F413441
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 185 | 334 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100051546|Ga0068859_1000515462 |
| Length | 300 |
| Sequence | MGLILIKCSNWTFTTNATYYRLHLYTFNGLVGVIQQDIYLNAFEEEDSMTKLDQLKTICFLVFGVLVLAATSCSHQPASSPKPIAKTLTAEQIAKTYGLDSFGQIEAIRYTWNAQFPGVNISRKWVWEPKTGQVSYEGKDKYGKPVKATYFRTQLNTQPDIVKAELEPMFVNDNYWLLFPFHAYWDKSATVTDQGEKQLPQGNGSATLVSVEYPSEGGYTPADTWDLYIGKDDRVEQFVYHRGGPTKPSTVIATWEGYKKAGPLLISTDHNGTADGNPVRIFISDVAVKMSGSENWINAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 4 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 163 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 167 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.04 |
| Metatranscriptomes | 1.78 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.89 |
| Rhizoplane | 2.96 |
| Rhizosphere | 95.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_762510 | 2162886007 | Bacteria | 5776 |
| 2 | JGI24751J29686_10000138 | 3300002459 | Bacteria | 36181 |
| 3 | Ga0065714_10002189 | 3300005288 | Bacteria | 128055 |
| 4 | Ga0065704_10000862 | 3300005289 | Bacteria | 12469 |
| 5 | Ga0065712_10067733 | 3300005290 | Bacteria | 118568 |
| 6 | Ga0065712_10074559 | 3300005290 | Unclassified | 4063 |
| 7 | Ga0065715_10095260 | 3300005293 | Bacteria | 4126 |
| 8 | Ga0065715_10100737 | 3300005293 | Unclassified | 3271 |
| 9 | Ga0065715_10128015 | 3300005293 | Unclassified | 2058 |
| 10 | Ga0065715_10153367 | 3300005293 | Unclassified | 1704 |
| 11 | Ga0065707_10000700 | 3300005295 | Bacteria | 13888 |
| 12 | Ga0070690_100020784 | 3300005330 | Unclassified | 4002 |
| 13 | Ga0070670_100000229 | 3300005331 | Bacteria | 51545 |
| 14 | Ga0070670_100256816 | 3300005331 | Unclassified | 1523 |
| 15 | Ga0068869_100069396 | 3300005334 | Unclassified | 2606 |
| 16 | Ga0068869_100203372 | 3300005334 | Bacteria | 1563 |
| 17 | Ga0070666_10339565 | 3300005335 | Bacteria | 1073 |
| 18 | Ga0068868_100036419 | 3300005338 | Bacteria | 3808 |
| 19 | Ga0070689_100388085 | 3300005340 | Bacteria | 1178 |
| 20 | Ga0070687_100014515 | 3300005343 | Unclassified | 3539 |
| 21 | Ga0070687_100293248 | 3300005343 | Unclassified | 1029 |
| 22 | Ga0070661_100109798 | 3300005344 | Unclassified | 2059 |
| 23 | Ga0070668_100239629 | 3300005347 | Unclassified | 1502 |
| 24 | Ga0070674_100145037 | 3300005356 | Bacteria | 1786 |
| 25 | Ga0070673_100032262 | 3300005364 | Unclassified | 3941 |
| 26 | Ga0070667_100265130 | 3300005367 | Bacteria | 1539 |
| 27 | Ga0070709_10029031 | 3300005434 | Unclassified | 3304 |
| 28 | Ga0070709_10373279 | 3300005434 | Unclassified | 1059 |
| 29 | Ga0070709_10448709 | 3300005434 | Unclassified | 971 |
| 30 | Ga0070714_100159676 | 3300005435 | Unclassified | 2038 |
| 31 | Ga0070714_100659306 | 3300005435 | Unclassified | 1008 |
| 32 | Ga0070713_100036044 | 3300005436 | Unclassified | 3988 |
| 33 | Ga0070713_100041409 | 3300005436 | Unclassified | 3752 |
| 34 | Ga0070713_100049797 | 3300005436 | Unclassified | 3458 |
| 35 | Ga0070713_100296996 | 3300005436 | Bacteria | 1486 |
| 36 | Ga0070710_10000598 | 3300005437 | Bacteria | 17193 |
| 37 | Ga0070701_10133771 | 3300005438 | Unclassified | 1411 |
| 38 | Ga0070701_10272653 | 3300005438 | Bacteria | 1030 |
| 39 | Ga0070711_100125465 | 3300005439 | Unclassified | 1905 |
| 40 | Ga0070711_100137237 | 3300005439 | Bacteria | 1829 |
| 41 | Ga0070705_100251310 | 3300005440 | Unclassified | 1241 |
| 42 | Ga0070700_100668590 | 3300005441 | Bacteria | 822 |
| 43 | Ga0070694_100000029 | 3300005444 | Bacteria | 65647 |
| 44 | Ga0070694_100043519 | 3300005444 | Unclassified | 3003 |
| 45 | Ga0070708_100023230 | 3300005445 | Bacteria | 5270 |
| 46 | Ga0070708_100098796 | 3300005445 | Bacteria | 2669 |
| 47 | Ga0070708_100130605 | 3300005445 | Bacteria | 2324 |
| 48 | Ga0070708_100474152 | 3300005445 | Bacteria | 1181 |
| 49 | Ga0070678_100324375 | 3300005456 | Bacteria | 1316 |
| 50 | Ga0070662_100128385 | 3300005457 | Unclassified | 1951 |
| 51 | Ga0070681_10002508 | 3300005458 | Bacteria | 16826 |
| 52 | Ga0070681_10006112 | 3300005458 | Bacteria | 11683 |
| 53 | Ga0070685_10015743 | 3300005466 | Unclassified | 4021 |
| 54 | Ga0070706_100038427 | 3300005467 | Bacteria | 4417 |
| 55 | Ga0070706_100057207 | 3300005467 | Unclassified | 3598 |
| 56 | Ga0070707_100010317 | 3300005468 | Bacteria | 8697 |
| 57 | Ga0070707_100034566 | 3300005468 | Bacteria | 4821 |
| 58 | Ga0070707_100052287 | 3300005468 | Bacteria | 3916 |
| 59 | Ga0070707_100121543 | 3300005468 | Bacteria | 2536 |
| 60 | Ga0070707_100249462 | 3300005468 | Unclassified | 1727 |
| 61 | Ga0070698_100183339 | 3300005471 | Bacteria | 2031 |
| 62 | Ga0070699_100020286 | 3300005518 | Bacteria | 5731 |
| 63 | Ga0070699_100029760 | 3300005518 | Bacteria | 4710 |
| 64 | Ga0070699_100223433 | 3300005518 | Unclassified | 1678 |
| 65 | Ga0070679_100000256 | 3300005530 | Bacteria | 44524 |
| 66 | Ga0070679_100251159 | 3300005530 | Unclassified | 1725 |
| 67 | Ga0070697_100019394 | 3300005536 | Bacteria | 5372 |
| 68 | Ga0070697_100307453 | 3300005536 | Bacteria | 1363 |
| 69 | Ga0070697_100399301 | 3300005536 | Bacteria | 1193 |
| 70 | Ga0068853_100252418 | 3300005539 | Bacteria | 1619 |
| 71 | Ga0068853_100530587 | 3300005539 | Unclassified | 1113 |
| 72 | Ga0070696_100161933 | 3300005546 | Unclassified | 1649 |
| 73 | Ga0070693_100006950 | 3300005547 | Bacteria | 5505 |
| 74 | Ga0070693_100078193 | 3300005547 | Bacteria | 1965 |
| 75 | Ga0070704_100231159 | 3300005549 | Unclassified | 1509 |
| 76 | Ga0070704_100242651 | 3300005549 | Bacteria | 1475 |
| 77 | Ga0070704_100296970 | 3300005549 | Bacteria | 1344 |
| 78 | Ga0070664_100071497 | 3300005564 | Unclassified | 2973 |
| 79 | Ga0070664_100279558 | 3300005564 | Bacteria | 1505 |
| 80 | Ga0068856_100001532 | 3300005614 | Bacteria | 24221 |
| 81 | Ga0068856_100222571 | 3300005614 | Unclassified | 1902 |
| 82 | Ga0068856_100232271 | 3300005614 | Bacteria | 1860 |
