F413441

General Info

Members Datasets Scaffolds Average Seq Length
338 185 334 248

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100051546|Ga0068859_1000515462
Length 300
Sequence MGLILIKCSNWTFTTNATYYRLHLYTFNGLVGVIQQDIYLNAFEEEDSMTKLDQLKTICFLVFGVLVLAATSCSHQPASSPKPIAKTLTAEQIAKTYGLDSFGQIEAIRYTWNAQFPGVNISRKWVWEPKTGQVSYEGKDKYGKPVKATYFRTQLNTQPDIVKAELEPMFVNDNYWLLFPFHAYWDKSATVTDQGEKQLPQGNGSATLVSVEYPSEGGYTPADTWDLYIGKDDRVEQFVYHRGGPTKPSTVIATWEGYKKAGPLLISTDHNGTADGNPVRIFISDVAVKMSGSENWINAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 1.78
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.89
Rhizoplane 2.96
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_762510 2162886007 Bacteria 5776
2 JGI24751J29686_10000138 3300002459 Bacteria 36181
3 Ga0065714_10002189 3300005288 Bacteria 128055
4 Ga0065704_10000862 3300005289 Bacteria 12469
5 Ga0065712_10067733 3300005290 Bacteria 118568
6 Ga0065712_10074559 3300005290 Unclassified 4063
7 Ga0065715_10095260 3300005293 Bacteria 4126
8 Ga0065715_10100737 3300005293 Unclassified 3271
9 Ga0065715_10128015 3300005293 Unclassified 2058
10 Ga0065715_10153367 3300005293 Unclassified 1704
11 Ga0065707_10000700 3300005295 Bacteria 13888
12 Ga0070690_100020784 3300005330 Unclassified 4002
13 Ga0070670_100000229 3300005331 Bacteria 51545
14 Ga0070670_100256816 3300005331 Unclassified 1523
15 Ga0068869_100069396 3300005334 Unclassified 2606
16 Ga0068869_100203372 3300005334 Bacteria 1563
17 Ga0070666_10339565 3300005335 Bacteria 1073
18 Ga0068868_100036419 3300005338 Bacteria 3808
19 Ga0070689_100388085 3300005340 Bacteria 1178
20 Ga0070687_100014515 3300005343 Unclassified 3539
21 Ga0070687_100293248 3300005343 Unclassified 1029
22 Ga0070661_100109798 3300005344 Unclassified 2059
23 Ga0070668_100239629 3300005347 Unclassified 1502
24 Ga0070674_100145037 3300005356 Bacteria 1786
25 Ga0070673_100032262 3300005364 Unclassified 3941
26 Ga0070667_100265130 3300005367 Bacteria 1539
27 Ga0070709_10029031 3300005434 Unclassified 3304
28 Ga0070709_10373279 3300005434 Unclassified 1059
29 Ga0070709_10448709 3300005434 Unclassified 971
30 Ga0070714_100159676 3300005435 Unclassified 2038
31 Ga0070714_100659306 3300005435 Unclassified 1008
32 Ga0070713_100036044 3300005436 Unclassified 3988
33 Ga0070713_100041409 3300005436 Unclassified 3752
34 Ga0070713_100049797 3300005436 Unclassified 3458
35 Ga0070713_100296996 3300005436 Bacteria 1486
36 Ga0070710_10000598 3300005437 Bacteria 17193
37 Ga0070701_10133771 3300005438 Unclassified 1411
38 Ga0070701_10272653 3300005438 Bacteria 1030
39 Ga0070711_100125465 3300005439 Unclassified 1905
40 Ga0070711_100137237 3300005439 Bacteria 1829
41 Ga0070705_100251310 3300005440 Unclassified 1241
42 Ga0070700_100668590 3300005441 Bacteria 822
43 Ga0070694_100000029 3300005444 Bacteria 65647
44 Ga0070694_100043519 3300005444 Unclassified 3003
45 Ga0070708_100023230 3300005445 Bacteria 5270
46 Ga0070708_100098796 3300005445 Bacteria 2669
47 Ga0070708_100130605 3300005445 Bacteria 2324
48 Ga0070708_100474152 3300005445 Bacteria 1181
49 Ga0070678_100324375 3300005456 Bacteria 1316
50 Ga0070662_100128385 3300005457 Unclassified 1951
51 Ga0070681_10002508 3300005458 Bacteria 16826
52 Ga0070681_10006112 3300005458 Bacteria 11683
53 Ga0070685_10015743 3300005466 Unclassified 4021
54 Ga0070706_100038427 3300005467 Bacteria 4417
55 Ga0070706_100057207 3300005467 Unclassified 3598
56 Ga0070707_100010317 3300005468 Bacteria 8697
57 Ga0070707_100034566 3300005468 Bacteria 4821
58 Ga0070707_100052287 3300005468 Bacteria 3916
59 Ga0070707_100121543 3300005468 Bacteria 2536
60 Ga0070707_100249462 3300005468 Unclassified 1727
61 Ga0070698_100183339 3300005471 Bacteria 2031
62 Ga0070699_100020286 3300005518 Bacteria 5731
63 Ga0070699_100029760 3300005518 Bacteria 4710
64 Ga0070699_100223433 3300005518 Unclassified 1678
65 Ga0070679_100000256 3300005530 Bacteria 44524
66 Ga0070679_100251159 3300005530 Unclassified 1725
67 Ga0070697_100019394 3300005536 Bacteria 5372
68 Ga0070697_100307453 3300005536 Bacteria 1363
69 Ga0070697_100399301 3300005536 Bacteria 1193
70 Ga0068853_100252418 3300005539 Bacteria 1619
71 Ga0068853_100530587 3300005539 Unclassified 1113
72 Ga0070696_100161933 3300005546 Unclassified 1649
73 Ga0070693_100006950 3300005547 Bacteria 5505
74 Ga0070693_100078193 3300005547 Bacteria 1965
75 Ga0070704_100231159 3300005549 Unclassified 1509
76 Ga0070704_100242651 3300005549 Bacteria 1475
77 Ga0070704_100296970 3300005549 Bacteria 1344
78 Ga0070664_100071497 3300005564 Unclassified 2973
79 Ga0070664_100279558 3300005564 Bacteria 1505
80 Ga0068856_100001532 3300005614 Bacteria 24221
81 Ga0068856_100222571 3300005614 Unclassified 1902
82 Ga0068856_100232271 3300005614 Bacteria 1860
83 Ga0070702_100037362 3300005615 Unclassified 2697
84 Ga0068859_100034221 3300005617 Bacteria 5100
85 Ga0068859_100050008 3300005617 Bacteria 4199
