 Ga0068861_100283726
396 Ga0068858_100026799
397 Ga0068858_100116055
398 Ga0068858_100195873
399 Ga0068860_100085560
400 Ga0068860_101276977
401 Ga0068862_100517806
402 Ga0081540_1001926
403 Ga0070717_10021859
404 Ga0070717_10035384
405 Ga0075432_10213958
406 Ga0070716_100013087
407 Ga0070712_100063250
408 Ga0097621_100003863
409 Ga0068871_100210963
410 Ga0075433_10033597
411 Ga0075434_100346925
412 Ga0068865_100153960
413 Ga0075436_100037542
414 Ga0097620_100002525
415 Ga0097620_101014194
416 Ga0075435_100102955
417 Ga0105240_10079351
418 Ga0111539_11062523
419 Ga0105245_10009037
420 Ga0105245_10331254
421 Ga0105247_10000156
422 Ga0105247_10190612
423 Ga0114129_10732348
424 Ga0114129_11162554
425 Ga0105243_10277471
426 Ga0105241_10016217
427 Ga0105242_10025910
428 Ga0105248_10000763
429 Ga0105248_10054653
430 Ga0105237_10186058
431 Ga0105238_10095266
432 Ga0105238_10401764
433 Ga0105249_10296897
434 Ga0105239_10653365
435 Ga0105246_10022505
436 Ga0105246_10065355
437 Ga0157371_10029675
438 Ga0157371_10144512
439 Ga0157370_10034554
440 Ga0157369_10144751
441 Ga0157369_10178582
442 Ga0157374_10053691
443 Ga0163162_10006435
444 Ga0157372_10053216
445 Ga0157372_10054849
446 Ga0157372_10488424
447 Ga0157375_10237444
448 Ga0163163_10158259
449 Ga0157380_10154145
450 Ga0157377_10028705
451 Ga0157379_10165749
452 Ga0157379_10713461
453 Ga0157376_10047559
454 Ga0163161_10261317
455 Ga0207653_10010188
456 Ga0207692_10432855
457 Ga0207642_10015417
458 Ga0207710_10000023
459 Ga0207710_10000170
460 Ga0207710_10148387
461 Ga0207688_10002113
462 Ga0207680_10058093
463 Ga0207684_10011044
464 Ga0207654_10014703
465 Ga0207671_10184012
466 Ga0207693_10006633
467 Ga0207663_10209965
468 Ga0207663_10245900
469 Ga0207660_10283525
470 Ga0207662_10003423
471 Ga0207657_10339761
472 Ga0207652_10274286
473 Ga0207646_10010244
474 Ga0207681_10251568
475 Ga0207694_10344225
476 Ga0207687_10130294
477 Ga0207687_10644710
478 Ga0207700_10050288
479 Ga0207664_10029004
480 Ga0207664_10308741
481 Ga0207690_10052455
482 Ga0207690_10380174
483 Ga0207690_10653168
484 Ga0207709_10327422
485 Ga0207704_10078705
486 Ga0207665_10003409
487 Ga0207711_10001179
488 Ga0207661_10063694
489 Ga0207679_10063016
490 Ga0207651_10078456
491 Ga0207712_10027596
492 Ga0207703_10000003
493 Ga0207703_10344121
494 Ga0207678_10005337
495 Ga0207702_10046133
496 Ga0207641_10001713
497 Ga0207641_10303081
498 Ga0207676_10025047
499 Ga0207674_10104149
500 Ga0207674_10120944
501 Ga0207674_10768976
502 Ga0207675_100014559
503 Ga0207675_100251906
504 Ga0207683_10002497
505 Ga0207698_10297660
506 Ga0268266_10029392
507 Ga0268265_10048207
508 Ga0268264_10524691
509 Ga0307517_10113993
510 Ga0307512_10028003
511 Ga0307508_10000927
512 Ga0307413_10232152
513 Ga0307413_10572684
514 Ga0307407_10522900
515 Ga0307409_100317942
516 Ga0307507_10000008
517 Ga0373938_0003647
518 Ga0373929_0002344
519 Ga0373952_0014929
520 Ga0373932_0012907
521 Ga0373931_0384801
522 Ga0373935_0248021
523 Ga0373927_0040154
524 Ga0395900_0046603
525 Ga0395898_0008144
526 Ga0395905_0578141
527 Ga0395901_0009455
528 Ga0395901_0343693
529 Ga0450918_092351
530 Ga0466969_0002646
531 Ga0466969_0087389
532 Ga0466969_0445243
533 Ga0466972_0151873
534 Ga0466966_0069304
535 Ga0466966_0150059
536 Ga0466966_0259725
537 Ga0466961_0011871
538 Ga0466961_0020366
539 Ga0466961_0181505
540 Ga0466961_0329863
541 Ga0466963_0222601
542 Ga0466963_0279606
543 Ga0466963_0395246
544 Ga0466964_0097674
545 Ga0466970_0002698
546 Ga0466970_0007631
547 Ga0466970_0026721
548 Ga0466970_0080591
549 Ga0466970_0320877
550 Ga0466957_0032519
551 Ga0466960_0015671
552 Ga0466960_0092004
553 Ga0466959_0005563
554 Ga0466959_0116349
555 Ga0466959_0267925
556 Ga0466959_0468681
557 Ga0466958_0120076
558 Ga0466958_0122499
559 Ga0466958_0219753