| 83 | Ga0070702_100037362 | 3300005615 | Unclassified | 2697 |
| 84 | Ga0068859_100034221 | 3300005617 | Bacteria | 5100 |
| 85 | Ga0068859_100050008 | 3300005617 | Bacteria | 4199 |
| 86 | Ga0068859_100051546 | 3300005617 | Unclassified | 4137 |
| 87 | Ga0068859_100061163 | 3300005617 | Bacteria | 3794 |
| 88 | Ga0068859_100159924 | 3300005617 | Unclassified | 2331 |
| 89 | Ga0068864_100002523 | 3300005618 | Bacteria | 15123 |
| 90 | Ga0068864_100033852 | 3300005618 | Unclassified | 4344 |
| 91 | Ga0068864_100656111 | 3300005618 | Bacteria | 1022 |
| 92 | Ga0068866_10008438 | 3300005718 | Unclassified | 4344 |
| 93 | Ga0068866_10267636 | 3300005718 | Unclassified | 1053 |
| 94 | Ga0068863_100014158 | 3300005841 | Bacteria | 7684 |
| 95 | Ga0068863_100128752 | 3300005841 | Bacteria | 2416 |
| 96 | Ga0068863_100280403 | 3300005841 | Unclassified | 1614 |
| 97 | Ga0068858_100023723 | 3300005842 | Bacteria | 5715 |
| 98 | Ga0068858_100044131 | 3300005842 | Bacteria | 4133 |
| 99 | Ga0068858_100164386 | 3300005842 | Bacteria | 2091 |
| 100 | Ga0068860_100250259 | 3300005843 | Bacteria | 1725 |
| 101 | Ga0068862_100026619 | 3300005844 | Unclassified | 4861 |
| 102 | Ga0068862_100160232 | 3300005844 | Bacteria | 2008 |
| 103 | Ga0068862_100301245 | 3300005844 | Unclassified | 1475 |
| 104 | Ga0081539_10005965 | 3300005985 | Bacteria | 12012 |
| 105 | Ga0070717_10035236 | 3300006028 | Bacteria | 4050 |
| 106 | Ga0070717_10053889 | 3300006028 | Bacteria | 3316 |
| 107 | Ga0070717_10137457 | 3300006028 | Bacteria | 2106 |
| 108 | Ga0070715_10086453 | 3300006163 | Unclassified | 1434 |
| 109 | Ga0070716_100250901 | 3300006173 | Bacteria | 1205 |
| 110 | Ga0070716_100558106 | 3300006173 | Unclassified | 855 |
| 111 | Ga0070712_100054242 | 3300006175 | Bacteria | 2802 |
| 112 | Ga0070712_100078749 | 3300006175 | Bacteria | 2380 |
| 113 | Ga0075433_10008310 | 3300006852 | Bacteria | 8275 |
| 114 | Ga0075433_10014162 | 3300006852 | Bacteria | 6508 |
| 115 | Ga0075433_10332841 | 3300006852 | Bacteria | 1343 |
| 116 | Ga0075433_10364320 | 3300006852 | Unclassified | 1277 |
| 117 | Ga0075434_100000235 | 3300006871 | Bacteria | 38289 |
| 118 | Ga0075434_100004271 | 3300006871 | Bacteria | 12817 |
| 119 | Ga0075434_100085149 | 3300006871 | Bacteria | 3160 |
| 120 | Ga0075434_100125885 | 3300006871 | Bacteria | 2579 |
| 121 | Ga0068865_100010397 | 3300006881 | Bacteria | 5792 |
| 122 | Ga0075436_100005980 | 3300006914 | Bacteria | 8355 |
| 123 | Ga0075436_100037125 | 3300006914 | Bacteria | 3364 |
| 124 | Ga0075436_100296556 | 3300006914 | Unclassified | 1158 |
| 125 | Ga0097620_100034221 | 3300006931 | Bacteria | 5100 |
| 126 | Ga0097620_100050006 | 3300006931 | Bacteria | 4199 |
| 127 | Ga0097620_100051544 | 3300006931 | Unclassified | 4137 |
| 128 | Ga0097620_100061163 | 3300006931 | Bacteria | 3794 |
| 129 | Ga0097620_100159911 | 3300006931 | Unclassified | 2331 |
| 130 | Ga0075435_100003821 | 3300007076 | Bacteria | 10277 |
| 131 | Ga0075435_100007962 | 3300007076 | Bacteria | 7584 |
| 132 | Ga0075435_100283365 | 3300007076 | Bacteria | 1415 |
| 133 | Ga0099794_10033140 | 3300007265 | Bacteria | 2428 |
| 134 | Ga0099795_10003415 | 3300007788 | Bacteria | 3927 |
| 135 | Ga0105240_10047360 | 3300009093 | Bacteria | 5441 |
| 136 | Ga0105240_10294798 | 3300009093 | Bacteria | 1858 |
| 137 | Ga0105240_10661300 | 3300009093 | Unclassified | 1144 |
| 138 | Ga0111539_10001904 | 3300009094 | Bacteria | 27778 |
| 139 | Ga0105247_10000823 | 3300009101 | Bacteria | 23675 |
| 140 | Ga0114129_10016764 | 3300009147 | Bacteria | 10430 |
| 141 | Ga0114129_10042658 | 3300009147 | Bacteria | 6385 |
| 142 | Ga0114129_10298742 | 3300009147 | Bacteria | 2147 |
| 143 | Ga0114129_10315325 | 3300009147 | Bacteria | 2080 |
| 144 | Ga0105243_10028333 | 3300009148 | Unclassified | 4299 |
| 145 | Ga0105241_10063899 | 3300009174 | Unclassified | 2841 |
| 146 | Ga0105241_10225910 | 3300009174 | Unclassified | 1576 |
| 147 | Ga0105241_10333693 | 3300009174 | Unclassified | 1311 |
| 148 | Ga0105242_10025920 | 3300009176 | Unclassified | 4643 |
| 149 | Ga0105248_10003374 | 3300009177 | Bacteria | 17740 |
| 150 | Ga0105248_10019222 | 3300009177 | Bacteria | 7558 |
| 151 | Ga0105248_10028507 | 3300009177 | Bacteria | 6221 |
| 152 | Ga0105248_10266815 | 3300009177 | Unclassified | 1927 |
| 153 | Ga0105237_10048776 | 3300009545 | Bacteria | 4256 |
| 154 | Ga0105237_10162765 | 3300009545 | Bacteria | 2230 |
| 155 | Ga0105238_10034553 | 3300009551 | Bacteria | 5143 |
| 156 | Ga0105238_10159731 | 3300009551 | Unclassified | 2229 |
| 157 | Ga0105249_10003242 | 3300009553 | Bacteria | 14097 |
| 158 | Ga0105249_10260942 | 3300009553 | Unclassified | 1722 |
| 159 | Ga0105239_10031349 | 3300010375 | Bacteria | 5847 |
| 160 | Ga0105239_10214947 | 3300010375 | Unclassified | 2155 |
| 161 | Ga0105239_10346955 | 3300010375 | Bacteria | 1676 |
| 162 | Ga0105239_10711845 | 3300010375 | Bacteria | 1148 |
| 163 | Ga0105246_10175058 | 3300011119 | Bacteria | 1647 |
| 164 | Ga0157373_10098903 | 3300013100 | Unclassified | 2053 |
| 165 | Ga0157374_10103711 | 3300013296 | Bacteria | 2729 |
| 166 | Ga0157374_10624710 | 3300013296 | Unclassified | 1088 |
| 167 | Ga0157378_10118820 | 3300013297 | Unclassified | 2434 |
| 168 | Ga0157378_10348618 | 3300013297 | Unclassified | 1446 |
| 169 | Ga0163162_10120881 | 3300013306 | Bacteria | 2723 |
| 170 | Ga0157372_10178231 | 3300013307 | Unclassified | 2460 |
| 171 | Ga0157375_10611615 | 3300013308 | Bacteria | 1248 |
| 172 | Ga0163163_10003830 | 3300014325 | Bacteria | 12806 |
| 173 | Ga0163163_10005740 | 3300014325 | Bacteria | 10769 |
| 174 | Ga0163163_10041259 | 3300014325 | Bacteria | 4512 |
| 175 | Ga0163163_10155516 | 3300014325 | Bacteria | 2331 |
| 176 | Ga0163163_10187496 | 3300014325 | Bacteria | 2116 |
| 177 | Ga0163163_10246280 | 3300014325 | Unclassified | 1837 |
| 178 | Ga0157380_10271462 | 3300014326 | Bacteria | 1546 |