86 Ga0068859_100051546 3300005617 Unclassified 4137
87 Ga0068859_100061163 3300005617 Bacteria 3794
88 Ga0068859_100159924 3300005617 Unclassified 2331
89 Ga0068864_100002523 3300005618 Bacteria 15123
90 Ga0068864_100033852 3300005618 Unclassified 4344
91 Ga0068864_100656111 3300005618 Bacteria 1022
92 Ga0068866_10008438 3300005718 Unclassified 4344
93 Ga0068866_10267636 3300005718 Unclassified 1053
94 Ga0068863_100014158 3300005841 Bacteria 7684
95 Ga0068863_100128752 3300005841 Bacteria 2416
96 Ga0068863_100280403 3300005841 Unclassified 1614
97 Ga0068858_100023723 3300005842 Bacteria 5715
98 Ga0068858_100044131 3300005842 Bacteria 4133
99 Ga0068858_100164386 3300005842 Bacteria 2091
100 Ga0068860_100250259 3300005843 Bacteria 1725
101 Ga0068862_100026619 3300005844 Unclassified 4861
102 Ga0068862_100160232 3300005844 Bacteria 2008
103 Ga0068862_100301245 3300005844 Unclassified 1475
104 Ga0081539_10005965 3300005985 Bacteria 12012
105 Ga0070717_10035236 3300006028 Bacteria 4050
106 Ga0070717_10053889 3300006028 Bacteria 3316
107 Ga0070717_10137457 3300006028 Bacteria 2106
108 Ga0070715_10086453 3300006163 Unclassified 1434
109 Ga0070716_100250901 3300006173 Bacteria 1205
110 Ga0070716_100558106 3300006173 Unclassified 855
111 Ga0070712_100054242 3300006175 Bacteria 2802
112 Ga0070712_100078749 3300006175 Bacteria 2380
113 Ga0075433_10008310 3300006852 Bacteria 8275
114 Ga0075433_10014162 3300006852 Bacteria 6508
115 Ga0075433_10332841 3300006852 Bacteria 1343
116 Ga0075433_10364320 3300006852 Unclassified 1277
117 Ga0075434_100000235 3300006871 Bacteria 38289
118 Ga0075434_100004271 3300006871 Bacteria 12817
119 Ga0075434_100085149 3300006871 Bacteria 3160
120 Ga0075434_100125885 3300006871 Bacteria 2579
121 Ga0068865_100010397 3300006881 Bacteria 5792
122 Ga0075436_100005980 3300006914 Bacteria 8355
123 Ga0075436_100037125 3300006914 Bacteria 3364
124 Ga0075436_100296556 3300006914 Unclassified 1158
125 Ga0097620_100034221 3300006931 Bacteria 5100
126 Ga0097620_100050006 3300006931 Bacteria 4199
127 Ga0097620_100051544 3300006931 Unclassified 4137
128 Ga0097620_100061163 3300006931 Bacteria 3794
129 Ga0097620_100159911 3300006931 Unclassified 2331
130 Ga0075435_100003821 3300007076 Bacteria 10277
131 Ga0075435_100007962 3300007076 Bacteria 7584
132 Ga0075435_100283365 3300007076 Bacteria 1415
133 Ga0099794_10033140 3300007265 Bacteria 2428
134 Ga0099795_10003415 3300007788 Bacteria 3927
135 Ga0105240_10047360 3300009093 Bacteria 5441
136 Ga0105240_10294798 3300009093 Bacteria 1858
137 Ga0105240_10661300 3300009093 Unclassified 1144
138 Ga0111539_10001904 3300009094 Bacteria 27778
139 Ga0105247_10000823 3300009101 Bacteria 23675
140 Ga0114129_10016764 3300009147 Bacteria 10430
141 Ga0114129_10042658 3300009147 Bacteria 6385
142 Ga0114129_10298742 3300009147 Bacteria 2147
143 Ga0114129_10315325 3300009147 Bacteria 2080
144 Ga0105243_10028333 3300009148 Unclassified 4299
145 Ga0105241_10063899 3300009174 Unclassified 2841
146 Ga0105241_10225910 3300009174 Unclassified 1576
147 Ga0105241_10333693 3300009174 Unclassified 1311
148 Ga0105242_10025920 3300009176 Unclassified 4643
149 Ga0105248_10003374 3300009177 Bacteria 17740
150 Ga0105248_10019222 3300009177 Bacteria 7558
151 Ga0105248_10028507 3300009177 Bacteria 6221
152 Ga0105248_10266815 3300009177 Unclassified 1927
153 Ga0105237_10048776 3300009545 Bacteria 4256
154 Ga0105237_10162765 3300009545 Bacteria 2230
155 Ga0105238_10034553 3300009551 Bacteria 5143
156 Ga0105238_10159731 3300009551 Unclassified 2229
157 Ga0105249_10003242 3300009553 Bacteria 14097
158 Ga0105249_10260942 3300009553 Unclassified 1722
159 Ga0105239_10031349 3300010375 Bacteria 5847
160 Ga0105239_10214947 3300010375 Unclassified 2155
161 Ga0105239_10346955 3300010375 Bacteria 1676
162 Ga0105239_10711845 3300010375 Bacteria 1148
163 Ga0105246_10175058 3300011119 Bacteria 1647
164 Ga0157373_10098903 3300013100 Unclassified 2053
165 Ga0157374_10103711 3300013296 Bacteria 2729
166 Ga0157374_10624710 3300013296 Unclassified 1088
167 Ga0157378_10118820 3300013297 Unclassified 2434
168 Ga0157378_10348618 3300013297 Unclassified 1446
169 Ga0163162_10120881 3300013306 Bacteria 2723
170 Ga0157372_10178231 3300013307 Unclassified 2460
171 Ga0157375_10611615 3300013308 Bacteria 1248
172 Ga0163163_10003830 3300014325 Bacteria 12806
173 Ga0163163_10005740 3300014325 Bacteria 10769
174 Ga0163163_10041259 3300014325 Bacteria 4512
175 Ga0163163_10155516 3300014325 Bacteria 2331
176 Ga0163163_10187496 3300014325 Bacteria 2116
177 Ga0163163_10246280 3300014325 Unclassified 1837
178 Ga0157380_10271462 3300014326 Bacteria 1546
179 Ga0182008_10038215 3300014497 Bacteria 2401
180 Ga0157377_10100450 3300014745 Bacteria 1723
181 Ga0157376_10106026 3300014969 Bacteria 2465
182 Ga0157376_10195170 3300014969 Unclassified 1859
183 Ga0182006_1097083 3300015261 Unclassified 1051