560 Ga0466967_0004267
561 Ga0495627_044071
562 Ga0495603_0059398
563 Ga0495629_0025954
564 Ga0495651_0207347
565 Ga0495650_0000788
566 Ga0495594_0094655
567 Ga0495628_0023838
568 Ga0495666_0034489
569 Ga0495652_0066624
570 Ga0495640_0003437
571 Ga0495667_0151820
572 Ga0495634_0014759
573 Ga0495657_0142101
574 Ga0495613_0028681
575 Ga0495600_0086305
576 Ga0495600_0536997
577 Ga0495604_0020649
578 Ga0495676_0013776
579 Ga0495675_0085819
580 Ga0496100_0024558
581 Ga0496102_0017166
582 Ga0496102_0233334
583 Ga0496104_0036889
584 Ga0496104_0325904
585 Ga0496105_0025426
586 Ga0496106_0096175
587 Ga0496108_0000073
588 Ga0496108_0154447
589 Ga0496109_0071028
590 Ga0496110_0115083
591 Ga0496111_0056886
592 Ga0496112_0039356
593 Ga0496113_0083679
594 Ga0496113_0769903
595 Ga0496114_0016153
596 Ga0496115_0295230
597 Ga0496117_0110028
598 Ga0496118_0052735
599 Ga0496119_0002056
600 Ga0496119_0013567
601 Ga0496120_0001296
602 Ga0496121_0010301
603 Ga0496121_0326452
604 Ga0496124_0123718
605 Ga0501031_0253405
606 Ga0501031_0372897
607 Ga0501032_0192703
608 Ga0501032_0452008
609 Ga0501033_0078676
610 Ga0501033_0153394
611 Ga0501033_0392666
612 Ga0501033_0398218
613 Ga0501034_0014986
614 Ga0501034_0133652
615 Ga0501036_0048708
616 Ga0501036_0095285
617 Ga0501036_0142760
618 Ga0501036_0252754
619 Ga0501036_0357777
620 Ga0501037_0350776
621 Ga0501037_0486001
622 Ga0501038_0202415
623 Ga0501038_0245723
624 Ga0501038_0428639
625 Ga0501046_0167293
626 Ga0501047_0007527
627 Ga0501047_0046273
628 Ga0501047_0094955
629 Ga0501047_0184656
630 Ga0501048_0027136
631 Ga0501069_0001226
632 Ga0501070_0064923
633 Ga0501070_0100280
634 Ga0501071_0105395
635 Ga0501071_0602607
636 Ga0501073_0010003
637 Ga0501073_0051682
638 Ga0501074_0181563
639 Ga0501076_0006544
640 Ga0501077_0010951
641 Ga0501077_0147451
642 Ga0501080_0167784
643 Ga0501081_0086290
644 Ga0501083_0010812
645 Ga0501083_0012663
646 Ga0501035_0017438
647 Ga0501044_0012425
648 Ga0501044_0139704
649 Ga0501044_0524055
650 Ga0501045_0163628
651 nmdc:mga0n895_511701_c1
652 nmdc:mga0rr50_35210_c1
653 nmdc:mga08x19_246331_c1
654 Ga0500568_0000014
655 Ga0500573_0004563
656 Ga0500573_0059698
657 Ga0500577_0025982
658 Ga0501084_0023237
659 Ga0501084_0119477
660 Ga0501082_0024089
661 Ga0501082_0284549
662 Ga0466962_0218482
663 Ga0530510_0016088
664 2559423833
665 2753270842
666 2774396012
667 2812347854
668 2812373299
669 2857736903
670 2862996012
671 2895434746
672 2919450563
673 2920881164
674 2939659214
675 2964329535
676 8055158545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

49

253

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8297 1 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8187 1 214
5mmm-assembly1.cif.gz_U structure of the 70s chloroplast ribosome 0.803 196 214
4v8p-assembly4.cif.gz_GR t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.7881 196 214
5xxb-assembly1.cif.gz_W large subunit of toxoplasma gondii ribosome 0.786 196 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8165 2 214 3.40.430.10
af_Q99PR8_58_152_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.798 197 213 2.60.40.790
af_K7VBN7_519_611_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7962 196 214 3.30.70.260
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7909 2 214 3.40.430.10
4a1aR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7859 196 214 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A143QAP0-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9838 1 214 GO:0008703
GO:0009231
AF-A0A7Z0IH95-F1-model_v4 Dihydrofolate reductase 0.9837 109 214 GO:0008703
GO:0009231
AF-A0A0T2IIK2-F1-model_v4 Deaminase 0.9827 1 214 GO:0008703
GO:0009231
AF-A0A2T5AFZ9-F1-model_v4 deleted 0.9823 1 214
AF-A0A6J6N7R2-F1-model_v4 Unannotated protein 0.9821 2 214 GO:0008703
GO:0009231

Map