F413404

General Info

Members Datasets Scaffolds Average Seq Length
338 208 676 91

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_101602690|Ga0070705_1016026901
Length 103
Sequence MPKFVIEREIPGAGSLNQQELQGVSQTSCNVLQKLGPQIQWVQSYVTADKVYCVYIAPNEEMIREHSTLSGIPANRISEVKSVIDPTTAETEKQSAAAGSKTA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
71 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
208 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 1.48
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 2.96
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_101602690 3300005440 Bacteria 548
2 JGI25404J52841_10025640 3300003659 Bacteria 1269
3 JGI25405J52794_10095444 3300003911 Bacteria 660
4 Ga0065704_10639512 3300005289 Bacteria 588
5 Ga0065715_10363414 3300005293 Bacteria 932
6 Ga0070670_100013260 3300005331 Bacteria 7062
7 Ga0070670_100171124 3300005331 Bacteria 1884
8 Ga0070670_100522284 3300005331 Unclassified 1057
9 Ga0070677_10602210 3300005333 Bacteria 609
10 Ga0068869_100001010 3300005334 Bacteria 16366
11 Ga0068869_100040595 3300005334 Bacteria 3328
12 Ga0068869_100114725 3300005334 Unclassified 2054
13 Ga0068869_100120821 3300005334 Bacteria 2003
14 Ga0070680_100957136 3300005336 Bacteria 739
15 Ga0070680_101311020 3300005336 Unclassified 627
16 Ga0068868_100065071 3300005338 Bacteria 2895
17 Ga0068868_100116793 3300005338 Bacteria 2173
18 Ga0068868_101072258 3300005338 Unclassified 740
19 Ga0070689_100010003 3300005340 Bacteria 6751
20 Ga0070687_101067336 3300005343 Bacteria 589
21 Ga0070669_100003176 3300005353 Bacteria 11812
22 Ga0070669_101986819 3300005353 Bacteria 508
23 Ga0070675_100509774 3300005354 Bacteria 1085
24 Ga0070675_100608513 3300005354 Bacteria 991
25 Ga0070675_100673599 3300005354 Bacteria 941
26 Ga0070675_101527142 3300005354 Bacteria 616
27 Ga0070671_100341259 3300005355 Bacteria 1278
28 Ga0070671_100440998 3300005355 Bacteria 1116
29 Ga0070671_101000558 3300005355 Bacteria 732
30 Ga0070674_100713601 3300005356 Bacteria 858
31 Ga0070673_101816627 3300005364 Bacteria 577
32 Ga0070659_100199669 3300005366 Bacteria 1646
33 Ga0070703_10000567 3300005406 Bacteria 13435
34 Ga0070714_100115962 3300005435 Bacteria 2377
35 Ga0070714_100777265 3300005435 Bacteria 926
36 Ga0070713_100027271 3300005436 Bacteria 4495
37 Ga0070713_100727459 3300005436 Bacteria 948
38 Ga0070713_101066771 3300005436 Bacteria 780
39 Ga0070711_100104416 3300005439 Bacteria 2067
40 Ga0070705_100000530 3300005440 Bacteria 22014
41 Ga0070694_100329429 3300005444 Bacteria 1177
42 Ga0070694_101497842 3300005444 Bacteria 571
43 Ga0070694_101635354 3300005444 Bacteria 547
44 Ga0070708_100036258 3300005445 Bacteria 4302
45 Ga0070708_100190242 3300005445 Bacteria 1919
46 Ga0070708_100502637 3300005445 Bacteria 1144
47 Ga0070708_100629877 3300005445 Unclassified 1011
48 Ga0070708_100786254 3300005445 Unclassified 895
49 Ga0070662_100000172 3300005457 Bacteria 37802
50 Ga0068867_100124200 3300005459 Bacteria 1998
51 Ga0068867_100366281 3300005459 Bacteria 1207
52 Ga0070706_100000327 3300005467 Bacteria 57895
53 Ga0070706_100013440 3300005467 Bacteria 7568
54 Ga0070706_100192085 3300005467 Unclassified 1907
55 Ga0070707_100000056 3300005468 Bacteria 99729
56 Ga0070707_100056709 3300005468 Bacteria 3758