184 Ga0182007_10011790 3300015262 Bacteria 3387
185 Ga0163161_10083259 3300017792 Bacteria 2358
186 Ga0213871_10007623 3300021441 Bacteria 2351
187 Ga0224712_10154196 3300022467 Bacteria 1020
188 Ga0228598_1000303 3300024227 Bacteria 9589
189 Ga0207697_10106627 3300025315 Bacteria 1198
190 Ga0207692_10000820 3300025898 Bacteria 11129
191 Ga0207710_10000521 3300025900 Bacteria 23589
192 Ga0207688_10174972 3300025901 Unclassified 1278
193 Ga0207680_10037221 3300025903 Bacteria 2808
194 Ga0207680_10129636 3300025903 Bacteria 1661
195 Ga0207647_10236723 3300025904 Bacteria 1049
196 Ga0207685_10024028 3300025905 Bacteria 2083
197 Ga0207699_10088224 3300025906 Unclassified 1941
198 Ga0207643_10158052 3300025908 Unclassified 1362
199 Ga0207643_10192063 3300025908 Bacteria 1240
200 Ga0207684_10000973 3300025910 Bacteria 32084
201 Ga0207684_10021975 3300025910 Bacteria 5448
202 Ga0207684_10024724 3300025910 Bacteria 5121
203 Ga0207654_10079536 3300025911 Unclassified 1969
204 Ga0207654_10315618 3300025911 Unclassified 1067
205 Ga0207707_10000190 3300025912 Bacteria 64802
206 Ga0207707_10007393 3300025912 Bacteria 9568
207 Ga0207707_10034399 3300025912 Bacteria 4433
208 Ga0207695_10296536 3300025913 Bacteria 1508
209 Ga0207671_10112600 3300025914 Bacteria 2072
210 Ga0207693_10032918 3300025915 Bacteria 4091
211 Ga0207693_10186681 3300025915 Unclassified 1632
212 Ga0207663_10063371 3300025916 Bacteria 2354
213 Ga0207663_10383955 3300025916 Unclassified 1070
214 Ga0207660_10000117 3300025917 Bacteria 46029
215 Ga0207660_10047118 3300025917 Unclassified 3045
216 Ga0207657_10006751 3300025919 Bacteria 11856
217 Ga0207652_10000028 3300025921 Bacteria 150429
218 Ga0207652_10347397 3300025921 Unclassified 1339
219 Ga0207646_10003275 3300025922 Bacteria 18448
220 Ga0207646_10007050 3300025922 Bacteria 11497
221 Ga0207646_10051530 3300025922 Bacteria 3683
222 Ga0207646_10145645 3300025922 Bacteria 2134
223 Ga0207646_10255374 3300025922 Bacteria 1584
224 Ga0207681_10008483 3300025923 Bacteria 6280
225 Ga0207650_10000061 3300025925 Bacteria 149822
226 Ga0207687_10000141 3300025927 Bacteria 48006
227 Ga0207700_10003903 3300025928 Bacteria 8708
228 Ga0207700_10005864 3300025928 Bacteria 7384
229 Ga0207700_10046658 3300025928 Bacteria 3206
230 Ga0207700_10383082 3300025928 Unclassified 1230
231 Ga0207644_10054580 3300025931 Bacteria 2879
232 Ga0207644_10483134 3300025931 Bacteria 1020
233 Ga0207706_10038557 3300025933 Unclassified 4238
234 Ga0207706_10273823 3300025933 Bacteria 1473
235 Ga0207686_10010216 3300025934 Bacteria 5105
236 Ga0207686_10256939 3300025934 Bacteria 1279
237 Ga0207670_10200588 3300025936 Bacteria 1516
238 Ga0207665_10014915 3300025939 Bacteria 5105
239 Ga0207665_10065117 3300025939 Bacteria 2477
240 Ga0207665_10104651 3300025939 Unclassified 1981
241 Ga0207665_10289223 3300025939 Unclassified 1222
242 Ga0207665_10564853 3300025939 Unclassified 885
243 Ga0207691_10003856 3300025940 Bacteria 14550
244 Ga0207711_10018023 3300025941 Bacteria 5868
245 Ga0207711_10136048 3300025941 Unclassified 2207
246 Ga0207711_10477375 3300025941 Bacteria 1161
247 Ga0207689_10001152 3300025942 Bacteria 25444
248 Ga0207689_10020009 3300025942 Bacteria 5638
249 Ga0207689_10476360 3300025942 Unclassified 1045
250 Ga0207679_10142363 3300025945 Unclassified 1940
251 Ga0207651_10168456 3300025960 Bacteria 1725
252 Ga0207712_10122433 3300025961 Bacteria 1970
253 Ga0207712_10125444 3300025961 Bacteria 1948
254 Ga0207703_10023777 3300026035 Unclassified 4820
255 Ga0207703_10068739 3300026035 Bacteria 2919
256 Ga0207703_10156357 3300026035 Bacteria 1993
257 Ga0207703_10708663 3300026035 Unclassified 957
258 Ga0207639_10047885 3300026041 Unclassified 3233
259 Ga0207639_10080610 3300026041 Unclassified 2575
260 Ga0207639_10506571 3300026041 Bacteria 1104
261 Ga0207708_10032296 3300026075 Bacteria 3976
262 Ga0207702_10001513 3300026078 Bacteria 22979
263 Ga0207702_10008584 3300026078 Bacteria 8614
264 Ga0207702_10110588 3300026078 Bacteria 2442
265 Ga0207641_10016687 3300026088 Bacteria 6013
266 Ga0207641_10513672 3300026088 Unclassified 1165
267 Ga0207648_10018216 3300026089 Bacteria 6361
268 Ga0207648_10254304 3300026089 Bacteria 1567
269 Ga0207676_10048768 3300026095 Unclassified 3289
270 Ga0207676_10509384 3300026095 Bacteria 1144
271 Ga0207674_10341845 3300026116 Bacteria 1447
272 Ga0207675_100003882 3300026118 Bacteria 14530
273 Ga0207675_100024164 3300026118 Bacteria 5650
274 Ga0207698_10036131 3300026142 Bacteria 3623
275 Ga0207428_10005364 3300027907 Bacteria 11964
276 Ga0268266_10090452 3300028379 Bacteria 2683
277 Ga0268265_10100912 3300028380 Bacteria 2331
278 Ga0268265_10409535 3300028380 Bacteria 1256
279 Ga0268264_10027218 3300028381 Unclassified 4669
280 Ga0265762_1017540 3300030760 Bacteria 1303
281 Ga0265762_1046195 3300030760 Unclassified 863
282 Ga0265760_10001276 3300031090 Bacteria 7364
283 Ga0265760_10004746 3300031090 Unclassified 3894
284 Ga0265760_10026531 3300031090 Viruses 1695
285 Ga0307407_10104121 3300031903 Bacteria 1768
286 Ga0307416_100477585 3300032002 Bacteria 1306
287 Ga0373951_0007159 3300035091 Bacteria 2538
288 Ga0373956_0010215 3300035119 Bacteria 3840
289 Ga0373955_0047296 3300035172 Bacteria 2329
290 Ga0373927_0066423 3300035695 Bacteria 2333
291 Ga0373927_0476602 3300035695 Unclassified 825
292 Ga0373947_0534807 3300035725 Bacteria 797
293 Ga0373937_0057281 3300036401 Unclassified 3580
294 Ga0395900_0121168 3300037418 Bacteria 2684
295 Ga0395898_0060913 3300037466 Bacteria 3667
296 Ga0395898_0178281 3300037466 Unclassified 2031
297 Ga0395901_0169513 3300038443 Bacteria 2291
298 Ga0242422_01045 3300038699 Bacteria 1886
299 Ga0242420_008052 3300038996 Bacteria 1702
300 Ga0436360_1133811 3300039438 Bacteria 9302
301 Ga0436363_1570361 3300039450 Bacteria 2175
302 Ga0453683_0143153 3300044673 Unclassified 1509
303 Ga0466963_0314347 3300044694 Bacteria 1102
304 Ga0451576_0185902 3300045051 Bacteria 2170
305 Ga0495580_0002658 3300046472 Bacteria 15508
306 Ga0495669_0068184 3300046684 Bacteria 1618
307 Ga0495669_0235652 3300046684 Unclassified 878
308 Ga0496102_0186702 3300048905 Unclassified 1954
309 Ga0496103_0103826 3300048906 Unclassified 1801
310 Ga0496103_0411101 3300048906 Unclassified 869
311 Ga0496104_0274668 3300048907 Unclassified 1598
312 Ga0496104_0337568 3300048907 Bacteria 1420
313 Ga0496105_0250592 3300048908 Unclassified 1435
314 Ga0496106_0128129 3300048909 Unclassified 1989
315 Ga0496108_0122528 3300048911 Unclassified 2231
316 Ga0496111_0094675 3300048914 Unclassified 2191
317 Ga0496112_0205235 3300048915 Unclassified 1929
318 nmdc:mga05p37_553657_c1 3300050507 Unclassified 1309
319 nmdc:mga05p37_599185_c1 3300050507 Bacteria 1244
320 nmdc:mga05p37_676458_c1 3300050507 Bacteria 1151
321 nmdc:mga05p37_789536_c1 3300050507 Unclassified 1040
322 nmdc:mga08y16_608_c1 3300050511 Bacteria 33357
323 nmdc:mga0n895_17170_c1 3300050512 Bacteria 6668
324 nmdc:mga0n895_185310_c1 3300050512 Bacteria 2112
325 nmdc:mga0n895_267931_c1 3300050512 Bacteria 1733
326 nmdc:mga0n895_33003_c1 3300050512 Bacteria 4972
327 nmdc:mga0rr50_140_c1 3300050513 Bacteria 39942
328 nmdc:mga0rr50_19118_c1 3300050513 Bacteria 4617
329 nmdc:mga0rr50_604799_c1 3300050513 Bacteria 935
330 nmdc:mga08x19_22938_c1 3300050514 Bacteria 3870
331 nmdc:mga0a205_10359_c1 3300050515 Bacteria 4112
332 nmdc:mga0a205_366937_c1 3300050515 Bacteria 1306
333 nmdc:mga0a205_3975_c1 3300050515 Bacteria 13222
334 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0066423 Ga0373927_0066423_18_641 207
2 3300005293 Ga0065715_10128015 Ga0065715_101280152 226
3 3300005438 Ga0070701_10133771 Ga0070701_101337712 226
4 3300005842 Ga0068858_100164386 Ga0068858_1001643862 226
5 3300009101 Ga0105247_10000823 Ga0105247_100008238 226
6 3300009177 Ga0105248_10266815 Ga0105248_102668152 226
7 3300025900 Ga0207710_10000521 Ga0207710_100005218 226
8 3300025901 Ga0207688_10174972 Ga0207688_101749722 226
9 3300025941 Ga0207711_10136048 Ga0207711_101360482 226
10 3300005293 Ga0065715_10153367 Ga0065715_101533672 227
11 3300005530 Ga0070679_100251159 Ga0070679_1002511592 228
12 3300005564 Ga0070664_100279558 Ga0070664_1002795582 228
13 3300005614 Ga0068856_100232271 Ga0068856_1002322712 228
14 3300005718 Ga0068866_10267636 Ga0068866_102676362 228
15 3300013296 Ga0157374_10103711 Ga0157374_101037112 228
16 3300025921 Ga0207652_10347397 Ga0207652_103473972 228
17 3300026078 Ga0207702_10110588 Ga0207702_101105882 228
18 3300005445 Ga0070708_100474152 Ga0070708_1004741522 229
19 3300005467 Ga0070706_100038427 Ga0070706_1000384273 229
20 3300005468 Ga0070707_100010317 Ga0070707_1000103178 229
21 3300005617 Ga0068859_100159924 Ga0068859_1001599243 229
22 3300006931 Ga0097620_100159911 Ga0097620_1001599112 229
23 3300025910 Ga0207684_10021975 Ga0207684_100219753 229
24 3300025922 Ga0207646_10145645 Ga0207646_101456454 229
25 3300048907 Ga0496104_0337568 Ga0496104_0337568_92_892 229
26 3300009174 Ga0105241_10225910 Ga0105241_102259102 231
27 3300013296 Ga0157374_10624710 Ga0157374_106247101 231
28 3300013297 Ga0157378_10348618 Ga0157378_103486182 231
29 3300048915 Ga0496112_0205235 Ga0496112_0205235_644_1342 231
30 3300005844 Ga0068862_100301245 Ga0068862_1003012452 232
31 3300026089 Ga0207648_10254304 Ga0207648_102543041 232
32 3300028380 Ga0268265_10409535 Ga0268265_104095351 232
33 3300006028 Ga0070717_10035236 Ga0070717_100352363 233
34 3300026041 Ga0207639_10047885 Ga0207639_100478855 234
35 3300026078 Ga0207702_10008584 Ga0207702_100085845 234
36 3300048911 Ga0496108_0122528 Ga0496108_0122528_1023_1808 234
37 3300046684 Ga0495669_0235652 Ga0495669_0235652_52_765 235
38 3300002459 JGI24751J29686_10000138 JGI24751J29686_1000013821 236
39 3300005331 Ga0070670_100000229 Ga0070670_1000002295 236