| 179 | Ga0182008_10038215 | 3300014497 | Bacteria | 2401 |
| 180 | Ga0157377_10100450 | 3300014745 | Bacteria | 1723 |
| 181 | Ga0157376_10106026 | 3300014969 | Bacteria | 2465 |
| 182 | Ga0157376_10195170 | 3300014969 | Unclassified | 1859 |
| 183 | Ga0182006_1097083 | 3300015261 | Unclassified | 1051 |
| 184 | Ga0182007_10011790 | 3300015262 | Bacteria | 3387 |
| 185 | Ga0163161_10083259 | 3300017792 | Bacteria | 2358 |
| 186 | Ga0213871_10007623 | 3300021441 | Bacteria | 2351 |
| 187 | Ga0224712_10154196 | 3300022467 | Bacteria | 1020 |
| 188 | Ga0228598_1000303 | 3300024227 | Bacteria | 9589 |
| 189 | Ga0207697_10106627 | 3300025315 | Bacteria | 1198 |
| 190 | Ga0207692_10000820 | 3300025898 | Bacteria | 11129 |
| 191 | Ga0207710_10000521 | 3300025900 | Bacteria | 23589 |
| 192 | Ga0207688_10174972 | 3300025901 | Unclassified | 1278 |
| 193 | Ga0207680_10037221 | 3300025903 | Bacteria | 2808 |
| 194 | Ga0207680_10129636 | 3300025903 | Bacteria | 1661 |
| 195 | Ga0207647_10236723 | 3300025904 | Bacteria | 1049 |
| 196 | Ga0207685_10024028 | 3300025905 | Bacteria | 2083 |
| 197 | Ga0207699_10088224 | 3300025906 | Unclassified | 1941 |
| 198 | Ga0207643_10158052 | 3300025908 | Unclassified | 1362 |
| 199 | Ga0207643_10192063 | 3300025908 | Bacteria | 1240 |
| 200 | Ga0207684_10000973 | 3300025910 | Bacteria | 32084 |
| 201 | Ga0207684_10021975 | 3300025910 | Bacteria | 5448 |
| 202 | Ga0207684_10024724 | 3300025910 | Bacteria | 5121 |
| 203 | Ga0207654_10079536 | 3300025911 | Unclassified | 1969 |
| 204 | Ga0207654_10315618 | 3300025911 | Unclassified | 1067 |
| 205 | Ga0207707_10000190 | 3300025912 | Bacteria | 64802 |
| 206 | Ga0207707_10007393 | 3300025912 | Bacteria | 9568 |
| 207 | Ga0207707_10034399 | 3300025912 | Bacteria | 4433 |
| 208 | Ga0207695_10296536 | 3300025913 | Bacteria | 1508 |
| 209 | Ga0207671_10112600 | 3300025914 | Bacteria | 2072 |
| 210 | Ga0207693_10032918 | 3300025915 | Bacteria | 4091 |
| 211 | Ga0207693_10186681 | 3300025915 | Unclassified | 1632 |
| 212 | Ga0207663_10063371 | 3300025916 | Bacteria | 2354 |
| 213 | Ga0207663_10383955 | 3300025916 | Unclassified | 1070 |
| 214 | Ga0207660_10000117 | 3300025917 | Bacteria | 46029 |
| 215 | Ga0207660_10047118 | 3300025917 | Unclassified | 3045 |
| 216 | Ga0207657_10006751 | 3300025919 | Bacteria | 11856 |
| 217 | Ga0207652_10000028 | 3300025921 | Bacteria | 150429 |
| 218 | Ga0207652_10347397 | 3300025921 | Unclassified | 1339 |
| 219 | Ga0207646_10003275 | 3300025922 | Bacteria | 18448 |
| 220 | Ga0207646_10007050 | 3300025922 | Bacteria | 11497 |
| 221 | Ga0207646_10051530 | 3300025922 | Bacteria | 3683 |
| 222 | Ga0207646_10145645 | 3300025922 | Bacteria | 2134 |
| 223 | Ga0207646_10255374 | 3300025922 | Bacteria | 1584 |
| 224 | Ga0207681_10008483 | 3300025923 | Bacteria | 6280 |
| 225 | Ga0207650_10000061 | 3300025925 | Bacteria | 149822 |
| 226 | Ga0207687_10000141 | 3300025927 | Bacteria | 48006 |
| 227 | Ga0207700_10003903 | 3300025928 | Bacteria | 8708 |
| 228 | Ga0207700_10005864 | 3300025928 | Bacteria | 7384 |
| 229 | Ga0207700_10046658 | 3300025928 | Bacteria | 3206 |
| 230 | Ga0207700_10383082 | 3300025928 | Unclassified | 1230 |
| 231 | Ga0207644_10054580 | 3300025931 | Bacteria | 2879 |
| 232 | Ga0207644_10483134 | 3300025931 | Bacteria | 1020 |
| 233 | Ga0207706_10038557 | 3300025933 | Unclassified | 4238 |
| 234 | Ga0207706_10273823 | 3300025933 | Bacteria | 1473 |
| 235 | Ga0207686_10010216 | 3300025934 | Bacteria | 5105 |
| 236 | Ga0207686_10256939 | 3300025934 | Bacteria | 1279 |
| 237 | Ga0207670_10200588 | 3300025936 | Bacteria | 1516 |
| 238 | Ga0207665_10014915 | 3300025939 | Bacteria | 5105 |
| 239 | Ga0207665_10065117 | 3300025939 | Bacteria | 2477 |
| 240 | Ga0207665_10104651 | 3300025939 | Unclassified | 1981 |
| 241 | Ga0207665_10289223 | 3300025939 | Unclassified | 1222 |
| 242 | Ga0207665_10564853 | 3300025939 | Unclassified | 885 |
| 243 | Ga0207691_10003856 | 3300025940 | Bacteria | 14550 |
| 244 | Ga0207711_10018023 | 3300025941 | Bacteria | 5868 |
| 245 | Ga0207711_10136048 | 3300025941 | Unclassified | 2207 |
| 246 | Ga0207711_10477375 | 3300025941 | Bacteria | 1161 |
| 247 | Ga0207689_10001152 | 3300025942 | Bacteria | 25444 |
| 248 | Ga0207689_10020009 | 3300025942 | Bacteria | 5638 |
| 249 | Ga0207689_10476360 | 3300025942 | Unclassified | 1045 |
| 250 | Ga0207679_10142363 | 3300025945 | Unclassified | 1940 |
| 251 | Ga0207651_10168456 | 3300025960 | Bacteria | 1725 |
| 252 | Ga0207712_10122433 | 3300025961 | Bacteria | 1970 |
| 253 | Ga0207712_10125444 | 3300025961 | Bacteria | 1948 |
| 254 | Ga0207703_10023777 | 3300026035 | Unclassified | 4820 |
| 255 | Ga0207703_10068739 | 3300026035 | Bacteria | 2919 |
| 256 | Ga0207703_10156357 | 3300026035 | Bacteria | 1993 |
| 257 | Ga0207703_10708663 | 3300026035 | Unclassified | 957 |
| 258 | Ga0207639_10047885 | 3300026041 | Unclassified | 3233 |
| 259 | Ga0207639_10080610 | 3300026041 | Unclassified | 2575 |
| 260 | Ga0207639_10506571 | 3300026041 | Bacteria | 1104 |
| 261 | Ga0207708_10032296 | 3300026075 | Bacteria | 3976 |
| 262 | Ga0207702_10001513 | 3300026078 | Bacteria | 22979 |
| 263 | Ga0207702_10008584 | 3300026078 | Bacteria | 8614 |
| 264 | Ga0207702_10110588 | 3300026078 | Bacteria | 2442 |
| 265 | Ga0207641_10016687 | 3300026088 | Bacteria | 6013 |
| 266 | Ga0207641_10513672 | 3300026088 | Unclassified | 1165 |
| 267 | Ga0207648_10018216 | 3300026089 | Bacteria | 6361 |
| 268 | Ga0207648_10254304 | 3300026089 | Bacteria | 1567 |
| 269 | Ga0207676_10048768 | 3300026095 | Unclassified | 3289 |
| 270 | Ga0207676_10509384 | 3300026095 | Bacteria | 1144 |
| 271 | Ga0207674_10341845 | 3300026116 | Bacteria | 1447 |
| 272 | Ga0207675_100003882 | 3300026118 | Bacteria | 14530 |
| 273 | Ga0207675_100024164 | 3300026118 | Bacteria | 5650 |
| 274 | Ga0207698_10036131 | 3300026142 | Bacteria | 3623 |
| 275 | Ga0207428_10005364 | 3300027907 | Bacteria | 11964 |