57 Ga0070707_100075140 3300005468 Bacteria 3259
58 Ga0070707_100232247 3300005468 Bacteria 1795
59 Ga0070707_101051257 3300005468 Bacteria 780
60 Ga0070707_101277010 3300005468 Unclassified 700
61 Ga0070698_100021709 3300005471 Bacteria 6721
62 Ga0070698_100025047 3300005471 Bacteria 6219
63 Ga0070699_100000004 3300005518 Bacteria 404262
64 Ga0070699_100145331 3300005518 Bacteria 2095
65 Ga0070684_100455447 3300005535 Bacteria 1183
66 Ga0068853_100200520 3300005539 Bacteria 1816
67 Ga0070686_100225251 3300005544 Bacteria 1357
68 Ga0070695_100029576 3300005545 Bacteria 3404
69 Ga0070695_100182596 3300005545 Unclassified 1487
70 Ga0070695_100475859 3300005545 Bacteria 962
71 Ga0070695_101472971 3300005545 Bacteria 566
72 Ga0070696_100035221 3300005546 Bacteria 3445
73 Ga0070696_100239636 3300005546 Bacteria 1367
74 Ga0070696_100515353 3300005546 Bacteria 953
75 Ga0070696_100689416 3300005546 Bacteria 832
76 Ga0070696_101044509 3300005546 Unclassified 684
77 Ga0070693_100009016 3300005547 Bacteria 4950
78 Ga0070693_100059412 3300005547 Bacteria 2216
79 Ga0070704_100050870 3300005549 Bacteria 2915
80 Ga0070704_100264317 3300005549 Bacteria 1419
81 Ga0070704_100919798 3300005549 Unclassified 788
82 Ga0070704_101103407 3300005549 Bacteria 721
83 Ga0068855_100141627 3300005563 Bacteria 2740
84 Ga0068855_100228680 3300005563 Bacteria 2084
85 Ga0068855_100617267 3300005563 Bacteria 1168
86 Ga0070664_100261858 3300005564 Bacteria 1556
87 Ga0070664_101376385 3300005564 Bacteria 667
88 Ga0068857_100273986 3300005577 Unclassified 1551
89 Ga0068856_102158110 3300005614 Bacteria 566
90 Ga0070702_101101021 3300005615 Bacteria 635
91 Ga0068852_100652701 3300005616 Bacteria 1060
92 Ga0068859_100157958 3300005617 Bacteria 2346
93 Ga0068864_100123647 3300005618 Unclassified 2316
94 Ga0068864_100488412 3300005618 Bacteria 1183
95 Ga0068864_101354862 3300005618 Bacteria 713
96 Ga0068864_101380804 3300005618 Bacteria 706
97 Ga0068864_101462556 3300005618 Bacteria 686
98 Ga0068866_10271079 3300005718 Bacteria 1047
99 Ga0068866_10969477 3300005718 Bacteria 602
100 Ga0068851_10539047 3300005834 Bacteria 704
101 Ga0068863_100036037 3300005841 Bacteria 4711
102 Ga0068863_100946278 3300005841 Bacteria 863
103 Ga0068863_101046334 3300005841 Unclassified 820
104 Ga0068863_102245479 3300005841 Bacteria 556
105 Ga0068858_100273481 3300005842 Bacteria 1608
106 Ga0068860_100043291 3300005843 Bacteria 4296
107 Ga0068860_100484279 3300005843 Bacteria 1233
108 Ga0068862_100077153 3300005844 Bacteria 2885
109 Ga0068862_100539644 3300005844 Bacteria 1112
110 Ga0068862_100807538 3300005844 Bacteria 916
111 Ga0068862_102712282 3300005844 Unclassified 507
112 Ga0081455_10006776 3300005937 Bacteria 12223
113 Ga0081540_1047402 3300005983 Bacteria 2161
114 Ga0070717_10028882 3300006028 Bacteria 4444
115 Ga0070717_10464693 3300006028 Unclassified 1141
116 Ga0070716_100240870 3300006173 Bacteria 1226
117 Ga0070716_100496346 3300006173 Bacteria 899
118 Ga0070712_100157115 3300006175 Bacteria 1752
119 Ga0068871_100040849 3300006358 Bacteria 3717
120 Ga0075433_10069899 3300006852 Bacteria 3085
121 Ga0075433_11339456 3300006852 Unclassified 620
122 Ga0068865_100019790 3300006881 Bacteria 4359