40 3300014325 Ga0163163_10003830 Ga0163163_100038305 236
41 3300025925 Ga0207650_10000061 Ga0207650_1000006199 236
42 3300050507 nmdc:mga05p37_599185_c1 nmdc:mga05p37_599185_c1_361_1077 236
43 3300050513 nmdc:mga0rr50_140_c1 nmdc:mga0rr50_140_c1_29129_29845 236
44 3300050515 nmdc:mga0a205_3975_c1 nmdc:mga0a205_3975_c1_12352_13068 236
45 3300005434 Ga0070709_10029031 Ga0070709_100290313 237
46 3300005436 Ga0070713_100041409 Ga0070713_1000414093 237
47 3300005436 Ga0070713_100296996 Ga0070713_1002969962 237
48 3300005439 Ga0070711_100137237 Ga0070711_1001372371 237
49 3300005614 Ga0068856_100222571 Ga0068856_1002225712 237
50 3300006163 Ga0070715_10086453 Ga0070715_100864531 237
51 3300025915 Ga0207693_10186681 Ga0207693_101866812 237
52 3300025916 Ga0207663_10063371 Ga0207663_100633712 237
53 3300025927 Ga0207687_10000141 Ga0207687_100001417 237
54 3300025928 Ga0207700_10005864 Ga0207700_100058644 237
55 3300025928 Ga0207700_10383082 Ga0207700_103830821 237
56 3300025939 Ga0207665_10014915 Ga0207665_100149152 237
57 3300050507 nmdc:mga05p37_789536_c1 nmdc:mga05p37_789536_c1_131_856 237
58 3300010375 Ga0105239_10711845 Ga0105239_107118452 239
59 3300013306 Ga0163162_10120881 Ga0163162_101208812 239
60 3300025904 Ga0207647_10236723 Ga0207647_102367231 239
61 3300025933 Ga0207706_10273823 Ga0207706_102738231 239
62 3300035119 Ga0373956_0010215 Ga0373956_0010215_3033_3755 239
63 3300035172 Ga0373955_0047296 Ga0373955_0047296_78_800 239
64 3300037418 Ga0395900_0121168 Ga0395900_0121168_310_1086 239
65 3300037466 Ga0395898_0060913 Ga0395898_0060913_798_1574 239
66 3300038443 Ga0395901_0169513 Ga0395901_0169513_240_1016 239
67 3300005437 Ga0070710_10000598 Ga0070710_1000059815 240
68 3300005441 Ga0070700_100668590 Ga0070700_1006685901 240
69 3300006852 Ga0075433_10364320 Ga0075433_103643202 240
70 3300025898 Ga0207692_10000820 Ga0207692_100008201 240
71 3300026142 Ga0207698_10036131 Ga0207698_100361314 240
72 3300030760 Ga0265762_1017540 Ga0265762_10175401 240
73 3300030760 Ga0265762_1046195 Ga0265762_10461951 240
74 3300031090 Ga0265760_10001276 Ga0265760_100012764 240
75 3300035695 Ga0373927_0476602 Ga0373927_0476602_26_760 240
76 3300006173 Ga0070716_100558106 Ga0070716_1005581061 241
77 3300009174 Ga0105241_10063899 Ga0105241_100638993 241
78 3300025911 Ga0207654_10079536 Ga0207654_100795362 241
79 3300025939 Ga0207665_10564853 Ga0207665_105648531 241
80 3300044694 Ga0466963_0314347 Ga0466963_0314347_40_765 241
81 iso_pu_bacteria 2513237098 2513679720 241
82 3300005439 Ga0070711_100125465 Ga0070711_1001254652 242
83 3300005445 Ga0070708_100023230 Ga0070708_1000232303 242
84 3300006175 Ga0070712_100054242 Ga0070712_1000542422 242
85 3300006175 Ga0070712_100078749 Ga0070712_1000787491 242
86 3300014325 Ga0163163_10041259 Ga0163163_100412592 242
87 3300022467 Ga0224712_10154196 Ga0224712_101541961 242
88 3300025905 Ga0207685_10024028 Ga0207685_100240283 242
89 3300025915 Ga0207693_10032918 Ga0207693_100329184 242
90 3300025916 Ga0207663_10383955 Ga0207663_103839551 242
91 3300048905 Ga0496102_0186702 Ga0496102_0186702_1085_1819 242
92 3300048906 Ga0496103_0411101 Ga0496103_0411101_103_837 242
93 3300048907 Ga0496104_0274668 Ga0496104_0274668_814_1548 242
94 iso_pu_bacteria 2524023210 2524464934 242
95 iso_pu_bacteria 2885383462 2885387354 242
96 iso_pu_bacteria 8056681323 8056689637 242
97 3300005331 Ga0070670_100256816 Ga0070670_1002568161 243
98 3300005344 Ga0070661_100109798 Ga0070661_1001097982 243
99 3300005347 Ga0070668_100239629 Ga0070668_1002396292 243
100 3300005434 Ga0070709_10373279 Ga0070709_103732791 243
101 3300005435 Ga0070714_100159676 Ga0070714_1001596762 243
102 3300005435 Ga0070714_100659306 Ga0070714_1006593061 243
103 3300005436 Ga0070713_100036044 Ga0070713_1000360442 243
104 3300005436 Ga0070713_100049797 Ga0070713_1000497973 243
105 3300005444 Ga0070694_100043519 Ga0070694_1000435192 243
106 3300005445 Ga0070708_100098796 Ga0070708_1000987962 243
107 3300005445 Ga0070708_100130605 Ga0070708_1001306053 243
108 3300005457 Ga0070662_100128385 Ga0070662_1001283852 243
109 3300005467 Ga0070706_100057207 Ga0070706_1000572075 243
110 3300005468 Ga0070707_100034566 Ga0070707_1000345663 243
111 3300005468 Ga0070707_100249462 Ga0070707_1002494622 243
112 3300005471 Ga0070698_100183339 Ga0070698_1001833391 243
113 3300005518 Ga0070699_100020286 Ga0070699_1000202862 243
114 3300005536 Ga0070697_100019394 Ga0070697_1000193944 243
115 3300005536 Ga0070697_100307453 Ga0070697_1003074532 243
116 3300005536 Ga0070697_100399301 Ga0070697_1003993012 243
117 3300005539 Ga0068853_100530587 Ga0068853_1005305872 243
118 3300005546 Ga0070696_100161933 Ga0070696_1001619332 243
119 3300005564 Ga0070664_100071497 Ga0070664_1000714972 243
120 3300005614 Ga0068856_100001532 Ga0068856_10000153224 243
121 3300005841 Ga0068863_100280403 Ga0068863_1002804032 243
122 3300006028 Ga0070717_10053889 Ga0070717_100538893 243
123 3300006028 Ga0070717_10137457 Ga0070717_101374572 243
124 3300006173 Ga0070716_100250901 Ga0070716_1002509012 243
125 3300006852 Ga0075433_10008310 Ga0075433_1000831010 243
126 3300006871 Ga0075434_100000235 Ga0075434_10000023523 243
127 3300006871 Ga0075434_100004271 Ga0075434_10000427110 243
128 3300006914 Ga0075436_100005980 Ga0075436_1000059803 243
129 3300006914 Ga0075436_100037125 Ga0075436_1000371252 243
130 3300006914 Ga0075436_100296556 Ga0075436_1002965562 243
131 3300007076 Ga0075435_100003821 Ga0075435_1000038216 243
132 3300007076 Ga0075435_100007962 Ga0075435_1000079626 243
133 3300007076 Ga0075435_100283365 Ga0075435_1002833651 243
134 3300007265 Ga0099794_10033140 Ga0099794_100331402 243
135 3300007788 Ga0099795_10003415 Ga0099795_100034154 243
136 3300009093 Ga0105240_10047360 Ga0105240_100473602 243
137 3300009093 Ga0105240_10661300 Ga0105240_106613001 243
138 3300009147 Ga0114129_10298742 Ga0114129_102987422 243
139 3300009545 Ga0105237_10162765 Ga0105237_101627652 243
140 3300009551 Ga0105238_10034553 Ga0105238_100345535 243
141 3300009551 Ga0105238_10159731 Ga0105238_101597312 243
142 3300010375 Ga0105239_10214947 Ga0105239_102149472 243
143 3300013297 Ga0157378_10118820 Ga0157378_101188202 243
144 3300013307 Ga0157372_10178231 Ga0157372_101782312 243
145 3300014497 Ga0182008_10038215 Ga0182008_100382153 243
146 3300015261 Ga0182006_1097083 Ga0182006_10970831 243
147 3300015262 Ga0182007_10011790 Ga0182007_100117903 243
148 3300021441 Ga0213871_10007623 Ga0213871_100076232 243
149 3300024227 Ga0228598_1000303 Ga0228598_10003035 243
150 3300025906 Ga0207699_10088224 Ga0207699_100882241 243
151 3300025910 Ga0207684_10000973 Ga0207684_1000097315 243
152 3300025910 Ga0207684_10024724 Ga0207684_100247245 243
153 3300025912 Ga0207707_10034399 Ga0207707_100343992 243
154 3300025914 Ga0207671_10112600 Ga0207671_101126002 243
155 3300025917 Ga0207660_10047118 Ga0207660_100471182 243
156 3300025919 Ga0207657_10006751 Ga0207657_1000675110 243
157 3300025922 Ga0207646_10003275 Ga0207646_100032754 243
158 3300025922 Ga0207646_10007050 Ga0207646_100070508 243
159 3300025922 Ga0207646_10255374 Ga0207646_102553742 243
160 3300025928 Ga0207700_10003903 Ga0207700_100039039 243
161 3300025928 Ga0207700_10046658 Ga0207700_100466583 243
162 3300025931 Ga0207644_10054580 Ga0207644_100545802 243
163 3300025933 Ga0207706_10038557 Ga0207706_100385573 243
164 3300025939 Ga0207665_10065117 Ga0207665_100651172 243
165 3300025939 Ga0207665_10104651 Ga0207665_101046511 243
166 3300025945 Ga0207679_10142363 Ga0207679_101423632 243
167 3300026041 Ga0207639_10080610 Ga0207639_100806102 243
168 3300026078 Ga0207702_10001513 Ga0207702_1000151313 243
169 3300026116 Ga0207674_10341845 Ga0207674_103418451 243
170 3300031090 Ga0265760_10004746 Ga0265760_100047462 243
171 3300031090 Ga0265760_10026531 Ga0265760_100265312 243
172 3300035725 Ga0373947_0534807 Ga0373947_0534807_41_778 243
173 3300037466 Ga0395898_0178281 Ga0395898_0178281_1202_1939 243
174 3300039438 Ga0436360_1133811 Ga0436360_1133811_7132_7869 243
175 3300039450 Ga0436363_1570361 Ga0436363_1570361_331_1164 243
176 3300044673 Ga0453683_0143153 Ga0453683_0143153_291_1022 243
177 3300045051 Ga0451576_0185902 Ga0451576_0185902_495_1262 243
178 3300046472 Ga0495580_0002658 Ga0495580_0002658_4331_5065 243
179 3300048906 Ga0496103_0103826 Ga0496103_0103826_215_952 243
180 3300048908 Ga0496105_0250592 Ga0496105_0250592_403_1140 243
181 3300048909 Ga0496106_0128129 Ga0496106_0128129_705_1442 243
182 3300048914 Ga0496111_0094675 Ga0496111_0094675_629_1366 243
183 3300050507 nmdc:mga05p37_676458_c1 nmdc:mga05p37_676458_c1_249_986 243
184 3300050512 nmdc:mga0n895_17170_c1 nmdc:mga0n895_17170_c1_1770_2507 243
185 3300050513 nmdc:mga0rr50_19118_c1 nmdc:mga0rr50_19118_c1_72_809 243
186 3300050513 nmdc:mga0rr50_604799_c1 nmdc:mga0rr50_604799_c1_135_866 243
187 3300050514 nmdc:mga08x19_22938_c1 nmdc:mga08x19_22938_c1_189_926 243
188 3300050515 nmdc:mga0a205_449_c1 nmdc:mga0a205_449_c1_22143_22880 243
189 3300005518 Ga0070699_100223433 Ga0070699_1002234331 244
190 3300006852 Ga0075433_10332841 Ga0075433_103328412 244
191 3300009147 Ga0114129_10315325 Ga0114129_103153251 244
192 3300009177 Ga0105248_10019222 Ga0105248_100192227 244
193 3300025941 Ga0207711_10018023 Ga0207711_100180234 244
194 3300050515 nmdc:mga0a205_366937_c1 nmdc:mga0a205_366937_c1_61_801 244
195 3300005356 Ga0070674_100145037 Ga0070674_1001450372 245
196 3300005438 Ga0070701_10272653 Ga0070701_102726531 245
197 3300005456 Ga0070678_100324375 Ga0070678_1003243752 245
198 3300009553 Ga0105249_10003242 Ga0105249_100032423 245
199 3300010375 Ga0105239_10031349 Ga0105239_100313495 245
200 3300014325 Ga0163163_10246280 Ga0163163_102462801 245
201 3300026089 Ga0207648_10018216 Ga0207648_100182165 245
202 3300005293 Ga0065715_10095260 Ga0065715_100952605 246
203 3300005334 Ga0068869_100203372 Ga0068869_1002033721 246
204 3300005335 Ga0070666_10339565 Ga0070666_103395651 246
205 3300005338 Ga0068868_100036419 Ga0068868_1000364192 246
206 3300005367 Ga0070667_100265130 Ga0070667_1002651302 246
207 3300005547 Ga0070693_100078193 Ga0070693_1000781932 246
208 3300005615 Ga0070702_100037362 Ga0070702_1000373622 246
209 3300005617 Ga0068859_100061163 Ga0068859_1000611633 246
210 3300005618 Ga0068864_100002523 Ga0068864_1000025235 246
211 3300005842 Ga0068858_100023723 Ga0068858_1000237235 246
212 3300006931 Ga0097620_100061163 Ga0097620_1000611633 246
213 3300009177 Ga0105248_10003374 Ga0105248_100033742 246
214 3300014969 Ga0157376_10106026 Ga0157376_101060262 246
215 3300025903 Ga0207680_10037221 Ga0207680_100372213 246
216 3300025931 Ga0207644_10483134 Ga0207644_104831342 246
217 3300025934 Ga0207686_10256939 Ga0207686_102569392 246
218 3300025936 Ga0207670_10200588 Ga0207670_102005882 246
219 3300025941 Ga0207711_10477375 Ga0207711_104773752 246
220 3300025942 Ga0207689_10020009 Ga0207689_100200095 246
221 3300026035 Ga0207703_10068739 Ga0207703_100687392 246
222 3300026095 Ga0207676_10048768 Ga0207676_100487683 246
223 3300028379 Ga0268266_10090452 Ga0268266_100904522 246
224 3300036401 Ga0373937_0057281 Ga0373937_0057281_2557_3345 246
225 3300005466 Ga0070685_10015743 Ga0070685_100157432 248
226 3300013308 Ga0157375_10611615 Ga0157375_106116151 248
227 3300005468 Ga0070707_100121543 Ga0070707_1001215432 249
228 3300005440 Ga0070705_100251310 Ga0070705_1002513102 250
229 3300005547 Ga0070693_100006950 Ga0070693_1000069505 250
230 3300025939 Ga0207665_10289223 Ga0207665_102892232 250
231 3300005444 Ga0070694_100000029 Ga0070694_10000002916 251
232 3300005468 Ga0070707_100052287 Ga0070707_1000522873 251
233 3300025922 Ga0207646_10051530 Ga0207646_100515303 251
234 3300005340 Ga0070689_100388085 Ga0070689_1003880852 252
235 3300005343 Ga0070687_100014515 Ga0070687_1000145152 252
236 3300005617 Ga0068859_100051546 Ga0068859_1000515462 252
237 3300005844 Ga0068862_100160232 Ga0068862_1001602322 252
238 3300006931 Ga0097620_100051544 Ga0097620_1000515442 252
239 3300028380 Ga0268265_10100912 Ga0268265_101009122 252
240 3300035091 Ga0373951_0007159 Ga0373951_0007159_1230_1988 252
241 3300005290 Ga0065712_10074559 Ga0065712_100745592 253
242 3300005330 Ga0070690_100020784 Ga0070690_1000207845 253
243 3300005334 Ga0068869_100069396 Ga0068869_1000693962 253
244 3300005364 Ga0070673_100032262 Ga0070673_1000322621 253
245 3300005434 Ga0070709_10448709 Ga0070709_104487091 253
246 3300005518 Ga0070699_100029760 Ga0070699_1000297603 253
247 3300005539 Ga0068853_100252418 Ga0068853_1002524182 253
248 3300005617 Ga0068859_100034221 Ga0068859_1000342215 253
249 3300005618 Ga0068864_100033852 Ga0068864_1000338522 253
250 3300005718 Ga0068866_10008438 Ga0068866_100084382 253
251 3300005841 Ga0068863_100014158 Ga0068863_1000141583 253
252 3300005842 Ga0068858_100044131 Ga0068858_1000441312 253
253 3300005843 Ga0068860_100250259 Ga0068860_1002502592 253
254 3300005844 Ga0068862_100026619 Ga0068862_1000266192 253
255 3300006881 Ga0068865_100010397 Ga0068865_1000103975 253
256 3300006931 Ga0097620_100034221 Ga0097620_1000342212 253
257 3300009148 Ga0105243_10028333 Ga0105243_100283335 253
258 3300009176 Ga0105242_10025920 Ga0105242_100259202 253
259 3300009177 Ga0105248_10028507 Ga0105248_100285073 253
260 3300009553 Ga0105249_10260942 Ga0105249_102609422 253
261 3300010375 Ga0105239_10346955 Ga0105239_103469552 253
262 3300014325 Ga0163163_10155516 Ga0163163_101555162 253
263 3300014326 Ga0157380_10271462 Ga0157380_102714622 253
264 3300014969 Ga0157376_10195170 Ga0157376_101951702 253
265 3300017792 Ga0163161_10083259 Ga0163161_100832592 253
266 3300025903 Ga0207680_10129636 Ga0207680_101296362 253
267 3300025908 Ga0207643_10192063 Ga0207643_101920631 253
268 3300025934 Ga0207686_10010216 Ga0207686_100102165 253
269 3300025940 Ga0207691_10003856 Ga0207691_100038568 253
270 3300025942 Ga0207689_10001152 Ga0207689_100011527 253
271 3300025960 Ga0207651_10168456 Ga0207651_101684562 253
272 3300025961 Ga0207712_10122433 Ga0207712_101224331 253
273 3300025961 Ga0207712_10125444 Ga0207712_101254442 253
274 3300026035 Ga0207703_10023777 Ga0207703_100237772 253
275 3300026035 Ga0207703_10156357 Ga0207703_101563572 253
276 3300026075 Ga0207708_10032296 Ga0207708_100322963 253
277 3300026088 Ga0207641_10016687 Ga0207641_100166875 253
278 3300026118 Ga0207675_100003882 Ga0207675_10000388213 253
279 3300026118 Ga0207675_100024164 Ga0207675_1000241646 253
280 3300028381 Ga0268264_10027218 Ga0268264_100272185 253
281 3300005288 Ga0065714_10002189 Ga0065714_1000218926 254
282 3300005290 Ga0065712_10067733 Ga0065712_1006773318 254
283 3300005293 Ga0065715_10100737 Ga0065715_101007372 254
284 3300005343 Ga0070687_100293248 Ga0070687_1002932481 254