| 276 | Ga0268266_10090452 | 3300028379 | Bacteria | 2683 |
| 277 | Ga0268265_10100912 | 3300028380 | Bacteria | 2331 |
| 278 | Ga0268265_10409535 | 3300028380 | Bacteria | 1256 |
| 279 | Ga0268264_10027218 | 3300028381 | Unclassified | 4669 |
| 280 | Ga0265762_1017540 | 3300030760 | Bacteria | 1303 |
| 281 | Ga0265762_1046195 | 3300030760 | Unclassified | 863 |
| 282 | Ga0265760_10001276 | 3300031090 | Bacteria | 7364 |
| 283 | Ga0265760_10004746 | 3300031090 | Unclassified | 3894 |
| 284 | Ga0265760_10026531 | 3300031090 | Viruses | 1695 |
| 285 | Ga0307407_10104121 | 3300031903 | Bacteria | 1768 |
| 286 | Ga0307416_100477585 | 3300032002 | Bacteria | 1306 |
| 287 | Ga0373951_0007159 | 3300035091 | Bacteria | 2538 |
| 288 | Ga0373956_0010215 | 3300035119 | Bacteria | 3840 |
| 289 | Ga0373955_0047296 | 3300035172 | Bacteria | 2329 |
| 290 | Ga0373927_0066423 | 3300035695 | Bacteria | 2333 |
| 291 | Ga0373927_0476602 | 3300035695 | Unclassified | 825 |
| 292 | Ga0373947_0534807 | 3300035725 | Bacteria | 797 |
| 293 | Ga0373937_0057281 | 3300036401 | Unclassified | 3580 |
| 294 | Ga0395900_0121168 | 3300037418 | Bacteria | 2684 |
| 295 | Ga0395898_0060913 | 3300037466 | Bacteria | 3667 |
| 296 | Ga0395898_0178281 | 3300037466 | Unclassified | 2031 |
| 297 | Ga0395901_0169513 | 3300038443 | Bacteria | 2291 |
| 298 | Ga0242422_01045 | 3300038699 | Bacteria | 1886 |
| 299 | Ga0242420_008052 | 3300038996 | Bacteria | 1702 |
| 300 | Ga0436360_1133811 | 3300039438 | Bacteria | 9302 |
| 301 | Ga0436363_1570361 | 3300039450 | Bacteria | 2175 |
| 302 | Ga0453683_0143153 | 3300044673 | Unclassified | 1509 |
| 303 | Ga0466963_0314347 | 3300044694 | Bacteria | 1102 |
| 304 | Ga0451576_0185902 | 3300045051 | Bacteria | 2170 |
| 305 | Ga0495580_0002658 | 3300046472 | Bacteria | 15508 |
| 306 | Ga0495669_0068184 | 3300046684 | Bacteria | 1618 |
| 307 | Ga0495669_0235652 | 3300046684 | Unclassified | 878 |
| 308 | Ga0496102_0186702 | 3300048905 | Unclassified | 1954 |
| 309 | Ga0496103_0103826 | 3300048906 | Unclassified | 1801 |
| 310 | Ga0496103_0411101 | 3300048906 | Unclassified | 869 |
| 311 | Ga0496104_0274668 | 3300048907 | Unclassified | 1598 |
| 312 | Ga0496104_0337568 | 3300048907 | Bacteria | 1420 |
| 313 | Ga0496105_0250592 | 3300048908 | Unclassified | 1435 |
| 314 | Ga0496106_0128129 | 3300048909 | Unclassified | 1989 |
| 315 | Ga0496108_0122528 | 3300048911 | Unclassified | 2231 |
| 316 | Ga0496111_0094675 | 3300048914 | Unclassified | 2191 |
| 317 | Ga0496112_0205235 | 3300048915 | Unclassified | 1929 |
| 318 | nmdc:mga05p37_553657_c1 | 3300050507 | Unclassified | 1309 |
| 319 | nmdc:mga05p37_599185_c1 | 3300050507 | Bacteria | 1244 |
| 320 | nmdc:mga05p37_676458_c1 | 3300050507 | Bacteria | 1151 |
| 321 | nmdc:mga05p37_789536_c1 | 3300050507 | Unclassified | 1040 |
| 322 | nmdc:mga08y16_608_c1 | 3300050511 | Bacteria | 33357 |
| 323 | nmdc:mga0n895_17170_c1 | 3300050512 | Bacteria | 6668 |
| 324 | nmdc:mga0n895_185310_c1 | 3300050512 | Bacteria | 2112 |
| 325 | nmdc:mga0n895_267931_c1 | 3300050512 | Bacteria | 1733 |
| 326 | nmdc:mga0n895_33003_c1 | 3300050512 | Bacteria | 4972 |
| 327 | nmdc:mga0rr50_140_c1 | 3300050513 | Bacteria | 39942 |
| 328 | nmdc:mga0rr50_19118_c1 | 3300050513 | Bacteria | 4617 |
| 329 | nmdc:mga0rr50_604799_c1 | 3300050513 | Bacteria | 935 |
| 330 | nmdc:mga08x19_22938_c1 | 3300050514 | Bacteria | 3870 |
| 331 | nmdc:mga0a205_10359_c1 | 3300050515 | Bacteria | 4112 |
| 332 | nmdc:mga0a205_366937_c1 | 3300050515 | Bacteria | 1306 |
| 333 | nmdc:mga0a205_3975_c1 | 3300050515 | Bacteria | 13222 |
| 334 | nmdc:mga0a205_449_c1 | 3300050515 | Bacteria | 31835 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0066423 | Ga0373927_0066423_18_641 | 207 |
| 2 | 3300005293 | Ga0065715_10128015 | Ga0065715_101280152 | 226 |
| 3 | 3300005438 | Ga0070701_10133771 | Ga0070701_101337712 | 226 |
| 4 | 3300005842 | Ga0068858_100164386 | Ga0068858_1001643862 | 226 |
| 5 | 3300009101 | Ga0105247_10000823 | Ga0105247_100008238 | 226 |
| 6 | 3300009177 | Ga0105248_10266815 | Ga0105248_102668152 | 226 |
| 7 | 3300025900 | Ga0207710_10000521 | Ga0207710_100005218 | 226 |
| 8 | 3300025901 | Ga0207688_10174972 | Ga0207688_101749722 | 226 |
| 9 | 3300025941 | Ga0207711_10136048 | Ga0207711_101360482 | 226 |
| 10 | 3300005293 | Ga0065715_10153367 | Ga0065715_101533672 | 227 |
| 11 | 3300005530 | Ga0070679_100251159 | Ga0070679_1002511592 | 228 |
| 12 | 3300005564 | Ga0070664_100279558 | Ga0070664_1002795582 | 228 |
| 13 | 3300005614 | Ga0068856_100232271 | Ga0068856_1002322712 | 228 |
| 14 | 3300005718 | Ga0068866_10267636 | Ga0068866_102676362 | 228 |
| 15 | 3300013296 | Ga0157374_10103711 | Ga0157374_101037112 | 228 |
| 16 | 3300025921 | Ga0207652_10347397 | Ga0207652_103473972 | 228 |
| 17 | 3300026078 | Ga0207702_10110588 | Ga0207702_101105882 | 228 |
| 18 | 3300005445 | Ga0070708_100474152 | Ga0070708_1004741522 | 229 |
| 19 | 3300005467 | Ga0070706_100038427 | Ga0070706_1000384273 | 229 |
| 20 | 3300005468 | Ga0070707_100010317 | Ga0070707_1000103178 | 229 |
| 21 | 3300005617 | Ga0068859_100159924 | Ga0068859_1001599243 | 229 |
| 22 | 3300006931 | Ga0097620_100159911 | Ga0097620_1001599112 | 229 |
| 23 | 3300025910 | Ga0207684_10021975 | Ga0207684_100219753 | 229 |
| 24 | 3300025922 | Ga0207646_10145645 | Ga0207646_101456454 | 229 |
| 25 | 3300048907 | Ga0496104_0337568 | Ga0496104_0337568_92_892 | 229 |
| 26 | 3300009174 | Ga0105241_10225910 | Ga0105241_102259102 | 231 |
| 27 | 3300013296 | Ga0157374_10624710 | Ga0157374_106247101 | 231 |
| 28 | 3300013297 | Ga0157378_10348618 | Ga0157378_103486182 | 231 |
| 29 | 3300048915 | Ga0496112_0205235 | Ga0496112_0205235_644_1342 | 231 |
| 30 | 3300005844 | Ga0068862_100301245 | Ga0068862_1003012452 | 232 |
| 31 | 3300026089 | Ga0207648_10254304 | Ga0207648_102543041 | 232 |
| 32 | 3300028380 | Ga0268265_10409535 | Ga0268265_104095351 | 232 |
| 33 | 3300006028 | Ga0070717_10035236 | Ga0070717_100352363 | 233 |