123 Ga0075436_100493628 3300006914 Bacteria 895
124 Ga0097620_100157956 3300006931 Bacteria 2346
125 Ga0105240_11268427 3300009093 Bacteria 778
126 Ga0105245_10200303 3300009098 Bacteria 1917
127 Ga0105243_11017267 3300009148 Bacteria 832
128 Ga0105243_12125239 3300009148 Unclassified 597
129 Ga0105241_10141241 3300009174 Bacteria 1961
130 Ga0105242_10207910 3300009176 Bacteria 1742
131 Ga0105242_11851681 3300009176 Bacteria 643
132 Ga0105237_10120041 3300009545 Bacteria 2623
133 Ga0105249_10540985 3300009553 Bacteria 1214
134 Ga0105249_10628728 3300009553 Unclassified 1130
135 Ga0105249_12746414 3300009553 Bacteria 564
136 Ga0105246_10096710 3300011119 Bacteria 2141
137 Ga0105246_11026095 3300011119 Bacteria 748
138 Ga0105246_11972572 3300011119 Bacteria 562
139 Ga0105246_11997132 3300011119 Bacteria 559
140 Ga0105246_12087740 3300011119 Bacteria 549
141 Ga0157318_1012254 3300012482 Bacteria 660
142 Ga0157316_1003059 3300012510 Bacteria 1181
143 Ga0157371_10070723 3300013102 Bacteria 2470
144 Ga0157370_10186900 3300013104 Bacteria 1923
145 Ga0157369_10675143 3300013105 Bacteria 1065
146 Ga0157369_11547239 3300013105 Bacteria 675
147 Ga0157374_10037584 3300013296 Bacteria 4445
148 Ga0157378_10014963 3300013297 Bacteria 6792
149 Ga0157378_10443411 3300013297 Bacteria 1287
150 Ga0163162_10062367 3300013306 Bacteria 3768
151 Ga0163162_10139606 3300013306 Bacteria 2536
152 Ga0157372_10036295 3300013307 Bacteria 5432
153 Ga0157372_10127864 3300013307 Bacteria 2922
154 Ga0157372_10143492 3300013307 Bacteria 2753
155 Ga0157375_10067054 3300013308 Bacteria 3585
156 Ga0163163_10098416 3300014325 Bacteria 2946
157 Ga0163163_10254678 3300014325 Bacteria 1806
158 Ga0163163_10525034 3300014325 Unclassified 1246
159 Ga0157380_11643945 3300014326 Unclassified 699
160 Ga0157380_12551658 3300014326 Unclassified 577
161 Ga0157377_11020498 3300014745 Bacteria 628
162 Ga0157379_10586301 3300014968 Bacteria 1040
163 Ga0157376_10002654 3300014969 Bacteria 12159
164 Ga0157376_10012694 3300014969 Bacteria 6263
165 Ga0157376_11237564 3300014969 Bacteria 775
166 Ga0207697_10148718 3300025315 Bacteria 1018
167 Ga0207656_10545157 3300025321 Bacteria 590
168 Ga0207653_10000021 3300025885 Bacteria 127411
169 Ga0207682_10398992 3300025893 Bacteria 650
170 Ga0207692_10072154 3300025898 Unclassified 1823
171 Ga0207642_10108699 3300025899 Bacteria 1408
172 Ga0207688_10348303 3300025901 Bacteria 912
173 Ga0207647_10023990 3300025904 Bacteria 4026
174 Ga0207699_10053026 3300025906 Bacteria 2403
175 Ga0207645_10340658 3300025907 Bacteria 1002
176 Ga0207645_11128594 3300025907 Bacteria 528
177 Ga0207684_10000537 3300025910 Bacteria 46979
178 Ga0207684_10025320 3300025910 Bacteria 5055
179 Ga0207684_10551057 3300025910 Bacteria 986
180 Ga0207684_10928126 3300025910 Bacteria 731
181 Ga0207671_10072073 3300025914 Bacteria 2578
182 Ga0207693_10015913 3300025915 Bacteria 6022
183 Ga0207663_10109111 3300025916 Bacteria 1875
184 Ga0207663_10498366 3300025916 Bacteria 946
185 Ga0207660_11699971 3300025917 Bacteria 507
186 Ga0207662_10417616 3300025918 Bacteria 912
187 Ga0207646_10000293 3300025922 Bacteria 67869
188 Ga0207646_10047145 3300025922 Bacteria 3866
189 Ga0207646_10085467 3300025922 Bacteria 2822
190 Ga0207646_10133017 3300025922 Bacteria 2239