285 3300005458 Ga0070681_10002508 Ga0070681_100025086 254
286 3300005458 Ga0070681_10006112 Ga0070681_100061123 254
287 3300005530 Ga0070679_100000256 Ga0070679_10000025612 254
288 3300005549 Ga0070704_100231159 Ga0070704_1002311591 254
289 3300005549 Ga0070704_100242651 Ga0070704_1002426512 254
290 3300005549 Ga0070704_100296970 Ga0070704_1002969701 254
291 3300005617 Ga0068859_100050008 Ga0068859_1000500084 254
292 3300005618 Ga0068864_100656111 Ga0068864_1006561111 254
293 3300006852 Ga0075433_10014162 Ga0075433_100141628 254
294 3300006871 Ga0075434_100085149 Ga0075434_1000851492 254
295 3300006931 Ga0097620_100050006 Ga0097620_1000500064 254
296 3300009093 Ga0105240_10294798 Ga0105240_102947983 254
297 3300009147 Ga0114129_10016764 Ga0114129_100167642 254
298 3300009147 Ga0114129_10042658 Ga0114129_100426586 254
299 3300009545 Ga0105237_10048776 Ga0105237_100487763 254
300 3300013100 Ga0157373_10098903 Ga0157373_100989032 254
301 3300014325 Ga0163163_10005740 Ga0163163_100057403 254
302 3300014745 Ga0157377_10100450 Ga0157377_101004502 254
303 3300025315 Ga0207697_10106627 Ga0207697_101066272 254
304 3300025912 Ga0207707_10000190 Ga0207707_1000019011 254
305 3300025912 Ga0207707_10007393 Ga0207707_100073936 254
306 3300025913 Ga0207695_10296536 Ga0207695_102965362 254
307 3300025917 Ga0207660_10000117 Ga0207660_100001174 254
308 3300025921 Ga0207652_10000028 Ga0207652_1000002881 254
309 3300025942 Ga0207689_10476360 Ga0207689_104763601 254
310 3300026035 Ga0207703_10708663 Ga0207703_107086631 254
311 3300026041 Ga0207639_10506571 Ga0207639_105065712 254
312 3300026095 Ga0207676_10509384 Ga0207676_105093841 254
313 3300031903 Ga0307407_10104121 Ga0307407_101041212 254
314 3300032002 Ga0307416_100477585 Ga0307416_1004775851 254
315 3300038699 Ga0242422_01045 Ga0242422_01045_589_1359 254
316 3300038996 Ga0242420_008052 Ga0242420_008052_204_974 254
317 3300046684 Ga0495669_0068184 Ga0495669_0068184_69_908 254
318 3300050507 nmdc:mga05p37_553657_c1 nmdc:mga05p37_553657_c1_312_1076 254
319 3300050512 nmdc:mga0n895_267931_c1 nmdc:mga0n895_267931_c1_250_1038 254
320 3300050515 nmdc:mga0a205_10359_c1 nmdc:mga0a205_10359_c1_441_1205 254
321 3300005841 Ga0068863_100128752 Ga0068863_1001287523 255
322 3300005985 Ga0081539_10005965 Ga0081539_1000596512 255
323 3300009174 Ga0105241_10333693 Ga0105241_103336932 255
324 3300011119 Ga0105246_10175058 Ga0105246_101750582 255
325 3300014325 Ga0163163_10187496 Ga0163163_101874962 255
326 3300025908 Ga0207643_10158052 Ga0207643_101580521 255
327 3300025911 Ga0207654_10315618 Ga0207654_103156182 255
328 3300025923 Ga0207681_10008483 Ga0207681_100084833 255
329 3300026088 Ga0207641_10513672 Ga0207641_105136722 255
330 3300050512 nmdc:mga0n895_33003_c1 nmdc:mga0n895_33003_c1_2952_3719 255
331 2162886007 SwRhRL2b_contig_762510 SwRhRL2b_0951.00005440 257
332 3300005289 Ga0065704_10000862 Ga0065704_100008626 257
333 3300005295 Ga0065707_10000700 Ga0065707_100007009 257
334 3300006871 Ga0075434_100125885 Ga0075434_1001258852 257
335 3300009094 Ga0111539_10001904 Ga0111539_1000190415 257
336 3300027907 Ga0207428_10005364 Ga0207428_1000536412 257
337 3300050511 nmdc:mga08y16_608_c1 nmdc:mga08y16_608_c1_8900_9673 257
338 3300050512 nmdc:mga0n895_185310_c1 nmdc:mga0n895_185310_c1_1234_2007 257

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ung-assembly1.cif.gz_5 48-nm repeat of the human respiratory doublet microtubule 0.5961 63 111
6s9v-assembly2.cif.gz_B crystal structure of sucrose 6f-phosphate phosphorylase from thermoanaerobacter thermosaccharolyticum 0.5798 64 108
6s9v-assembly1.cif.gz_A crystal structure of sucrose 6f-phosphate phosphorylase from thermoanaerobacter thermosaccharolyticum 0.5687 64 108
5eyy-assembly1.cif.gz_A-2 tetragonal form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome. 0.5285 75 108
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.5156 67 109
ID Description Score Start End Superfamily
af_P39310_121_209_3.10.450.350 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7399 176 213 3.10.450.350
af_Q4DYR6_268_320_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.6599 167 213 2.20.110.10
af_P0AFS9_92_178_3.10.450.350 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.629 177 222 3.10.450.350
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6227 45 247 3.40.605.10
af_Q9QXL8_17_111_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.5801 61 107 2.30.29.170
ID Description Score Start End GO Terms
AF-A0A534ZKA9-F1-model_v4 DUF3108 domain-containing protein 0.9822 57 257
AF-A0A534ZKA9-F1-model_v4 DUF3108 domain-containing protein 0.9727 57 257
AF-A0A2V5LBJ9-F1-model_v4 Uncharacterized protein 0.9668 84 257
AF-A0A2V6S4R5-F1-model_v4 Uncharacterized protein 0.9649 118 257
AF-A0A2V6S4R5-F1-model_v4 Uncharacterized protein 0.9517 118 257

Feature Viewer

pLDDT pTM Quality
84.45 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map