| 34 | 3300026041 | Ga0207639_10047885 | Ga0207639_100478855 | 234 |
| 35 | 3300026078 | Ga0207702_10008584 | Ga0207702_100085845 | 234 |
| 36 | 3300048911 | Ga0496108_0122528 | Ga0496108_0122528_1023_1808 | 234 |
| 37 | 3300046684 | Ga0495669_0235652 | Ga0495669_0235652_52_765 | 235 |
| 38 | 3300002459 | JGI24751J29686_10000138 | JGI24751J29686_1000013821 | 236 |
| 39 | 3300005331 | Ga0070670_100000229 | Ga0070670_1000002295 | 236 |
| 40 | 3300014325 | Ga0163163_10003830 | Ga0163163_100038305 | 236 |
| 41 | 3300025925 | Ga0207650_10000061 | Ga0207650_1000006199 | 236 |
| 42 | 3300050507 | nmdc:mga05p37_599185_c1 | nmdc:mga05p37_599185_c1_361_1077 | 236 |
| 43 | 3300050513 | nmdc:mga0rr50_140_c1 | nmdc:mga0rr50_140_c1_29129_29845 | 236 |
| 44 | 3300050515 | nmdc:mga0a205_3975_c1 | nmdc:mga0a205_3975_c1_12352_13068 | 236 |
| 45 | 3300005434 | Ga0070709_10029031 | Ga0070709_100290313 | 237 |
| 46 | 3300005436 | Ga0070713_100041409 | Ga0070713_1000414093 | 237 |
| 47 | 3300005436 | Ga0070713_100296996 | Ga0070713_1002969962 | 237 |
| 48 | 3300005439 | Ga0070711_100137237 | Ga0070711_1001372371 | 237 |
| 49 | 3300005614 | Ga0068856_100222571 | Ga0068856_1002225712 | 237 |
| 50 | 3300006163 | Ga0070715_10086453 | Ga0070715_100864531 | 237 |
| 51 | 3300025915 | Ga0207693_10186681 | Ga0207693_101866812 | 237 |
| 52 | 3300025916 | Ga0207663_10063371 | Ga0207663_100633712 | 237 |
| 53 | 3300025927 | Ga0207687_10000141 | Ga0207687_100001417 | 237 |
| 54 | 3300025928 | Ga0207700_10005864 | Ga0207700_100058644 | 237 |
| 55 | 3300025928 | Ga0207700_10383082 | Ga0207700_103830821 | 237 |
| 56 | 3300025939 | Ga0207665_10014915 | Ga0207665_100149152 | 237 |
| 57 | 3300050507 | nmdc:mga05p37_789536_c1 | nmdc:mga05p37_789536_c1_131_856 | 237 |
| 58 | 3300010375 | Ga0105239_10711845 | Ga0105239_107118452 | 239 |
| 59 | 3300013306 | Ga0163162_10120881 | Ga0163162_101208812 | 239 |
| 60 | 3300025904 | Ga0207647_10236723 | Ga0207647_102367231 | 239 |
| 61 | 3300025933 | Ga0207706_10273823 | Ga0207706_102738231 | 239 |
| 62 | 3300035119 | Ga0373956_0010215 | Ga0373956_0010215_3033_3755 | 239 |
| 63 | 3300035172 | Ga0373955_0047296 | Ga0373955_0047296_78_800 | 239 |
| 64 | 3300037418 | Ga0395900_0121168 | Ga0395900_0121168_310_1086 | 239 |
| 65 | 3300037466 | Ga0395898_0060913 | Ga0395898_0060913_798_1574 | 239 |
| 66 | 3300038443 | Ga0395901_0169513 | Ga0395901_0169513_240_1016 | 239 |
| 67 | 3300005437 | Ga0070710_10000598 | Ga0070710_1000059815 | 240 |
| 68 | 3300005441 | Ga0070700_100668590 | Ga0070700_1006685901 | 240 |
| 69 | 3300006852 | Ga0075433_10364320 | Ga0075433_103643202 | 240 |
| 70 | 3300025898 | Ga0207692_10000820 | Ga0207692_100008201 | 240 |
| 71 | 3300026142 | Ga0207698_10036131 | Ga0207698_100361314 | 240 |
| 72 | 3300030760 | Ga0265762_1017540 | Ga0265762_10175401 | 240 |
| 73 | 3300030760 | Ga0265762_1046195 | Ga0265762_10461951 | 240 |
| 74 | 3300031090 | Ga0265760_10001276 | Ga0265760_100012764 | 240 |
| 75 | 3300035695 | Ga0373927_0476602 | Ga0373927_0476602_26_760 | 240 |
| 76 | 3300006173 | Ga0070716_100558106 | Ga0070716_1005581061 | 241 |
| 77 | 3300009174 | Ga0105241_10063899 | Ga0105241_100638993 | 241 |
| 78 | 3300025911 | Ga0207654_10079536 | Ga0207654_100795362 | 241 |
| 79 | 3300025939 | Ga0207665_10564853 | Ga0207665_105648531 | 241 |
| 80 | 3300044694 | Ga0466963_0314347 | Ga0466963_0314347_40_765 | 241 |
| 81 | iso_pu_bacteria | 2513237098 | 2513679720 | 241 |
| 82 | 3300005439 | Ga0070711_100125465 | Ga0070711_1001254652 | 242 |
| 83 | 3300005445 | Ga0070708_100023230 | Ga0070708_1000232303 | 242 |
| 84 | 3300006175 | Ga0070712_100054242 | Ga0070712_1000542422 | 242 |
| 85 | 3300006175 | Ga0070712_100078749 | Ga0070712_1000787491 | 242 |
| 86 | 3300014325 | Ga0163163_10041259 | Ga0163163_100412592 | 242 |
| 87 | 3300022467 | Ga0224712_10154196 | Ga0224712_101541961 | 242 |
| 88 | 3300025905 | Ga0207685_10024028 | Ga0207685_100240283 | 242 |
| 89 | 3300025915 | Ga0207693_10032918 | Ga0207693_100329184 | 242 |
| 90 | 3300025916 | Ga0207663_10383955 | Ga0207663_103839551 | 242 |
| 91 | 3300048905 | Ga0496102_0186702 | Ga0496102_0186702_1085_1819 | 242 |
| 92 | 3300048906 | Ga0496103_0411101 | Ga0496103_0411101_103_837 | 242 |
| 93 | 3300048907 | Ga0496104_0274668 | Ga0496104_0274668_814_1548 | 242 |
| 94 | iso_pu_bacteria | 2524023210 | 2524464934 | 242 |
| 95 | iso_pu_bacteria | 2885383462 | 2885387354 | 242 |
| 96 | iso_pu_bacteria | 8056681323 | 8056689637 | 242 |
| 97 | 3300005331 | Ga0070670_100256816 | Ga0070670_1002568161 | 243 |
| 98 | 3300005344 | Ga0070661_100109798 | Ga0070661_1001097982 | 243 |
| 99 | 3300005347 | Ga0070668_100239629 | Ga0070668_1002396292 | 243 |
| 100 | 3300005434 | Ga0070709_10373279 | Ga0070709_103732791 | 243 |
| 101 | 3300005435 | Ga0070714_100159676 | Ga0070714_1001596762 | 243 |
| 102 | 3300005435 | Ga0070714_100659306 | Ga0070714_1006593061 | 243 |
| 103 | 3300005436 | Ga0070713_100036044 | Ga0070713_1000360442 | 243 |
| 104 | 3300005436 | Ga0070713_100049797 | Ga0070713_1000497973 | 243 |
| 105 | 3300005444 | Ga0070694_100043519 | Ga0070694_1000435192 | 243 |
| 106 | 3300005445 | Ga0070708_100098796 | Ga0070708_1000987962 | 243 |
| 107 | 3300005445 | Ga0070708_100130605 | Ga0070708_1001306053 | 243 |
| 108 | 3300005457 | Ga0070662_100128385 | Ga0070662_1001283852 | 243 |
| 109 | 3300005467 | Ga0070706_100057207 | Ga0070706_1000572075 | 243 |
| 110 | 3300005468 | Ga0070707_100034566 | Ga0070707_1000345663 | 243 |
| 111 | 3300005468 | Ga0070707_100249462 | Ga0070707_1002494622 | 243 |
| 112 | 3300005471 | Ga0070698_100183339 | Ga0070698_1001833391 | 243 |
| 113 | 3300005518 | Ga0070699_100020286 | Ga0070699_1000202862 | 243 |
| 114 | 3300005536 | Ga0070697_100019394 | Ga0070697_1000193944 | 243 |
| 115 | 3300005536 | Ga0070697_100307453 | Ga0070697_1003074532 | 243 |
| 116 | 3300005536 | Ga0070697_100399301 | Ga0070697_1003993012 | 243 |