191 Ga0207646_10145351 3300025922 Bacteria 2137
192 Ga0207646_10256027 3300025922 Unclassified 1582
193 Ga0207646_10918322 3300025922 Bacteria 776
194 Ga0207681_10005397 3300025923 Bacteria 7851
195 Ga0207650_10002116 3300025925 Bacteria 13877
196 Ga0207650_10110385 3300025925 Bacteria 2128
197 Ga0207659_10387125 3300025926 Bacteria 1167
198 Ga0207659_11214266 3300025926 Bacteria 648
199 Ga0207700_10096089 3300025928 Bacteria 2352
200 Ga0207700_10844603 3300025928 Bacteria 819
201 Ga0207664_10257506 3300025929 Bacteria 1525
202 Ga0207690_10165313 3300025932 Bacteria 1653
203 Ga0207706_10000106 3300025933 Bacteria 88479
204 Ga0207709_10910665 3300025935 Unclassified 715
205 Ga0207709_11064851 3300025935 Unclassified 663
206 Ga0207670_10015870 3300025936 Unclassified 4510
207 Ga0207704_10742912 3300025938 Bacteria 815
208 Ga0207665_10007799 3300025939 Bacteria 7064
209 Ga0207665_10011569 3300025939 Bacteria 5797
210 Ga0207665_10691135 3300025939 Bacteria 802
211 Ga0207665_11070217 3300025939 Bacteria 642
212 Ga0207665_11196107 3300025939 Bacteria 606
213 Ga0207711_10816963 3300025941 Bacteria 868
214 Ga0207711_11057397 3300025941 Bacteria 752
215 Ga0207689_10002220 3300025942 Bacteria 18185
216 Ga0207689_10015254 3300025942 Bacteria 6506
217 Ga0207689_10015444 3300025942 Bacteria 6465
218 Ga0207689_10058704 3300025942 Bacteria 3165
219 Ga0207661_11088892 3300025944 Bacteria 736
220 Ga0207679_10209403 3300025945 Bacteria 1634
221 Ga0207667_10186948 3300025949 Bacteria 2126
222 Ga0207667_10218818 3300025949 Bacteria 1951
223 Ga0207667_10622394 3300025949 Bacteria 1087
224 Ga0207712_10843847 3300025961 Bacteria 807
225 Ga0207677_11271665 3300026023 Bacteria 675
226 Ga0207703_10006285 3300026035 Bacteria 9499
227 Ga0207639_10108670 3300026041 Bacteria 2256
228 Ga0207708_10210925 3300026075 Bacteria 1552
229 Ga0207641_10043507 3300026088 Bacteria 3772
230 Ga0207641_10308526 3300026088 Bacteria 1497
231 Ga0207641_10830232 3300026088 Bacteria 915
232 Ga0207648_10368127 3300026089 Bacteria 1298
233 Ga0207676_10264805 3300026095 Bacteria 1554
234 Ga0207676_10437560 3300026095 Bacteria 1230
235 Ga0207674_10221624 3300026116 Unclassified 1840
236 Ga0207698_10623503 3300026142 Bacteria 1065
237 Ga0268265_10093499 3300028380 Bacteria 2409
238 Ga0268265_12165811 3300028380 Bacteria 563
239 Ga0268264_10049936 3300028381 Bacteria 3482
240 Ga0268264_10677147 3300028381 Bacteria 1023
241 Ga0265760_10000019 3300031090 Bacteria 81444
242 Ga0265760_10075406 3300031090 Bacteria 1039
243 Ga0265760_10177741 3300031090 Bacteria 710
244 Ga0265327_10000010 3300031251 Bacteria 566817
245 Ga0307408_100047274 3300031548 Bacteria 3081
246 Ga0307408_100787912 3300031548 Bacteria 862
247 Ga0307408_102063549 3300031548 Bacteria 549
248 Ga0307516_10018161 3300031730 Bacteria 7314
249 Ga0307405_10466930 3300031731 Unclassified 1004
250 Ga0307413_10488842 3300031824 Bacteria 986
251 Ga0307413_11610331 3300031824 Bacteria 577
252 Ga0307410_10103774 3300031852 Bacteria 2043
253 Ga0307406_10119736 3300031901 Bacteria 1828
254 Ga0307406_10385186 3300031901 Unclassified 1107
255 Ga0307407_11502670 3300031903 Bacteria 533
256 Ga0307407_11696926 3300031903 Unclassified 503
257 Ga0307412_10611179 3300031911 Bacteria 925