| 117 | 3300005539 | Ga0068853_100530587 | Ga0068853_1005305872 | 243 |
| 118 | 3300005546 | Ga0070696_100161933 | Ga0070696_1001619332 | 243 |
| 119 | 3300005564 | Ga0070664_100071497 | Ga0070664_1000714972 | 243 |
| 120 | 3300005614 | Ga0068856_100001532 | Ga0068856_10000153224 | 243 |
| 121 | 3300005841 | Ga0068863_100280403 | Ga0068863_1002804032 | 243 |
| 122 | 3300006028 | Ga0070717_10053889 | Ga0070717_100538893 | 243 |
| 123 | 3300006028 | Ga0070717_10137457 | Ga0070717_101374572 | 243 |
| 124 | 3300006173 | Ga0070716_100250901 | Ga0070716_1002509012 | 243 |
| 125 | 3300006852 | Ga0075433_10008310 | Ga0075433_1000831010 | 243 |
| 126 | 3300006871 | Ga0075434_100000235 | Ga0075434_10000023523 | 243 |
| 127 | 3300006871 | Ga0075434_100004271 | Ga0075434_10000427110 | 243 |
| 128 | 3300006914 | Ga0075436_100005980 | Ga0075436_1000059803 | 243 |
| 129 | 3300006914 | Ga0075436_100037125 | Ga0075436_1000371252 | 243 |
| 130 | 3300006914 | Ga0075436_100296556 | Ga0075436_1002965562 | 243 |
| 131 | 3300007076 | Ga0075435_100003821 | Ga0075435_1000038216 | 243 |
| 132 | 3300007076 | Ga0075435_100007962 | Ga0075435_1000079626 | 243 |
| 133 | 3300007076 | Ga0075435_100283365 | Ga0075435_1002833651 | 243 |
| 134 | 3300007265 | Ga0099794_10033140 | Ga0099794_100331402 | 243 |
| 135 | 3300007788 | Ga0099795_10003415 | Ga0099795_100034154 | 243 |
| 136 | 3300009093 | Ga0105240_10047360 | Ga0105240_100473602 | 243 |
| 137 | 3300009093 | Ga0105240_10661300 | Ga0105240_106613001 | 243 |
| 138 | 3300009147 | Ga0114129_10298742 | Ga0114129_102987422 | 243 |
| 139 | 3300009545 | Ga0105237_10162765 | Ga0105237_101627652 | 243 |
| 140 | 3300009551 | Ga0105238_10034553 | Ga0105238_100345535 | 243 |
| 141 | 3300009551 | Ga0105238_10159731 | Ga0105238_101597312 | 243 |
| 142 | 3300010375 | Ga0105239_10214947 | Ga0105239_102149472 | 243 |
| 143 | 3300013297 | Ga0157378_10118820 | Ga0157378_101188202 | 243 |
| 144 | 3300013307 | Ga0157372_10178231 | Ga0157372_101782312 | 243 |
| 145 | 3300014497 | Ga0182008_10038215 | Ga0182008_100382153 | 243 |
| 146 | 3300015261 | Ga0182006_1097083 | Ga0182006_10970831 | 243 |
| 147 | 3300015262 | Ga0182007_10011790 | Ga0182007_100117903 | 243 |
| 148 | 3300021441 | Ga0213871_10007623 | Ga0213871_100076232 | 243 |
| 149 | 3300024227 | Ga0228598_1000303 | Ga0228598_10003035 | 243 |
| 150 | 3300025906 | Ga0207699_10088224 | Ga0207699_100882241 | 243 |
| 151 | 3300025910 | Ga0207684_10000973 | Ga0207684_1000097315 | 243 |
| 152 | 3300025910 | Ga0207684_10024724 | Ga0207684_100247245 | 243 |
| 153 | 3300025912 | Ga0207707_10034399 | Ga0207707_100343992 | 243 |
| 154 | 3300025914 | Ga0207671_10112600 | Ga0207671_101126002 | 243 |
| 155 | 3300025917 | Ga0207660_10047118 | Ga0207660_100471182 | 243 |
| 156 | 3300025919 | Ga0207657_10006751 | Ga0207657_1000675110 | 243 |
| 157 | 3300025922 | Ga0207646_10003275 | Ga0207646_100032754 | 243 |
| 158 | 3300025922 | Ga0207646_10007050 | Ga0207646_100070508 | 243 |
| 159 | 3300025922 | Ga0207646_10255374 | Ga0207646_102553742 | 243 |
| 160 | 3300025928 | Ga0207700_10003903 | Ga0207700_100039039 | 243 |
| 161 | 3300025928 | Ga0207700_10046658 | Ga0207700_100466583 | 243 |
| 162 | 3300025931 | Ga0207644_10054580 | Ga0207644_100545802 | 243 |
| 163 | 3300025933 | Ga0207706_10038557 | Ga0207706_100385573 | 243 |
| 164 | 3300025939 | Ga0207665_10065117 | Ga0207665_100651172 | 243 |
| 165 | 3300025939 | Ga0207665_10104651 | Ga0207665_101046511 | 243 |
| 166 | 3300025945 | Ga0207679_10142363 | Ga0207679_101423632 | 243 |
| 167 | 3300026041 | Ga0207639_10080610 | Ga0207639_100806102 | 243 |
| 168 | 3300026078 | Ga0207702_10001513 | Ga0207702_1000151313 | 243 |
| 169 | 3300026116 | Ga0207674_10341845 | Ga0207674_103418451 | 243 |
| 170 | 3300031090 | Ga0265760_10004746 | Ga0265760_100047462 | 243 |
| 171 | 3300031090 | Ga0265760_10026531 | Ga0265760_100265312 | 243 |
| 172 | 3300035725 | Ga0373947_0534807 | Ga0373947_0534807_41_778 | 243 |
| 173 | 3300037466 | Ga0395898_0178281 | Ga0395898_0178281_1202_1939 | 243 |
| 174 | 3300039438 | Ga0436360_1133811 | Ga0436360_1133811_7132_7869 | 243 |
| 175 | 3300039450 | Ga0436363_1570361 | Ga0436363_1570361_331_1164 | 243 |
| 176 | 3300044673 | Ga0453683_0143153 | Ga0453683_0143153_291_1022 | 243 |
| 177 | 3300045051 | Ga0451576_0185902 | Ga0451576_0185902_495_1262 | 243 |
| 178 | 3300046472 | Ga0495580_0002658 | Ga0495580_0002658_4331_5065 | 243 |
| 179 | 3300048906 | Ga0496103_0103826 | Ga0496103_0103826_215_952 | 243 |
| 180 | 3300048908 | Ga0496105_0250592 | Ga0496105_0250592_403_1140 | 243 |
| 181 | 3300048909 | Ga0496106_0128129 | Ga0496106_0128129_705_1442 | 243 |
| 182 | 3300048914 | Ga0496111_0094675 | Ga0496111_0094675_629_1366 | 243 |
| 183 | 3300050507 | nmdc:mga05p37_676458_c1 | nmdc:mga05p37_676458_c1_249_986 | 243 |
| 184 | 3300050512 | nmdc:mga0n895_17170_c1 | nmdc:mga0n895_17170_c1_1770_2507 | 243 |
| 185 | 3300050513 | nmdc:mga0rr50_19118_c1 | nmdc:mga0rr50_19118_c1_72_809 | 243 |
| 186 | 3300050513 | nmdc:mga0rr50_604799_c1 | nmdc:mga0rr50_604799_c1_135_866 | 243 |
| 187 | 3300050514 | nmdc:mga08x19_22938_c1 | nmdc:mga08x19_22938_c1_189_926 | 243 |
| 188 | 3300050515 | nmdc:mga0a205_449_c1 | nmdc:mga0a205_449_c1_22143_22880 | 243 |
| 189 | 3300005518 | Ga0070699_100223433 | Ga0070699_1002234331 | 244 |
| 190 | 3300006852 | Ga0075433_10332841 | Ga0075433_103328412 | 244 |
| 191 | 3300009147 | Ga0114129_10315325 | Ga0114129_103153251 | 244 |
| 192 | 3300009177 | Ga0105248_10019222 | Ga0105248_100192227 | 244 |
| 193 | 3300025941 | Ga0207711_10018023 | Ga0207711_100180234 | 244 |
| 194 | 3300050515 | nmdc:mga0a205_366937_c1 | nmdc:mga0a205_366937_c1_61_801 | 244 |
| 195 | 3300005356 | Ga0070674_100145037 | Ga0070674_1001450372 | 245 |
| 196 | 3300005438 | Ga0070701_10272653 | Ga0070701_102726531 | 245 |
| 197 | 3300005456 | Ga0070678_100324375 | Ga0070678_1003243752 | 245 |
| 198 | 3300009553 | Ga0105249_10003242 | Ga0105249_100032423 | 245 |