258 Ga0307412_10622897 3300031911 Bacteria 917
259 Ga0307412_10743352 3300031911 Bacteria 846
260 Ga0307412_10886427 3300031911 Unclassified 781
261 Ga0307412_11149455 3300031911 Bacteria 693
262 Ga0307416_100608164 3300032002 Bacteria 1174
263 Ga0307416_101879457 3300032002 Bacteria 702
264 Ga0307414_10129313 3300032004 Bacteria 1957
265 Ga0307414_11587397 3300032004 Bacteria 610
266 Ga0307411_10079780 3300032005 Bacteria 2248
267 Ga0307411_10141299 3300032005 Bacteria 1776
268 Ga0373943_0267408 3300035170 Bacteria 964
269 Ga0373946_0717590 3300035171 Bacteria 523
270 Ga0373931_0424092 3300035691 Bacteria 846
271 Ga0395899_0189965 3300037312 Bacteria 1437
272 Ga0395899_0686507 3300037312 Bacteria 643
273 Ga0395900_0014175 3300037418 Bacteria 8140
274 Ga0395901_0007090 3300038443 Bacteria 11330
275 Ga0237819_01339 3300038705 Bacteria 6505
276 Ga0439436_0238665 3300041404 Bacteria 525
277 Ga0439439_0027355 3300041406 Bacteria 1441
278 Ga0439465_0271855 3300041413 Bacteria 630
279 Ga0439449_0398406 3300042007 Bacteria 522
280 Ga0439457_082194 3300042014 Bacteria 741
281 Ga0439462_0130758 3300042015 Bacteria 701
282 Ga0439446_0291929 3300042156 Unclassified 571
283 Ga0439434_0029375 3300042435 Bacteria 1667
284 Ga0495590_0328739 3300046457 Bacteria 578
285 Ga0495653_0005289 3300046463 Bacteria 10498
286 Ga0495580_0946377 3300046472 Unclassified 551
287 Ga0495639_0497923 3300046475 Unclassified 622
288 Ga0495639_0561852 3300046475 Unclassified 585
289 Ga0495632_0118439 3300046519 Bacteria 1238
290 Ga0495663_0030763 3300046525 Bacteria 1592
291 Ga0495666_0004061 3300046526 Bacteria 7396
292 Ga0495621_0064810 3300046539 Bacteria 1334
293 Ga0495645_0192828 3300046543 Bacteria 1387
294 Ga0495634_0060620 3300046642 Bacteria 2517
295 Ga0495646_0036254 3300046680 Bacteria 3055
296 Ga0495658_0662857 3300046683 Unclassified 668
297 Ga0495613_0013812 3300046689 Bacteria 5990
298 Ga0495624_0001785 3300046690 Bacteria 16464
299 Ga0495624_0218511 3300046690 Bacteria 1156
300 Ga0495600_0014072 3300046809 Bacteria 5039
301 Ga0495672_0002574 3300047320 Bacteria 16488
302 Ga0495672_0023768 3300047320 Bacteria 3960
303 Ga0495676_0059937 3300047321 Bacteria 2985
304 Ga0495680_0007326 3300047322 Bacteria 10148
305 Ga0495684_0060744 3300047471 Bacteria 2876
306 Ga0495593_0013670 3300047673 Bacteria 4625
307 Ga0495602_0002770 3300048088 Bacteria 17918
308 Ga0496102_0295861 3300048905 Bacteria 1526
309 Ga0496103_0893839 3300048906 Bacteria 557
310 Ga0496106_0597982 3300048909 Bacteria 883
311 Ga0496107_0220332 3300048910 Bacteria 1411
312 Ga0496108_0499398 3300048911 Bacteria 1062
313 Ga0496109_0257791 3300048912 Bacteria 1642
314 Ga0496110_0285879 3300048913 Bacteria 1502
315 Ga0496110_0770424 3300048913 Unclassified 866
316 Ga0496112_0001076 3300048915 Bacteria 20196
317 Ga0496115_0976584 3300048918 Bacteria 649
318 Ga0501299_024829 3300049522 Bacteria 1121
319 Ga0501036_1394298 3300049572 Bacteria 568
320 Ga0501042_1262963 3300049578 Bacteria 538
321 Ga0501072_0014381 3300049588 Bacteria 6066
322 Ga0501077_0607975 3300049593 Bacteria 702
323 Ga0501249_149623 3300049679 Bacteria 587
324 Ga0501225_0265838 3300049705 Bacteria 569
325 Ga0501245_042283 3300049708 Bacteria 787
326 Ga0501079_0224902 3300049741 Bacteria 1466
327 nmdc:mga05p37_940116_c1 3300050507 Bacteria 927
328 nmdc:mga09592_75308_c1 3300050508 Bacteria 2869
329 nmdc:mga06r32_1272793_c1 3300050510 Bacteria 680
330 nmdc:mga08x19_723664_c1 3300050514 Bacteria 706
331 nmdc:mga0a205_1106046_c1 3300050515 Bacteria 640
332 Ga0500568_0187536 3300053139 Unclassified 759
333 Ga0500590_152108 3300053148 Bacteria 1042
334 Ga0587070_215490 3300059491 Bacteria 518
335 Ga0587076_194666 3300059645 Bacteria 518
336 Ga0530510_0048637 3300061734 Bacteria 3065
337 2624480063 2623620443 Bacteria 6427864
338 2919068447 2919063839 Bacteria 6302690
339 Ga0070705_101602690
340 JGI25404J52841_10025640
341 JGI25405J52794_10095444
342 Ga0065704_10639512
343 Ga0065715_10363414
344 Ga0070670_100013260
345 Ga0070670_100171124
346 Ga0070670_100522284
347 Ga0070677_10602210
348 Ga0068869_100001010
349 Ga0068869_100040595
350 Ga0068869_100114725
351 Ga0068869_100120821
352 Ga0070680_100957136
353 Ga0070680_101311020
354 Ga0068868_100065071
355 Ga0068868_100116793
356 Ga0068868_101072258
357 Ga0070689_100010003
358 Ga0070687_101067336
359 Ga0070669_100003176
360 Ga0070669_101986819
361 Ga0070675_100509774
362 Ga0070675_100608513
363 Ga0070675_100673599
364 Ga0070675_101527142
365 Ga0070671_100341259
366 Ga0070671_100440998
367 Ga0070671_101000558
368 Ga0070674_100713601
369 Ga0070673_101816627
370 Ga0070659_100199669
371 Ga0070703_10000567
372 Ga0070714_100115962
373 Ga0070714_100777265
374 Ga0070713_100027271
375 Ga0070713_100727459
376 Ga0070713_101066771
377 Ga0070711_100104416
378 Ga0070705_100000530
379 Ga0070694_100329429
380 Ga0070694_101497842
381 Ga0070694_101635354
382 Ga0070708_100036258
383 Ga0070708_100190242
384 Ga0070708_100502637
385 Ga0070708_100629877
386 Ga0070708_100786254
387 Ga0070662_100000172
388 Ga0068867_100124200
389 Ga0068867_100366281
390 Ga0070706_100000327
391 Ga0070706_100013440
392 Ga0070706_100192085
393 Ga0070707_100000056
394 Ga0070707_100056709
395 Ga0070707_100075140
396 Ga0070707_100232247
397 Ga0070707_101051257
398 Ga0070707_101277010
399 Ga0070698_100021709
400 Ga0070698_100025047
401 Ga0070699_100000004
402 Ga0070699_100145331
403 Ga0070684_100455447
404 Ga0068853_100200520
405 Ga0070686_100225251
406 Ga0070695_100029576
407 Ga0070695_100182596
408 Ga0070695_100475859
409 Ga0070695_101472971
410 Ga0070696_100035221
411 Ga0070696_100239636
412 Ga0070696_100515353
413 Ga0070696_100689416
414 Ga0070696_101044509
415 Ga0070693_100009016
416 Ga0070693_100059412
417 Ga0070704_100050870
418 Ga0070704_100264317
419 Ga0070704_100919798
420 Ga0070704_101103407
421 Ga0068855_100141627
422 Ga0068855_100228680
423 Ga0068855_100617267
424 Ga0070664_100261858
425 Ga0070664_101376385
426 Ga0068857_100273986
427 Ga0068856_102158110
428 Ga0070702_101101021
429 Ga0068852_100652701
430 Ga0068859_100157958
431 Ga0068864_100123647
432 Ga0068864_100488412
433 Ga0068864_101354862
434 Ga0068864_101380804
435 Ga0068864_101462556
436 Ga0068866_10271079
437 Ga0068866_10969477
438 Ga0068851_10539047
439 Ga0068863_100036037
440 Ga0068863_100946278
441 Ga0068863_101046334
442 Ga0068863_102245479
443 Ga0068858_100273481
444 Ga0068860_100043291
445 Ga0068860_100484279
446 Ga0068862_100077153
447 Ga0068862_100539644
448 Ga0068862_100807538
449 Ga0068862_102712282