| 199 | 3300010375 | Ga0105239_10031349 | Ga0105239_100313495 | 245 |
| 200 | 3300014325 | Ga0163163_10246280 | Ga0163163_102462801 | 245 |
| 201 | 3300026089 | Ga0207648_10018216 | Ga0207648_100182165 | 245 |
| 202 | 3300005293 | Ga0065715_10095260 | Ga0065715_100952605 | 246 |
| 203 | 3300005334 | Ga0068869_100203372 | Ga0068869_1002033721 | 246 |
| 204 | 3300005335 | Ga0070666_10339565 | Ga0070666_103395651 | 246 |
| 205 | 3300005338 | Ga0068868_100036419 | Ga0068868_1000364192 | 246 |
| 206 | 3300005367 | Ga0070667_100265130 | Ga0070667_1002651302 | 246 |
| 207 | 3300005547 | Ga0070693_100078193 | Ga0070693_1000781932 | 246 |
| 208 | 3300005615 | Ga0070702_100037362 | Ga0070702_1000373622 | 246 |
| 209 | 3300005617 | Ga0068859_100061163 | Ga0068859_1000611633 | 246 |
| 210 | 3300005618 | Ga0068864_100002523 | Ga0068864_1000025235 | 246 |
| 211 | 3300005842 | Ga0068858_100023723 | Ga0068858_1000237235 | 246 |
| 212 | 3300006931 | Ga0097620_100061163 | Ga0097620_1000611633 | 246 |
| 213 | 3300009177 | Ga0105248_10003374 | Ga0105248_100033742 | 246 |
| 214 | 3300014969 | Ga0157376_10106026 | Ga0157376_101060262 | 246 |
| 215 | 3300025903 | Ga0207680_10037221 | Ga0207680_100372213 | 246 |
| 216 | 3300025931 | Ga0207644_10483134 | Ga0207644_104831342 | 246 |
| 217 | 3300025934 | Ga0207686_10256939 | Ga0207686_102569392 | 246 |
| 218 | 3300025936 | Ga0207670_10200588 | Ga0207670_102005882 | 246 |
| 219 | 3300025941 | Ga0207711_10477375 | Ga0207711_104773752 | 246 |
| 220 | 3300025942 | Ga0207689_10020009 | Ga0207689_100200095 | 246 |
| 221 | 3300026035 | Ga0207703_10068739 | Ga0207703_100687392 | 246 |
| 222 | 3300026095 | Ga0207676_10048768 | Ga0207676_100487683 | 246 |
| 223 | 3300028379 | Ga0268266_10090452 | Ga0268266_100904522 | 246 |
| 224 | 3300036401 | Ga0373937_0057281 | Ga0373937_0057281_2557_3345 | 246 |
| 225 | 3300005466 | Ga0070685_10015743 | Ga0070685_100157432 | 248 |
| 226 | 3300013308 | Ga0157375_10611615 | Ga0157375_106116151 | 248 |
| 227 | 3300005468 | Ga0070707_100121543 | Ga0070707_1001215432 | 249 |
| 228 | 3300005440 | Ga0070705_100251310 | Ga0070705_1002513102 | 250 |
| 229 | 3300005547 | Ga0070693_100006950 | Ga0070693_1000069505 | 250 |
| 230 | 3300025939 | Ga0207665_10289223 | Ga0207665_102892232 | 250 |
| 231 | 3300005444 | Ga0070694_100000029 | Ga0070694_10000002916 | 251 |
| 232 | 3300005468 | Ga0070707_100052287 | Ga0070707_1000522873 | 251 |
| 233 | 3300025922 | Ga0207646_10051530 | Ga0207646_100515303 | 251 |
| 234 | 3300005340 | Ga0070689_100388085 | Ga0070689_1003880852 | 252 |
| 235 | 3300005343 | Ga0070687_100014515 | Ga0070687_1000145152 | 252 |
| 236 | 3300005617 | Ga0068859_100051546 | Ga0068859_1000515462 | 252 |
| 237 | 3300005844 | Ga0068862_100160232 | Ga0068862_1001602322 | 252 |
| 238 | 3300006931 | Ga0097620_100051544 | Ga0097620_1000515442 | 252 |
| 239 | 3300028380 | Ga0268265_10100912 | Ga0268265_101009122 | 252 |
| 240 | 3300035091 | Ga0373951_0007159 | Ga0373951_0007159_1230_1988 | 252 |
| 241 | 3300005290 | Ga0065712_10074559 | Ga0065712_100745592 | 253 |
| 242 | 3300005330 | Ga0070690_100020784 | Ga0070690_1000207845 | 253 |
| 243 | 3300005334 | Ga0068869_100069396 | Ga0068869_1000693962 | 253 |
| 244 | 3300005364 | Ga0070673_100032262 | Ga0070673_1000322621 | 253 |
| 245 | 3300005434 | Ga0070709_10448709 | Ga0070709_104487091 | 253 |
| 246 | 3300005518 | Ga0070699_100029760 | Ga0070699_1000297603 | 253 |
| 247 | 3300005539 | Ga0068853_100252418 | Ga0068853_1002524182 | 253 |
| 248 | 3300005617 | Ga0068859_100034221 | Ga0068859_1000342215 | 253 |
| 249 | 3300005618 | Ga0068864_100033852 | Ga0068864_1000338522 | 253 |
| 250 | 3300005718 | Ga0068866_10008438 | Ga0068866_100084382 | 253 |
| 251 | 3300005841 | Ga0068863_100014158 | Ga0068863_1000141583 | 253 |
| 252 | 3300005842 | Ga0068858_100044131 | Ga0068858_1000441312 | 253 |
| 253 | 3300005843 | Ga0068860_100250259 | Ga0068860_1002502592 | 253 |
| 254 | 3300005844 | Ga0068862_100026619 | Ga0068862_1000266192 | 253 |
| 255 | 3300006881 | Ga0068865_100010397 | Ga0068865_1000103975 | 253 |
| 256 | 3300006931 | Ga0097620_100034221 | Ga0097620_1000342212 | 253 |
| 257 | 3300009148 | Ga0105243_10028333 | Ga0105243_100283335 | 253 |
| 258 | 3300009176 | Ga0105242_10025920 | Ga0105242_100259202 | 253 |
| 259 | 3300009177 | Ga0105248_10028507 | Ga0105248_100285073 | 253 |
| 260 | 3300009553 | Ga0105249_10260942 | Ga0105249_102609422 | 253 |
| 261 | 3300010375 | Ga0105239_10346955 | Ga0105239_103469552 | 253 |
| 262 | 3300014325 | Ga0163163_10155516 | Ga0163163_101555162 | 253 |
| 263 | 3300014326 | Ga0157380_10271462 | Ga0157380_102714622 | 253 |
| 264 | 3300014969 | Ga0157376_10195170 | Ga0157376_101951702 | 253 |
| 265 | 3300017792 | Ga0163161_10083259 | Ga0163161_100832592 | 253 |
| 266 | 3300025903 | Ga0207680_10129636 | Ga0207680_101296362 | 253 |
| 267 | 3300025908 | Ga0207643_10192063 | Ga0207643_101920631 | 253 |
| 268 | 3300025934 | Ga0207686_10010216 | Ga0207686_100102165 | 253 |
| 269 | 3300025940 | Ga0207691_10003856 | Ga0207691_100038568 | 253 |
| 270 | 3300025942 | Ga0207689_10001152 | Ga0207689_100011527 | 253 |
| 271 | 3300025960 | Ga0207651_10168456 | Ga0207651_101684562 | 253 |
| 272 | 3300025961 | Ga0207712_10122433 | Ga0207712_101224331 | 253 |
| 273 | 3300025961 | Ga0207712_10125444 | Ga0207712_101254442 | 253 |
| 274 | 3300026035 | Ga0207703_10023777 | Ga0207703_100237772 | 253 |
| 275 | 3300026035 | Ga0207703_10156357 | Ga0207703_101563572 | 253 |
| 276 | 3300026075 | Ga0207708_10032296 | Ga0207708_100322963 | 253 |
| 277 | 3300026088 | Ga0207641_10016687 | Ga0207641_100166875 | 253 |
| 278 | 3300026118 | Ga0207675_100003882 | Ga0207675_10000388213 | 253 |
| 279 | 3300026118 | Ga0207675_100024164 | Ga0207675_1000241646 | 253 |
| 280 | 3300028381 | Ga0268264_10027218 | Ga0268264_100272185 | 253 |
| 281 | 3300005288 | Ga0065714_10002189 | Ga0065714_1000218926 | 254 |
| 282 | 3300005290 | Ga0065712_10067733 | Ga0065712_1006773318 | 254 |