450 Ga0081455_10006776
451 Ga0081540_1047402
452 Ga0070717_10028882
453 Ga0070717_10464693
454 Ga0070716_100240870
455 Ga0070716_100496346
456 Ga0070712_100157115
457 Ga0068871_100040849
458 Ga0075433_10069899
459 Ga0075433_11339456
460 Ga0068865_100019790
461 Ga0075436_100493628
462 Ga0097620_100157956
463 Ga0105240_11268427
464 Ga0105245_10200303
465 Ga0105243_11017267
466 Ga0105243_12125239
467 Ga0105241_10141241
468 Ga0105242_10207910
469 Ga0105242_11851681
470 Ga0105237_10120041
471 Ga0105249_10540985
472 Ga0105249_10628728
473 Ga0105249_12746414
474 Ga0105246_10096710
475 Ga0105246_11026095
476 Ga0105246_11972572
477 Ga0105246_11997132
478 Ga0105246_12087740
479 Ga0157318_1012254
480 Ga0157316_1003059
481 Ga0157371_10070723
482 Ga0157370_10186900
483 Ga0157369_10675143
484 Ga0157369_11547239
485 Ga0157374_10037584
486 Ga0157378_10014963
487 Ga0157378_10443411
488 Ga0163162_10062367
489 Ga0163162_10139606
490 Ga0157372_10036295
491 Ga0157372_10127864
492 Ga0157372_10143492
493 Ga0157375_10067054
494 Ga0163163_10098416
495 Ga0163163_10254678
496 Ga0163163_10525034
497 Ga0157380_11643945
498 Ga0157380_12551658
499 Ga0157377_11020498
500 Ga0157379_10586301
501 Ga0157376_10002654
502 Ga0157376_10012694
503 Ga0157376_11237564
504 Ga0207697_10148718
505 Ga0207656_10545157
506 Ga0207653_10000021
507 Ga0207682_10398992
508 Ga0207692_10072154
509 Ga0207642_10108699
510 Ga0207688_10348303
511 Ga0207647_10023990
512 Ga0207699_10053026
513 Ga0207645_10340658
514 Ga0207645_11128594
515 Ga0207684_10000537
516 Ga0207684_10025320
517 Ga0207684_10551057
518 Ga0207684_10928126
519 Ga0207671_10072073
520 Ga0207693_10015913
521 Ga0207663_10109111
522 Ga0207663_10498366
523 Ga0207660_11699971
524 Ga0207662_10417616
525 Ga0207646_10000293
526 Ga0207646_10047145
527 Ga0207646_10085467
528 Ga0207646_10133017
529 Ga0207646_10145351
530 Ga0207646_10256027
531 Ga0207646_10918322
532 Ga0207681_10005397
533 Ga0207650_10002116
534 Ga0207650_10110385
535 Ga0207659_10387125
536 Ga0207659_11214266
537 Ga0207700_10096089
538 Ga0207700_10844603
539 Ga0207664_10257506
540 Ga0207690_10165313
541 Ga0207706_10000106
542 Ga0207709_10910665
543 Ga0207709_11064851
544 Ga0207670_10015870
545 Ga0207704_10742912
546 Ga0207665_10007799
547 Ga0207665_10011569
548 Ga0207665_10691135
549 Ga0207665_11070217
550 Ga0207665_11196107
551 Ga0207711_10816963
552 Ga0207711_11057397
553 Ga0207689_10002220
554 Ga0207689_10015254
555 Ga0207689_10015444
556 Ga0207689_10058704
557 Ga0207661_11088892
558 Ga0207679_10209403
559 Ga0207667_10186948
560 Ga0207667_10218818
561 Ga0207667_10622394
562 Ga0207712_10843847
563 Ga0207677_11271665
564 Ga0207703_10006285
565 Ga0207639_10108670
566 Ga0207708_10210925
567 Ga0207641_10043507
568 Ga0207641_10308526
569 Ga0207641_10830232
570 Ga0207648_10368127
571 Ga0207676_10264805
572 Ga0207676_10437560
573 Ga0207674_10221624
574 Ga0207698_10623503
575 Ga0268265_10093499
576 Ga0268265_12165811
577 Ga0268264_10049936
578 Ga0268264_10677147
579 Ga0265760_10000019
580 Ga0265760_10075406
581 Ga0265760_10177741
582 Ga0265327_10000010
583 Ga0307408_100047274
584 Ga0307408_100787912
585 Ga0307408_102063549
586 Ga0307516_10018161
587 Ga0307405_10466930
588 Ga0307413_10488842
589 Ga0307413_11610331
590 Ga0307410_10103774
591 Ga0307406_10119736
592 Ga0307406_10385186
593 Ga0307407_11502670
594 Ga0307407_11696926
595 Ga0307412_10611179
596 Ga0307412_10622897
597 Ga0307412_10743352
598 Ga0307412_10886427
599 Ga0307412_11149455
600 Ga0307416_100608164
601 Ga0307416_101879457
602 Ga0307414_10129313
603 Ga0307414_11587397
604 Ga0307411_10079780
605 Ga0307411_10141299
606 Ga0373943_0267408
607 Ga0373946_0717590
608 Ga0373931_0424092
609 Ga0395899_0189965
610 Ga0395899_0686507
611 Ga0395900_0014175
612 Ga0395901_0007090
613 Ga0237819_01339
614 Ga0439436_0238665
615 Ga0439439_0027355
616 Ga0439465_0271855
617 Ga0439449_0398406
618 Ga0439457_082194
619 Ga0439462_0130758
620 Ga0439446_0291929
621 Ga0439434_0029375
622 Ga0495590_0328739
623 Ga0495653_0005289
624 Ga0495580_0946377
625 Ga0495639_0497923
626 Ga0495639_0561852
627 Ga0495632_0118439
628 Ga0495663_0030763
629 Ga0495666_0004061
630 Ga0495621_0064810
631 Ga0495645_0192828
632 Ga0495634_0060620
633 Ga0495646_0036254
634 Ga0495658_0662857
635 Ga0495613_0013812
636 Ga0495624_0001785
637 Ga0495624_0218511
638 Ga0495600_0014072
639 Ga0495672_0002574
640 Ga0495672_0023768
641 Ga0495676_0059937
642 Ga0495680_0007326
643 Ga0495684_0060744
644 Ga0495593_0013670
645 Ga0495602_0002770
646 Ga0496102_0295861
647 Ga0496103_0893839
648 Ga0496106_0597982
649 Ga0496107_0220332
650 Ga0496108_0499398
651 Ga0496109_0257791
652 Ga0496110_0285879
653 Ga0496110_0770424
654 Ga0496112_0001076
655 Ga0496115_0976584
656 Ga0501299_024829
657 Ga0501036_1394298
658 Ga0501042_1262963
659 Ga0501072_0014381
660 Ga0501077_0607975
661 Ga0501249_149623
662 Ga0501225_0265838
663 Ga0501245_042283
664 Ga0501079_0224902
665 nmdc:mga05p37_940116_c1
666 nmdc:mga09592_75308_c1
667 nmdc:mga06r32_1272793_c1
668 nmdc:mga08x19_723664_c1
669 nmdc:mga0a205_1106046_c1
670 Ga0500568_0187536
671 Ga0500590_152108
672 Ga0587070_215490
673 Ga0587076_194666
674 Ga0530510_0048637
675 2624480063
676 2919068447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

4

80

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8779 3 84
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8581 3 84
2hxv-assembly1.cif.gz_A-2 crystal structure of a diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil reductase (tm1828) from thermotoga maritima at 1.80 a resolution 0.7242 36 57
2qe2-assembly1.cif.gz_A structure of hcv ns5b bound to an anthranilic acid inhibitor 0.6856 24 70
5vdf-assembly6.cif.gz_C crystal structure of cu(i)-loaded yeast atx1: crystal form ii 0.6779 2 80
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8708 4 84 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8509 4 84 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.822 1 80 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7783 1 80 3.30.70.3090
2zhoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.6861 3 70 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A286C6H2-F1-model_v4 DUF4242 domain-containing protein 1.001 1 80
AF-A0A4V3UYL4-F1-model_v4 DUF4242 domain-containing protein 0.9945 1 85
AF-A0A530QG42-F1-model_v4 DUF4242 domain-containing protein 0.9923 1 82
AF-A0A286C6H2-F1-model_v4 DUF4242 domain-containing protein 0.9888 1 80
AF-A0A7Y2HHT9-F1-model_v4 DUF4242 domain-containing protein 0.9887 2 89

Map