| 283 | 3300005293 | Ga0065715_10100737 | Ga0065715_101007372 | 254 |
| 284 | 3300005343 | Ga0070687_100293248 | Ga0070687_1002932481 | 254 |
| 285 | 3300005458 | Ga0070681_10002508 | Ga0070681_100025086 | 254 |
| 286 | 3300005458 | Ga0070681_10006112 | Ga0070681_100061123 | 254 |
| 287 | 3300005530 | Ga0070679_100000256 | Ga0070679_10000025612 | 254 |
| 288 | 3300005549 | Ga0070704_100231159 | Ga0070704_1002311591 | 254 |
| 289 | 3300005549 | Ga0070704_100242651 | Ga0070704_1002426512 | 254 |
| 290 | 3300005549 | Ga0070704_100296970 | Ga0070704_1002969701 | 254 |
| 291 | 3300005617 | Ga0068859_100050008 | Ga0068859_1000500084 | 254 |
| 292 | 3300005618 | Ga0068864_100656111 | Ga0068864_1006561111 | 254 |
| 293 | 3300006852 | Ga0075433_10014162 | Ga0075433_100141628 | 254 |
| 294 | 3300006871 | Ga0075434_100085149 | Ga0075434_1000851492 | 254 |
| 295 | 3300006931 | Ga0097620_100050006 | Ga0097620_1000500064 | 254 |
| 296 | 3300009093 | Ga0105240_10294798 | Ga0105240_102947983 | 254 |
| 297 | 3300009147 | Ga0114129_10016764 | Ga0114129_100167642 | 254 |
| 298 | 3300009147 | Ga0114129_10042658 | Ga0114129_100426586 | 254 |
| 299 | 3300009545 | Ga0105237_10048776 | Ga0105237_100487763 | 254 |
| 300 | 3300013100 | Ga0157373_10098903 | Ga0157373_100989032 | 254 |
| 301 | 3300014325 | Ga0163163_10005740 | Ga0163163_100057403 | 254 |
| 302 | 3300014745 | Ga0157377_10100450 | Ga0157377_101004502 | 254 |
| 303 | 3300025315 | Ga0207697_10106627 | Ga0207697_101066272 | 254 |
| 304 | 3300025912 | Ga0207707_10000190 | Ga0207707_1000019011 | 254 |
| 305 | 3300025912 | Ga0207707_10007393 | Ga0207707_100073936 | 254 |
| 306 | 3300025913 | Ga0207695_10296536 | Ga0207695_102965362 | 254 |
| 307 | 3300025917 | Ga0207660_10000117 | Ga0207660_100001174 | 254 |
| 308 | 3300025921 | Ga0207652_10000028 | Ga0207652_1000002881 | 254 |
| 309 | 3300025942 | Ga0207689_10476360 | Ga0207689_104763601 | 254 |
| 310 | 3300026035 | Ga0207703_10708663 | Ga0207703_107086631 | 254 |
| 311 | 3300026041 | Ga0207639_10506571 | Ga0207639_105065712 | 254 |
| 312 | 3300026095 | Ga0207676_10509384 | Ga0207676_105093841 | 254 |
| 313 | 3300031903 | Ga0307407_10104121 | Ga0307407_101041212 | 254 |
| 314 | 3300032002 | Ga0307416_100477585 | Ga0307416_1004775851 | 254 |
| 315 | 3300038699 | Ga0242422_01045 | Ga0242422_01045_589_1359 | 254 |
| 316 | 3300038996 | Ga0242420_008052 | Ga0242420_008052_204_974 | 254 |
| 317 | 3300046684 | Ga0495669_0068184 | Ga0495669_0068184_69_908 | 254 |
| 318 | 3300050507 | nmdc:mga05p37_553657_c1 | nmdc:mga05p37_553657_c1_312_1076 | 254 |
| 319 | 3300050512 | nmdc:mga0n895_267931_c1 | nmdc:mga0n895_267931_c1_250_1038 | 254 |
| 320 | 3300050515 | nmdc:mga0a205_10359_c1 | nmdc:mga0a205_10359_c1_441_1205 | 254 |
| 321 | 3300005841 | Ga0068863_100128752 | Ga0068863_1001287523 | 255 |
| 322 | 3300005985 | Ga0081539_10005965 | Ga0081539_1000596512 | 255 |
| 323 | 3300009174 | Ga0105241_10333693 | Ga0105241_103336932 | 255 |
| 324 | 3300011119 | Ga0105246_10175058 | Ga0105246_101750582 | 255 |
| 325 | 3300014325 | Ga0163163_10187496 | Ga0163163_101874962 | 255 |
| 326 | 3300025908 | Ga0207643_10158052 | Ga0207643_101580521 | 255 |
| 327 | 3300025911 | Ga0207654_10315618 | Ga0207654_103156182 | 255 |
| 328 | 3300025923 | Ga0207681_10008483 | Ga0207681_100084833 | 255 |
| 329 | 3300026088 | Ga0207641_10513672 | Ga0207641_105136722 | 255 |
| 330 | 3300050512 | nmdc:mga0n895_33003_c1 | nmdc:mga0n895_33003_c1_2952_3719 | 255 |
| 331 | 2162886007 | SwRhRL2b_contig_762510 | SwRhRL2b_0951.00005440 | 257 |
| 332 | 3300005289 | Ga0065704_10000862 | Ga0065704_100008626 | 257 |
| 333 | 3300005295 | Ga0065707_10000700 | Ga0065707_100007009 | 257 |
| 334 | 3300006871 | Ga0075434_100125885 | Ga0075434_1001258852 | 257 |
| 335 | 3300009094 | Ga0111539_10001904 | Ga0111539_1000190415 | 257 |
| 336 | 3300027907 | Ga0207428_10005364 | Ga0207428_1000536412 | 257 |
| 337 | 3300050511 | nmdc:mga08y16_608_c1 | nmdc:mga08y16_608_c1_8900_9673 | 257 |
| 338 | 3300050512 | nmdc:mga0n895_185310_c1 | nmdc:mga0n895_185310_c1_1234_2007 | 257 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ung-assembly1.cif.gz_5 | 48-nm repeat of the human respiratory doublet microtubule | 0.5961 | 63 | 111 |
| 6s9v-assembly2.cif.gz_B | crystal structure of sucrose 6f-phosphate phosphorylase from thermoanaerobacter thermosaccharolyticum | 0.5798 | 64 | 108 |
| 6s9v-assembly1.cif.gz_A | crystal structure of sucrose 6f-phosphate phosphorylase from thermoanaerobacter thermosaccharolyticum | 0.5687 | 64 | 108 |
| 5eyy-assembly1.cif.gz_A-2 | tetragonal form of centrolobium tomentosum seed lectin (ctl) complexed with man1-3man-ome. | 0.5285 | 75 | 108 |
| 4hgy-assembly1.cif.gz_E | structure of the ccbj methyltransferase from streptomyces caelestis | 0.5156 | 67 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39310_121_209_3.10.450.350 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7399 | 176 | 213 | 3.10.450.350 |
| af_Q4DYR6_268_320_2.20.110.10 | Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain | 0.6599 | 167 | 213 | 2.20.110.10 |
| af_P0AFS9_92_178_3.10.450.350 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.629 | 177 | 222 | 3.10.450.350 |
| af_O33271_1_245_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.6227 | 45 | 247 | 3.40.605.10 |
| af_Q9QXL8_17_111_2.30.29.170 | Mainly Beta;Roll;PH-domain like; | 0.5801 | 61 | 107 | 2.30.29.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534ZKA9-F1-model_v4 | DUF3108 domain-containing protein | 0.9822 | 57 | 257 |
|
| AF-A0A534ZKA9-F1-model_v4 | DUF3108 domain-containing protein | 0.9727 | 57 | 257 |
|
| AF-A0A2V5LBJ9-F1-model_v4 | Uncharacterized protein | 0.9668 | 84 | 257 |
|
| AF-A0A2V6S4R5-F1-model_v4 | Uncharacterized protein | 0.9649 | 118 | 257 |
|
| AF-A0A2V6S4R5-F1-model_v4 | Uncharacterized protein | 0.9517 | 118 | 257 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar