F413372

General Info

Members Datasets Scaffolds Average Seq Length
338 191 336 112

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100013446|Ga0068869_1000134462
Length 127
Sequence MPVFFLQLHLQPKRESMYKLKINFEEKGVAPVTFENLEPNQTLLEICLKNDIELHHNCGGVCACTTCHLYIDKGMDSIDEITDKEEDFIDRAVNPRLSSRLGCQSLLLDGDGEIEITLPDQTQFLGE

Samples

Sample ID Description Type Environment
1 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
2 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
141 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 0.59
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004241 3300002459 Bacteria 2909
2 JGI25157J39369_1014248 3300002741 Bacteria 990
3 Ga0065714_10303813 3300005288 Bacteria 690
4 Ga0065704_10388427 3300005289 Unclassified 765
5 Ga0065712_10084512 3300005290 Unclassified 2758
6 Ga0065715_10039073 3300005293 Bacteria 1100
7 Ga0065715_10468693 3300005293 Bacteria 808
8 Ga0070683_100670415 3300005329 Bacteria 993
9 Ga0070690_100686952 3300005330 Bacteria 785
10 Ga0070670_100037560 3300005331 Bacteria 4167
11 Ga0070670_100489105 3300005331 Bacteria 1093
12 Ga0070670_101258709 3300005331 Bacteria 677
13 Ga0070670_101783565 3300005331 Bacteria 566
14 Ga0070670_101829273 3300005331 Bacteria 559
15 Ga0068869_100013446 3300005334 Bacteria 5445
16 Ga0068869_100846781 3300005334 Bacteria 789
17 Ga0068869_101132704 3300005334 Bacteria 685
18 Ga0070666_10494516 3300005335 Bacteria 886
19 Ga0068868_100152036 3300005338 Bacteria 1906
20 Ga0070689_100044909 3300005340 Bacteria 3400
21 Ga0070689_100153792 3300005340 Bacteria 1856
22 Ga0070687_100280320 3300005343 Unclassified 1049
23 Ga0070687_101342622 3300005343 Unclassified 532
24 Ga0070661_101776071 3300005344 Bacteria 523
25 Ga0070668_100169244 3300005347 Bacteria 1778
26 Ga0070668_100412062 3300005347 Bacteria 1156
27 Ga0070668_100608273 3300005347 Unclassified 957
28 Ga0070669_100046507 3300005353 Bacteria 3165
29 Ga0070669_100469571 3300005353 Bacteria 1039
30 Ga0070669_101339046 3300005353 Unclassified 620
31 Ga0070675_101400897 3300005354 Bacteria 644
32 Ga0070675_101452117 3300005354 Bacteria 632
33 Ga0070671_101244359 3300005355 Bacteria 656
34 Ga0070674_100856747 3300005356 Bacteria 788
35 Ga0070673_100078786 3300005364 Bacteria 2666
36 Ga0070673_100552612 3300005364 Bacteria 1046
37 Ga0070688_100049396 3300005365 Bacteria 2617
38 Ga0070667_101976847 3300005367 Bacteria 549
39 Ga0070700_100128366 3300005441 Bacteria 1708
40 Ga0070694_101697218 3300005444 Unclassified 537
41 Ga0070678_100593199 3300005456 Bacteria 988
42 Ga0070678_101538095 3300005456 Bacteria 624
43 Ga0068867_100434284 3300005459 Bacteria 1115
44 Ga0068867_100843090 3300005459 Bacteria 821
45 Ga0068867_100849793 3300005459 Unclassified 818
46 Ga0068867_101039610 3300005459 Bacteria 745
47 Ga0068867_101522298 3300005459 Unclassified 623
48 Ga0070685_10137649 3300005466 Bacteria 1533
49 Ga0070685_10282194 3300005466 Bacteria 1112
50 Ga0070685_10330224 3300005466 Bacteria 1036
51 Ga0070706_101531506 3300005467 Bacteria 609
52 Ga0070698_100001455 3300005471 Bacteria 26296
53 Ga0070698_100002086 3300005471 Bacteria 22201
54 Ga0068853_100008858 3300005539 Bacteria 8097
55 Ga0068853_100700424 3300005539 Bacteria 966
56 Ga0070672_100150532 3300005543 Bacteria 1925
57 Ga0070672_100330906 3300005543 Unclassified 1296
58 Ga0070672_101314866 3300005543 Unclassified 646
59 Ga0070686_100346008 3300005544 Bacteria 1115
60 Ga0070695_100885563 3300005545 Bacteria 720
61 Ga0070693_100297682 3300005547 Bacteria 1086
62 Ga0070664_101810890 3300005564 Unclassified 579
63 Ga0070664_102203168 3300005564 Bacteria 523
64 Ga0068857_100045001 3300005577 Bacteria 3915
65 Ga0070702_100958872 3300005615 Bacteria 674
66 Ga0068852_100406273 3300005616 Bacteria 1340
67 Ga0068859_100097843 3300005617 Unclassified 2988
68 Ga0068859_100172006 3300005617 Unclassified 2247
69 Ga0068859_100323343 3300005617 Unclassified 1636
70 Ga0068859_100383627 3300005617 Bacteria 1501
71 Ga0068864_100135085 3300005618 Bacteria 2220
72 Ga0068864_100216431 3300005618 Bacteria 1766
73 Ga0068864_100385192 3300005618 Bacteria 1329
74 Ga0068864_101497575 3300005618 Unclassified 678
75 Ga0068864_102458130 3300005618 Bacteria 527
76 Ga0068861_100062234 3300005719 Bacteria 2866
77 Ga0068861_100143337 3300005719 Bacteria 1952
78 Ga0068861_100838284 3300005719 Unclassified 866
79 Ga0068851_10047674 3300005834 Bacteria 2170
80 Ga0068870_10011641 3300005840 Unclassified 4087
81 Ga0068870_10897803 3300005840 Bacteria 626
82 Ga0068863_100258983 3300005841 Bacteria 1681
83 Ga0068863_100262375 3300005841 Bacteria 1670
84 Ga0068863_101136145 3300005841 Bacteria 786
85 Ga0068863_101385571 3300005841 Archaea 711
86 Ga0068863_102318613 3300005841 Bacteria 546
87 Ga0068858_100116672 3300005842 Bacteria 2495
88 Ga0068860_100206522 3300005843 Bacteria 1905
89 Ga0068860_100610493 3300005843 Unclassified 1097
90 Ga0068860_100698687 3300005843 Unclassified 1024
91 Ga0068862_101132194 3300005844 Bacteria 779
92 Ga0075366_10567027 3300006195 Unclassified 703
93 Ga0097621_100324629 3300006237 Bacteria 1364
94 Ga0068871_100171713 3300006358 Bacteria 1859
95 Ga0068871_100280120 3300006358 Bacteria 1458
96 Ga0075428_100001878 3300006844 Bacteria 22540
97 Ga0075428_100061237 3300006844 Bacteria 4121
98 Ga0075430_100095144 3300006846 Bacteria 2490
99 Ga0075431_100307378 3300006847 Bacteria 1601
100 Ga0075429_100001931 3300006880 Bacteria 17186
101 Ga0075429_100052501 3300006880 Bacteria 3547
102 Ga0068865_101577525 3300006881 Unclassified 590
103 Ga0068865_101747389 3300006881 Bacteria 561
104 Ga0097620_100097845 3300006931 Unclassified 2988
105 Ga0097620_100172008 3300006931 Unclassified 2247
106 Ga0097620_100323345 3300006931 Unclassified 1636
107 Ga0097620_100383630 3300006931 Bacteria 1501
108 Ga0111539_10167394 3300009094 Bacteria 2569
109 Ga0111539_10579674 3300009094 Unclassified 1307
110 Ga0111539_10930513 3300009094 Unclassified 1011
111 Ga0105245_10418825 3300009098 Bacteria 1342
112 Ga0105247_10009905 3300009101 Bacteria 5774
113 Ga0105247_10941546 3300009101 Unclassified 670
114 Ga0114129_10062503 3300009147 Bacteria 5201
115 Ga0114129_10263410 3300009147 Unclassified 2309
116 Ga0105243_10440189 3300009148 Unclassified 1220
117 Ga0105242_10008224 3300009176 Bacteria 8016
118 Ga0105242_10014405 3300009176 Bacteria 6127
119 Ga0105242_10016179 3300009176 Bacteria 5794
120 Ga0105242_11232207 3300009176 Bacteria 769
121 Ga0105248_10164302 3300009177 Bacteria 2503
122 Ga0105249_10000611 3300009553 Bacteria 32583
123 Ga0105249_10001393 3300009553 Bacteria 21161
124 Ga0105249_10031748 3300009553 Unclassified 4778
125 Ga0105249_10075099 3300009553 Bacteria 3130
126 Ga0105249_10100046 3300009553 Unclassified 2726
127 Ga0105249_10397091 3300009553 Unclassified 1408
128 Ga0105249_10756917 3300009553 Bacteria 1034
129 Ga0105249_10944751 3300009553 Unclassified 930
130 Ga0105249_11381858 3300009553 Bacteria 776
131 Ga0105246_10408702 3300011119 Unclassified 1129
132 Ga0157373_10666629 3300013100 Bacteria 760
133 Ga0157371_10039559 3300013102 Bacteria 3372
134 Ga0157371_10314641 3300013102 Unclassified 1135
135 Ga0157370_10387087 3300013104 Bacteria 1288
136 Ga0157369_10126651 3300013105 Unclassified 2707
137 Ga0157369_11424192 3300013105 Unclassified 705
138 Ga0157369_12392917 3300013105 Unclassified 535
139 Ga0157374_12380073 3300013296 Unclassified 557
140 Ga0157378_10425351 3300013297 Bacteria 1313
141 Ga0157378_12234622 3300013297 Bacteria 598
142 Ga0157378_12650583 3300013297 Unclassified 554
143 Ga0157378_12822782 3300013297 Unclassified 538
144 Ga0163162_11360414 3300013306 Bacteria 807
145 Ga0163162_12109917 3300013306 Unclassified 646
146 Ga0163162_12469828 3300013306 Unclassified 597
147 Ga0157372_10233696 3300013307 Bacteria 2132
148 Ga0157372_10538220 3300013307 Bacteria 1362
149 Ga0157372_11701141 3300013307 Bacteria 726
150 Ga0157375_10390972 3300013308 Bacteria 1557
151 Ga0157375_10964309 3300013308 Bacteria 994
152 Ga0157375_11988280 3300013308 Bacteria 691
153 Ga0157375_12370902 3300013308 Unclassified 633
154 Ga0163163_10244122 3300014325 Unclassified 1846
155 Ga0163163_10250732 3300014325 Unclassified 1821
156 Ga0163163_10639108 3300014325 Bacteria 1128
157 Ga0163163_11860881 3300014325 Bacteria 662
158 Ga0163163_12423628 3300014325 Bacteria 583
159 Ga0163163_13349801 3300014325 Bacteria 500
160 Ga0157380_10026841 3300014326 Bacteria 4375
161 Ga0157380_10513970 3300014326 Bacteria 1166
162 Ga0157380_10727187 3300014326 Bacteria 1001
163 Ga0157380_10826314 3300014326 Bacteria 946
164 Ga0157380_11937091 3300014326 Bacteria 650
165 Ga0157380_13120171 3300014326 Bacteria 529
166 Ga0157377_11326385 3300014745 Bacteria 564
167 Ga0157377_11669254 3300014745 Unclassified 513
168 Ga0157377_11756348 3300014745 Bacteria 502
169 Ga0157379_10295644 3300014968 Bacteria 1475
170 Ga0157376_10684397 3300014969 Unclassified 1029
171 Ga0163161_10199530 3300017792 Bacteria 1541
172 Ga0163161_10235991 3300017792 Unclassified 1421
173 Ga0163161_10834315 3300017792 Bacteria 777
174 Ga0207666_1040998 3300025271 Bacteria 724
175 Ga0209455_1019102 3300025272 Bacteria 1392
176 Ga0207697_10030666 3300025315 Bacteria 2200
177 Ga0207682_10040074 3300025893 Bacteria 1907
178 Ga0207710_10009414 3300025900 Bacteria 4111
179 Ga0207680_10610229 3300025903 Bacteria 780
180 Ga0207685_10041275 3300025905 Unclassified 1725
181 Ga0207645_10131578 3300025907 Bacteria 1628
182 Ga0207645_10212616 3300025907 Bacteria 1274
183 Ga0207645_10500300 3300025907 Bacteria 823
184 Ga0207643_10003695 3300025908 Bacteria 8233
185 Ga0207705_10382712 3300025909 Unclassified 1087
186 Ga0207684_11435056 3300025910 Bacteria 564
187 Ga0207662_10309557 3300025918 Bacteria 1052
188 Ga0207650_10006365 3300025925 Bacteria 8040
189 Ga0207650_10062814 3300025925 Bacteria 2775
190 Ga0207650_10583032 3300025925 Bacteria 939
191 Ga0207650_10595219 3300025925 Unclassified 930
192 Ga0207650_10954049 3300025925 Bacteria 729
193 Ga0207659_11384262 3300025926 Unclassified 603
194 Ga0207686_10002249 3300025934 Bacteria 10600
195 Ga0207686_10053869 3300025934 Bacteria 2517
196 Ga0207686_10147419 3300025934 Bacteria 1634
197 Ga0207709_10146280 3300025935 Unclassified 1631
198 Ga0207670_10081086 3300025936 Bacteria 2270
199 Ga0207669_10259144 3300025937 Bacteria 1300
200 Ga0207704_10018696 3300025938 Bacteria 3624
201 Ga0207691_10116141 3300025940 Bacteria 2375
202 Ga0207691_10421549 3300025940 Unclassified 1137
203 Ga0207689_10032640 3300025942 Bacteria 4329
204 Ga0207689_10063754 3300025942 Bacteria 3032
205 Ga0207689_11158559 3300025942 Unclassified 651
206 Ga0207661_11472060 3300025944 Bacteria 624
207 Ga0207661_11674333 3300025944 Bacteria 581
208 Ga0207679_11310999 3300025945 Bacteria 664
209 Ga0207651_10154937 3300025960 Bacteria 1788
210 Ga0207712_10003748 3300025961 Bacteria 9593
211 Ga0207712_10003945 3300025961 Bacteria 9373
212 Ga0207712_10247327 3300025961 Bacteria 1440
213 Ga0207712_10562743 3300025961 Bacteria 982
214 Ga0207712_10739269 3300025961 Unclassified 861
215 Ga0207712_11114452 3300025961 Bacteria 703
216 Ga0207712_11515870 3300025961 Unclassified 601
217 Ga0207712_11914947 3300025961 Bacteria 531
218 Ga0207668_10222044 3300025972 Bacteria 1518
219 Ga0207640_10847197 3300025981 Bacteria 795
220 Ga0207658_10905451 3300025986 Bacteria 803
221 Ga0207658_11144237 3300025986 Bacteria 711
222 Ga0207658_11708259 3300025986 Unclassified 575
223 Ga0207658_11954433 3300025986 Bacteria 534
224 Ga0207677_10425680 3300026023 Unclassified 1132
225 Ga0207677_10632819 3300026023 Bacteria 942
226 Ga0207703_10174992 3300026035 Bacteria 1890
227 Ga0207639_10419971 3300026041 Bacteria 1209
228 Ga0207708_10036076 3300026075 Bacteria 3763
229 Ga0207708_11064616 3300026075 Bacteria 704
230 Ga0207641_10000873 3300026088 Bacteria 31566
231 Ga0207641_10055829 3300026088 Bacteria 3354
232 Ga0207641_10240867 3300026088 Bacteria 1685
233 Ga0207641_10766910 3300026088 Bacteria 953
234 Ga0207641_11566667 3300026088 Unclassified 661
235 Ga0207641_11587473 3300026088 Bacteria 656
236 Ga0207648_10034852 3300026089 Bacteria 4437
237 Ga0207648_10058604 3300026089 Bacteria 3358
238 Ga0207648_10094820 3300026089 Bacteria 2610
239 Ga0207648_10513027 3300026089 Unclassified 1098
240 Ga0207648_11961674 3300026089 Bacteria 547
241 Ga0207676_10014462 3300026095 Bacteria 5680
242 Ga0207676_10426119 3300026095 Bacteria 1245
243 Ga0207674_10150353 3300026116 Bacteria 2286
244 Ga0207675_100017141 3300026118 Bacteria 6764
245 Ga0207675_100097037 3300026118 Bacteria 2775
246 Ga0207675_100800013 3300026118 Bacteria 956
247 Ga0207675_102746717 3300026118 Bacteria 500
248 Ga0207683_10098563 3300026121 Unclassified 2608
249 Ga0207698_10466460 3300026142 Bacteria 1222
250 Ga0207428_10085039 3300027907 Unclassified 2464
251 Ga0268265_10485013 3300028380 Unclassified 1162
252 Ga0268265_10845262 3300028380 Bacteria 895
253 Ga0268264_10533310 3300028381 Unclassified 1149
254 Ga0268264_11143985 3300028381 Unclassified 787
255 Ga0268264_11352695 3300028381 Bacteria 722
256 Ga0307515_10000001 3300028794 Bacteria 4259510
257 Ga0265327_10000906 3300031251 Bacteria 43527
258 Ga0307408_101535249 3300031548 Bacteria 631
259 Ga0307410_10828363 3300031852 Bacteria 789
260 Ga0307416_101508214 3300032002 Bacteria 778
261 Ga0307414_10204524 3300032004 Bacteria 1609
262 Ga0307414_10589533 3300032004 Bacteria 996
263 Ga0307415_100220637 3300032126 Bacteria 1520
264 Ga0307507_10345259 3300033179 Unclassified 879
265 Ga0373957_0433847 3300035120 Bacteria 568
266 Ga0395900_0045533 3300037418 Unclassified 4519
267 Ga0395905_0000527 3300037471 Bacteria 52435
268 Ga0395905_0127684 3300037471 Bacteria 2391
269 Ga0439439_0027945 3300041406 Bacteria 1427
270 Ga0439453_0139578 3300041408 Bacteria 568
271 Ga0451793_1365790 3300041452 Bacteria 836
272 Ga0451804_0685085 3300041463 Unclassified 735
273 Ga0451835_0610908 3300041492 Bacteria 1056
274 Ga0451837_0308600 3300041494 Unclassified 612
275 Ga0451841_0075618 3300041498 Bacteria 513
276 Ga0451853_1725440 3300041512 Bacteria 502
277 Ga0439431_0014969 3300041997 Bacteria 1802
278 Ga0439441_027666 3300042001 Bacteria 1083
279 Ga0439442_019238 3300042002 Bacteria 1413
280 Ga0439454_065522 3300042011 Bacteria 637
281 Ga0450898_025533 3300042134 Bacteria 1060
282 Ga0439434_0170207 3300042435 Bacteria 726
283 Ga0439435_0049992 3300042436 Bacteria 1194
284 Ga0453683_0664787 3300044673 Bacteria 681
285 Ga0453684_0092803 3300044712 Bacteria 3720
286 Ga0453684_0147846 3300044712 Bacteria 2796
287 Ga0453684_0258773 3300044712 Bacteria 1995
288 Ga0453684_1237266 3300044712 Bacteria 782
289 Ga0453684_1847344 3300044712 Bacteria 613
290 Ga0495594_0176498 3300046499 Bacteria 1216
291 Ga0495643_0129766 3300046522 Bacteria 1266
292 Ga0495644_0466099 3300046523 Bacteria 504
293 Ga0495598_0128848 3300046537 Bacteria 865
294 Ga0495621_0091681 3300046539 Unclassified 1146
295 Ga0495668_0000863 3300046616 Bacteria 34191
296 Ga0495670_0292630 3300046691 Bacteria 872
297 Ga0495670_0526529 3300046691 Unclassified 643
298 Ga0495600_0417188 3300046809 Bacteria 833
299 Ga0495672_0069425 3300047320 Unclassified 2000
300 Ga0495676_0996909 3300047321 Bacteria 535
301 Ga0495686_0021166 3300047472 Bacteria 4325
302 Ga0495686_0028441 3300047472 Bacteria 3641
303 Ga0501032_0017004 3300049569 Bacteria 5110
304 Ga0501034_0062889 3300049571 Bacteria 3726
305 Ga0501036_0006877 3300049572 Bacteria 9244
306 Ga0501037_0059366 3300049573 Bacteria 2791
307 Ga0501038_0054670 3300049574 Bacteria 3433
308 Ga0501039_0041440 3300049575 Bacteria 3557
309 Ga0501043_0009419 3300049579 Bacteria 7667
310 Ga0501046_0374348 3300049580 Unclassified 1031
311 Ga0501047_0073517 3300049581 Bacteria 3291
312 Ga0501048_0042214 3300049582 Bacteria 3266
313 Ga0501070_0039093 3300049586 Bacteria 3958
314 Ga0501072_0809356 3300049588 Bacteria 734
315 Ga0501074_0010801 3300049590 Bacteria 6631
316 Ga0501079_0135959 3300049741 Bacteria 1914
317 Ga0501083_0014203 3300049744 Bacteria 5570
318 Ga0501035_0102294 3300049822 Unclassified 2513
319 Ga0501044_0181951 3300049823 Unclassified 2068
320 nmdc:mga0k408_488862_c1 3300050493 Unclassified 730
321 nmdc:mga05p37_359854_c1 3300050507 Bacteria 1711
322 nmdc:mga05p37_568354_c1 3300050507 Bacteria 1287
323 nmdc:mga05p37_782713_c1 3300050507 Bacteria 1046
324 nmdc:mga09592_81361_c1 3300050508 Bacteria 2760
325 nmdc:mga09592_823_c1 3300050508 Bacteria 24005
326 nmdc:mga0qj67_257108_c1 3300050509 Bacteria 1417
327 nmdc:mga0qj67_43430_c1 3300050509 Bacteria 3540
328 nmdc:mga06r32_289786_c1 3300050510 Bacteria 1624
329 nmdc:mga06r32_316572_c1 3300050510 Unclassified 1546
330 nmdc:mga08y16_1015400_c1 3300050511 Unclassified 809
331 nmdc:mga08y16_116351_c1 3300050511 Bacteria 2783
332 nmdc:mga08y16_1749003_c1 3300050511 Bacteria 576
333 Ga0500646_0115726 3300053090 Unclassified 857
334 Ga0500568_0070675 3300053139 Bacteria 1337
335 Ga0501084_0138728 3300054114 Bacteria 2047
336 Ga0501082_0286227 3300060353 Bacteria 1435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10388427 Ga0065704_103884271 103
2 3300042001 Ga0439441_027666 Ga0439441_027666_26_361 103
3 3300025944 Ga0207661_11472060 Ga0207661_114720602 104
4 3300025986 Ga0207658_11954433 Ga0207658_119544331 104
5 iso_pu_bacteria 2839989709 2839990244 105
6 iso_pu_bacteria 2977232053 2977236866 106
7 3300005331 Ga0070670_101829273 Ga0070670_1018292731 107
8 3300025272 Ga0209455_1019102 Ga0209455_10191023 107
9 3300031548 Ga0307408_101535249 Ga0307408_1015352491 107
10 3300032004 Ga0307414_10589533 Ga0307414_105895332 107
11 3300002741 JGI25157J39369_1014248 JGI25157J39369_10142482 108
12 3300005331 Ga0070670_100489105 Ga0070670_1004891052 109
13 3300025925 Ga0207650_10595219 Ga0207650_105952192 109
14 3300005334 Ga0068869_100846781 Ga0068869_1008467812 110
15 3300005343 Ga0070687_101342622 Ga0070687_1013426221 110
16 3300005347 Ga0070668_100608273 Ga0070668_1006082732 110
17 3300005617 Ga0068859_100097843 Ga0068859_1000978434 110
18 3300005843 Ga0068860_100698687 Ga0068860_1006986871 110
19 3300006237 Ga0097621_100324629 Ga0097621_1003246292 110
20 3300006931 Ga0097620_100097845 Ga0097620_1000978452 110
21 3300009176 Ga0105242_10016179 Ga0105242_100161792 110
22 3300009553 Ga0105249_11381858 Ga0105249_113818582 110
23 3300013297 Ga0157378_10425351 Ga0157378_104253512 110
24 3300013306 Ga0163162_11360414 Ga0163162_113604142 110
25 3300025907 Ga0207645_10131578 Ga0207645_101315783 110
26 3300025934 Ga0207686_10147419 Ga0207686_101474192 110
27 3300025942 Ga0207689_10032640 Ga0207689_100326405 110
28 3300025961 Ga0207712_11114452 Ga0207712_111144521 110
29 3300026089 Ga0207648_10034852 Ga0207648_100348524 110
30 3300028381 Ga0268264_11352695 Ga0268264_113526951 110
31 3300002459 JGI24751J29686_10004241 JGI24751J29686_100042415 111
32 3300005288 Ga0065714_10303813 Ga0065714_103038131 111
33 3300005290 Ga0065712_10084512 Ga0065712_100845124 111
34 3300005293 Ga0065715_10039073 Ga0065715_100390731 111
35 3300005293 Ga0065715_10468693 Ga0065715_104686931 111
36 3300005329 Ga0070683_100670415 Ga0070683_1006704151 111
37 3300005330 Ga0070690_100686952 Ga0070690_1006869521 111
38 3300005331 Ga0070670_100037560 Ga0070670_1000375602 111
39 3300005331 Ga0070670_101258709 Ga0070670_1012587091 111
40 3300005331 Ga0070670_101783565 Ga0070670_1017835652 111
41 3300005334 Ga0068869_100013446 Ga0068869_1000134462 111
42 3300005334 Ga0068869_101132704 Ga0068869_1011327041 111
43 3300005335 Ga0070666_10494516 Ga0070666_104945161 111
44 3300005338 Ga0068868_100152036 Ga0068868_1001520362 111
45 3300005340 Ga0070689_100044909 Ga0070689_1000449092 111
46 3300005340 Ga0070689_100153792 Ga0070689_1001537922 111
47 3300005343 Ga0070687_100280320 Ga0070687_1002803202 111
48 3300005344 Ga0070661_101776071 Ga0070661_1017760711 111
49 3300005347 Ga0070668_100169244 Ga0070668_1001692443 111
50 3300005347 Ga0070668_100412062 Ga0070668_1004120621 111
51 3300005353 Ga0070669_100046507 Ga0070669_1000465075 111
52 3300005353 Ga0070669_100469571 Ga0070669_1004695711 111
53 3300005353 Ga0070669_101339046 Ga0070669_1013390461 111
54 3300005354 Ga0070675_101400897 Ga0070675_1014008972 111
55 3300005354 Ga0070675_101452117 Ga0070675_1014521171 111
56 3300005355 Ga0070671_101244359 Ga0070671_1012443592 111
57 3300005356 Ga0070674_100856747 Ga0070674_1008567472 111
58 3300005364 Ga0070673_100078786 Ga0070673_1000787864 111
59 3300005364 Ga0070673_100552612 Ga0070673_1005526122 111
60 3300005365 Ga0070688_100049396 Ga0070688_1000493962 111
61 3300005367 Ga0070667_101976847 Ga0070667_1019768471 111
62 3300005441 Ga0070700_100128366 Ga0070700_1001283661 111
63 3300005444 Ga0070694_101697218 Ga0070694_1016972181 111
64 3300005456 Ga0070678_100593199 Ga0070678_1005931993 111
65 3300005456 Ga0070678_101538095 Ga0070678_1015380951 111
66 3300005459 Ga0068867_100434284 Ga0068867_1004342843 111
67 3300005459 Ga0068867_100843090 Ga0068867_1008430902 111
68 3300005459 Ga0068867_100849793 Ga0068867_1008497931 111
69 3300005459 Ga0068867_101039610 Ga0068867_1010396101 111
70 3300005459 Ga0068867_101522298 Ga0068867_1015222982 111
71 3300005466 Ga0070685_10137649 Ga0070685_101376492 111
72 3300005466 Ga0070685_10282194 Ga0070685_102821942 111
73 3300005466 Ga0070685_10330224 Ga0070685_103302242 111
74 3300005467 Ga0070706_101531506 Ga0070706_1015315061 111
75 3300005471 Ga0070698_100001455 Ga0070698_10000145523 111
76 3300005471 Ga0070698_100002086 Ga0070698_10000208628 111
77 3300005539 Ga0068853_100008858 Ga0068853_1000088582 111
78 3300005539 Ga0068853_100700424 Ga0068853_1007004242 111
79 3300005543 Ga0070672_100150532 Ga0070672_1001505321 111
80 3300005543 Ga0070672_100330906 Ga0070672_1003309061 111
81 3300005543 Ga0070672_101314866 Ga0070672_1013148662 111
82 3300005544 Ga0070686_100346008 Ga0070686_1003460083 111
83 3300005545 Ga0070695_100885563 Ga0070695_1008855631 111
84 3300005547 Ga0070693_100297682 Ga0070693_1002976822 111
85 3300005564 Ga0070664_101810890 Ga0070664_1018108902 111
86 3300005564 Ga0070664_102203168 Ga0070664_1022031681 111
87 3300005577 Ga0068857_100045001 Ga0068857_1000450015 111
88 3300005615 Ga0070702_100958872 Ga0070702_1009588721 111
89 3300005616 Ga0068852_100406273 Ga0068852_1004062732 111
90 3300005617 Ga0068859_100172006 Ga0068859_1001720064 111
91 3300005617 Ga0068859_100323343 Ga0068859_1003233433 111
92 3300005617 Ga0068859_100383627 Ga0068859_1003836271 111
93 3300005618 Ga0068864_100135085 Ga0068864_1001350852 111
94 3300005618 Ga0068864_100216431 Ga0068864_1002164312 111
95 3300005618 Ga0068864_100385192 Ga0068864_1003851922 111
96 3300005618 Ga0068864_101497575 Ga0068864_1014975752 111
97 3300005618 Ga0068864_102458130 Ga0068864_1024581301 111
98 3300005719 Ga0068861_100062234 Ga0068861_1000622342 111
99 3300005719 Ga0068861_100143337 Ga0068861_1001433373 111
100 3300005719 Ga0068861_100838284 Ga0068861_1008382842 111
101 3300005834 Ga0068851_10047674 Ga0068851_100476743 111
102 3300005840 Ga0068870_10011641 Ga0068870_100116413 111
103 3300005840 Ga0068870_10897803 Ga0068870_108978032 111
104 3300005841 Ga0068863_100258983 Ga0068863_1002589832 111
105 3300005841 Ga0068863_100262375 Ga0068863_1002623753 111
106 3300005841 Ga0068863_101136145 Ga0068863_1011361451 111
107 3300005841 Ga0068863_101385571 Ga0068863_1013855712 111
108 3300005841 Ga0068863_102318613 Ga0068863_1023186131 111
109 3300005842 Ga0068858_100116672 Ga0068858_1001166723 111
110 3300005843 Ga0068860_100206522 Ga0068860_1002065224 111
111 3300005843 Ga0068860_100610493 Ga0068860_1006104932 111
112 3300005844 Ga0068862_101132194 Ga0068862_1011321942 111
113 3300006195 Ga0075366_10567027 Ga0075366_105670272 111
114 3300006358 Ga0068871_100171713 Ga0068871_1001717133 111
115 3300006358 Ga0068871_100280120 Ga0068871_1002801202 111
116 3300006844 Ga0075428_100001878 Ga0075428_1000018788 111
117 3300006844 Ga0075428_100061237 Ga0075428_1000612374 111
118 3300006846 Ga0075430_100095144 Ga0075430_1000951443 111
119 3300006847 Ga0075431_100307378 Ga0075431_1003073782 111
120 3300006880 Ga0075429_100001931 Ga0075429_10000193111 111
121 3300006880 Ga0075429_100052501 Ga0075429_1000525016 111
122 3300006881 Ga0068865_101577525 Ga0068865_1015775252 111
123 3300006881 Ga0068865_101747389 Ga0068865_1017473891 111
124 3300006931 Ga0097620_100172008 Ga0097620_1001720084 111
125 3300006931 Ga0097620_100323345 Ga0097620_1003233453 111
126 3300006931 Ga0097620_100383630 Ga0097620_1003836303 111
127 3300009094 Ga0111539_10167394 Ga0111539_101673943 111
128 3300009094 Ga0111539_10579674 Ga0111539_105796741 111
129 3300009094 Ga0111539_10930513 Ga0111539_109305132 111
130 3300009098 Ga0105245_10418825 Ga0105245_104188253 111
131 3300009101 Ga0105247_10009905 Ga0105247_100099057 111
132 3300009101 Ga0105247_10941546 Ga0105247_109415462 111
133 3300009147 Ga0114129_10062503 Ga0114129_100625032 111
134 3300009147 Ga0114129_10263410 Ga0114129_102634102 111
135 3300009148 Ga0105243_10440189 Ga0105243_104401892 111
136 3300009176 Ga0105242_10008224 Ga0105242_100082244 111
137 3300009176 Ga0105242_10014405 Ga0105242_100144057 111
138 3300009176 Ga0105242_11232207 Ga0105242_112322071 111
139 3300009177 Ga0105248_10164302 Ga0105248_101643025 111
140 3300009553 Ga0105249_10000611 Ga0105249_1000061133 111
141 3300009553 Ga0105249_10001393 Ga0105249_1000139312 111
142 3300009553 Ga0105249_10031748 Ga0105249_100317486 111
143 3300009553 Ga0105249_10075099 Ga0105249_100750992 111
144 3300009553 Ga0105249_10100046 Ga0105249_101000465 111
145 3300009553 Ga0105249_10397091 Ga0105249_103970912 111
146 3300009553 Ga0105249_10756917 Ga0105249_107569172 111
147 3300009553 Ga0105249_10944751 Ga0105249_109447511 111
148 3300011119 Ga0105246_10408702 Ga0105246_104087021 111
149 3300013100 Ga0157373_10666629 Ga0157373_106666292 111
150 3300013102 Ga0157371_10039559 Ga0157371_100395591 111
151 3300013102 Ga0157371_10314641 Ga0157371_103146412 111
152 3300013104 Ga0157370_10387087 Ga0157370_103870871 111
153 3300013105 Ga0157369_10126651 Ga0157369_101266513 111
154 3300013105 Ga0157369_11424192 Ga0157369_114241921 111
155 3300013105 Ga0157369_12392917 Ga0157369_123929171 111
156 3300013296 Ga0157374_12380073 Ga0157374_123800731 111
157 3300013297 Ga0157378_12234622 Ga0157378_122346222 111
158 3300013297 Ga0157378_12650583 Ga0157378_126505831 111
159 3300013297 Ga0157378_12822782 Ga0157378_128227822 111
160 3300013306 Ga0163162_12109917 Ga0163162_121099171 111
161 3300013306 Ga0163162_12469828 Ga0163162_124698281 111
162 3300013307 Ga0157372_10233696 Ga0157372_102336964 111
163 3300013307 Ga0157372_10538220 Ga0157372_105382203 111
164 3300013307 Ga0157372_11701141 Ga0157372_117011412 111
165 3300013308 Ga0157375_10390972 Ga0157375_103909722 111
166 3300013308 Ga0157375_10964309 Ga0157375_109643092 111
167 3300013308 Ga0157375_11988280 Ga0157375_119882801 111
168 3300013308 Ga0157375_12370902 Ga0157375_123709022 111
169 3300014325 Ga0163163_10244122 Ga0163163_102441221 111
170 3300014325 Ga0163163_10250732 Ga0163163_102507323 111
171 3300014325 Ga0163163_10639108 Ga0163163_106391081 111
172 3300014325 Ga0163163_11860881 Ga0163163_118608811 111
173 3300014325 Ga0163163_12423628 Ga0163163_124236281 111
174 3300014325 Ga0163163_13349801 Ga0163163_133498011 111
175 3300014326 Ga0157380_10026841 Ga0157380_100268411 111
176 3300014326 Ga0157380_10513970 Ga0157380_105139702 111
177 3300014326 Ga0157380_10727187 Ga0157380_107271872 111
178 3300014326 Ga0157380_10826314 Ga0157380_108263141 111
179 3300014326 Ga0157380_11937091 Ga0157380_119370912 111
180 3300014326 Ga0157380_13120171 Ga0157380_131201711 111
181 3300014745 Ga0157377_11326385 Ga0157377_113263851 111
182 3300014745 Ga0157377_11669254 Ga0157377_116692542 111
183 3300014745 Ga0157377_11756348 Ga0157377_117563481 111
184 3300014968 Ga0157379_10295644 Ga0157379_102956442 111
185 3300014969 Ga0157376_10684397 Ga0157376_106843972 111
186 3300017792 Ga0163161_10199530 Ga0163161_101995302 111
187 3300017792 Ga0163161_10235991 Ga0163161_102359912 111
188 3300017792 Ga0163161_10834315 Ga0163161_108343151 111
189 3300025271 Ga0207666_1040998 Ga0207666_10409982 111
190 3300025315 Ga0207697_10030666 Ga0207697_100306663 111
191 3300025893 Ga0207682_10040074 Ga0207682_100400742 111
192 3300025900 Ga0207710_10009414 Ga0207710_100094142 111
193 3300025903 Ga0207680_10610229 Ga0207680_106102292 111
194 3300025905 Ga0207685_10041275 Ga0207685_100412753 111
195 3300025907 Ga0207645_10212616 Ga0207645_102126162 111
196 3300025907 Ga0207645_10500300 Ga0207645_105003002 111
197 3300025908 Ga0207643_10003695 Ga0207643_100036953 111
198 3300025909 Ga0207705_10382712 Ga0207705_103827121 111
199 3300025910 Ga0207684_11435056 Ga0207684_114350561 111
200 3300025918 Ga0207662_10309557 Ga0207662_103095572 111
201 3300025925 Ga0207650_10006365 Ga0207650_1000636510 111
202 3300025925 Ga0207650_10062814 Ga0207650_100628142 111
203 3300025925 Ga0207650_10583032 Ga0207650_105830322 111
204 3300025925 Ga0207650_10954049 Ga0207650_109540491 111
205 3300025926 Ga0207659_11384262 Ga0207659_113842621 111
206 3300025934 Ga0207686_10002249 Ga0207686_100022497 111
207 3300025934 Ga0207686_10053869 Ga0207686_100538694 111
208 3300025935 Ga0207709_10146280 Ga0207709_101462803 111
209 3300025936 Ga0207670_10081086 Ga0207670_100810861 111
210 3300025937 Ga0207669_10259144 Ga0207669_102591442 111
211 3300025938 Ga0207704_10018696 Ga0207704_100186965 111
212 3300025940 Ga0207691_10116141 Ga0207691_101161412 111
213 3300025940 Ga0207691_10421549 Ga0207691_104215492 111
214 3300025942 Ga0207689_10063754 Ga0207689_100637541 111
215 3300025942 Ga0207689_11158559 Ga0207689_111585592 111
216 3300025944 Ga0207661_11674333 Ga0207661_116743332 111
217 3300025945 Ga0207679_11310999 Ga0207679_113109991 111
218 3300025960 Ga0207651_10154937 Ga0207651_101549371 111
219 3300025961 Ga0207712_10003748 Ga0207712_100037483 111
220 3300025961 Ga0207712_10003945 Ga0207712_100039454 111
221 3300025961 Ga0207712_10247327 Ga0207712_102473271 111
222 3300025961 Ga0207712_10562743 Ga0207712_105627432 111
223 3300025961 Ga0207712_10739269 Ga0207712_107392692 111
224 3300025961 Ga0207712_11515870 Ga0207712_115158701 111
225 3300025961 Ga0207712_11914947 Ga0207712_119149471 111
226 3300025972 Ga0207668_10222044 Ga0207668_102220443 111
227 3300025981 Ga0207640_10847197 Ga0207640_108471971 111
228 3300025986 Ga0207658_10905451 Ga0207658_109054511 111
229 3300025986 Ga0207658_11144237 Ga0207658_111442371 111
230 3300025986 Ga0207658_11708259 Ga0207658_117082592 111
231 3300026023 Ga0207677_10425680 Ga0207677_104256802 111
232 3300026023 Ga0207677_10632819 Ga0207677_106328192 111
233 3300026035 Ga0207703_10174992 Ga0207703_101749923 111
234 3300026041 Ga0207639_10419971 Ga0207639_104199712 111
235 3300026075 Ga0207708_10036076 Ga0207708_100360763 111
236 3300026075 Ga0207708_11064616 Ga0207708_110646162 111
237 3300026088 Ga0207641_10000873 Ga0207641_1000087327 111
238 3300026088 Ga0207641_10055829 Ga0207641_100558293 111
239 3300026088 Ga0207641_10240867 Ga0207641_102408672 111
240 3300026088 Ga0207641_10766910 Ga0207641_107669102 111
241 3300026088 Ga0207641_11566667 Ga0207641_115666672 111
242 3300026088 Ga0207641_11587473 Ga0207641_115874731 111
243 3300026089 Ga0207648_10058604 Ga0207648_100586041 111
244 3300026089 Ga0207648_10094820 Ga0207648_100948202 111
245 3300026089 Ga0207648_10513027 Ga0207648_105130272 111
246 3300026089 Ga0207648_11961674 Ga0207648_119616741 111
247 3300026095 Ga0207676_10014462 Ga0207676_100144625 111
248 3300026095 Ga0207676_10426119 Ga0207676_104261193 111
249 3300026116 Ga0207674_10150353 Ga0207674_101503533 111
250 3300026118 Ga0207675_100017141 Ga0207675_1000171416 111
251 3300026118 Ga0207675_100097037 Ga0207675_1000970374 111
252 3300026118 Ga0207675_100800013 Ga0207675_1008000132 111
253 3300026118 Ga0207675_102746717 Ga0207675_1027467171 111
254 3300026121 Ga0207683_10098563 Ga0207683_100985633 111
255 3300026142 Ga0207698_10466460 Ga0207698_104664602 111
256 3300027907 Ga0207428_10085039 Ga0207428_100850393 111
257 3300028380 Ga0268265_10485013 Ga0268265_104850132 111
258 3300028380 Ga0268265_10845262 Ga0268265_108452622 111
259 3300028381 Ga0268264_10533310 Ga0268264_105333102 111
260 3300028381 Ga0268264_11143985 Ga0268264_111439852 111
261 3300028794 Ga0307515_10000001 Ga0307515_10000001374 111
262 3300031251 Ga0265327_10000906 Ga0265327_1000090620 111
263 3300031852 Ga0307410_10828363 Ga0307410_108283632 111
264 3300032002 Ga0307416_101508214 Ga0307416_1015082141 111
265 3300032004 Ga0307414_10204524 Ga0307414_102045243 111
266 3300032126 Ga0307415_100220637 Ga0307415_1002206373 111
267 3300033179 Ga0307507_10345259 Ga0307507_103452591 111
268 3300035120 Ga0373957_0433847 Ga0373957_0433847_189_524 111
269 3300037418 Ga0395900_0045533 Ga0395900_0045533_2248_2583 111
270 3300037471 Ga0395905_0000527 Ga0395905_0000527_665_1000 111
271 3300037471 Ga0395905_0127684 Ga0395905_0127684_142_477 111
272 3300041406 Ga0439439_0027945 Ga0439439_0027945_232_567 111
273 3300041408 Ga0439453_0139578 Ga0439453_0139578_19_354 111
274 3300041452 Ga0451793_1365790 Ga0451793_1365790_68_403 111
275 3300041463 Ga0451804_0685085 Ga0451804_0685085_343_678 111
276 3300041492 Ga0451835_0610908 Ga0451835_0610908_426_779 111
277 3300041494 Ga0451837_0308600 Ga0451837_0308600_142_477 111
278 3300041498 Ga0451841_0075618 Ga0451841_0075618_27_362 111
279 3300041512 Ga0451853_1725440 Ga0451853_1725440_103_438 111
280 3300041997 Ga0439431_0014969 Ga0439431_0014969_710_1045 111
281 3300042002 Ga0439442_019238 Ga0439442_019238_329_664 111
282 3300042011 Ga0439454_065522 Ga0439454_065522_219_554 111
283 3300042134 Ga0450898_025533 Ga0450898_025533_643_978 111
284 3300042435 Ga0439434_0170207 Ga0439434_0170207_182_517 111
285 3300042436 Ga0439435_0049992 Ga0439435_0049992_163_498 111
286 3300044673 Ga0453683_0664787 Ga0453683_0664787_129_464 111
287 3300044712 Ga0453684_0092803 Ga0453684_0092803_3267_3707 111
288 3300044712 Ga0453684_0147846 Ga0453684_0147846_34_369 111
289 3300044712 Ga0453684_0258773 Ga0453684_0258773_658_993 111
290 3300044712 Ga0453684_1237266 Ga0453684_1237266_124_465 111
291 3300044712 Ga0453684_1847344 Ga0453684_1847344_213_557 111
292 3300046499 Ga0495594_0176498 Ga0495594_0176498_526_861 111
293 3300046522 Ga0495643_0129766 Ga0495643_0129766_733_1068 111
294 3300046523 Ga0495644_0466099 Ga0495644_0466099_112_447 111
295 3300046537 Ga0495598_0128848 Ga0495598_0128848_139_474 111
296 3300046539 Ga0495621_0091681 Ga0495621_0091681_593_928 111
297 3300046616 Ga0495668_0000863 Ga0495668_0000863_5568_5903 111
298 3300046691 Ga0495670_0292630 Ga0495670_0292630_126_461 111
299 3300046691 Ga0495670_0526529 Ga0495670_0526529_255_590 111
300 3300046809 Ga0495600_0417188 Ga0495600_0417188_245_580 111
301 3300047320 Ga0495672_0069425 Ga0495672_0069425_518_853 111
302 3300047321 Ga0495676_0996909 Ga0495676_0996909_95_430 111
303 3300047472 Ga0495686_0021166 Ga0495686_0021166_173_508 111
304 3300047472 Ga0495686_0028441 Ga0495686_0028441_1771_2106 111
305 3300049569 Ga0501032_0017004 Ga0501032_0017004_2873_3208 111
306 3300049571 Ga0501034_0062889 Ga0501034_0062889_131_466 111
307 3300049572 Ga0501036_0006877 Ga0501036_0006877_5359_5694 111
308 3300049573 Ga0501037_0059366 Ga0501037_0059366_815_1150 111
309 3300049574 Ga0501038_0054670 Ga0501038_0054670_2646_2981 111
310 3300049575 Ga0501039_0041440 Ga0501039_0041440_2500_2835 111
311 3300049579 Ga0501043_0009419 Ga0501043_0009419_1835_2170 111
312 3300049580 Ga0501046_0374348 Ga0501046_0374348_140_475 111
313 3300049581 Ga0501047_0073517 Ga0501047_0073517_462_797 111
314 3300049582 Ga0501048_0042214 Ga0501048_0042214_308_643 111
315 3300049586 Ga0501070_0039093 Ga0501070_0039093_160_495 111
316 3300049588 Ga0501072_0809356 Ga0501072_0809356_14_349 111
317 3300049590 Ga0501074_0010801 Ga0501074_0010801_2682_3017 111
318 3300049741 Ga0501079_0135959 Ga0501079_0135959_433_768 111
319 3300049744 Ga0501083_0014203 Ga0501083_0014203_2889_3224 111
320 3300049822 Ga0501035_0102294 Ga0501035_0102294_1481_1816 111
321 3300049823 Ga0501044_0181951 Ga0501044_0181951_95_430 111
322 3300050493 nmdc:mga0k408_488862_c1 nmdc:mga0k408_488862_c1_250_585 111
323 3300050507 nmdc:mga05p37_359854_c1 nmdc:mga05p37_359854_c1_165_500 111
324 3300050507 nmdc:mga05p37_568354_c1 nmdc:mga05p37_568354_c1_338_673 111
325 3300050507 nmdc:mga05p37_782713_c1 nmdc:mga05p37_782713_c1_79_414 111
326 3300050508 nmdc:mga09592_81361_c1 nmdc:mga09592_81361_c1_1624_1959 111
327 3300050508 nmdc:mga09592_823_c1 nmdc:mga09592_823_c1_17768_18103 111
328 3300050509 nmdc:mga0qj67_257108_c1 nmdc:mga0qj67_257108_c1_386_721 111
329 3300050509 nmdc:mga0qj67_43430_c1 nmdc:mga0qj67_43430_c1_2327_2662 111
330 3300050510 nmdc:mga06r32_289786_c1 nmdc:mga06r32_289786_c1_903_1238 111
331 3300050510 nmdc:mga06r32_316572_c1 nmdc:mga06r32_316572_c1_521_856 111
332 3300050511 nmdc:mga08y16_1015400_c1 nmdc:mga08y16_1015400_c1_161_496 111
333 3300050511 nmdc:mga08y16_116351_c1 nmdc:mga08y16_116351_c1_1395_1730 111
334 3300050511 nmdc:mga08y16_1749003_c1 nmdc:mga08y16_1749003_c1_83_418 111
335 3300053090 Ga0500646_0115726 Ga0500646_0115726_401_739 111
336 3300053139 Ga0500568_0070675 Ga0500568_0070675_217_552 111
337 3300054114 Ga0501084_0138728 Ga0501084_0138728_861_1196 111
338 3300060353 Ga0501082_0286227 Ga0501082_0286227_307_642 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

24

108

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.8825 3 103
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.8662 1 111
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.8516 1 111
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.8383 3 105
1l5p-assembly3.cif.gz_C crystal structure of trichomonas vaginalis ferredoxin 0.83 3 102
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8806 3 103 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8383 3 105 3.10.20.30
1l5pC00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.83 3 102 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8202 3 102 3.10.20.30
2wlbB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8187 3 103 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A838TPU9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9627 1 111 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A520BWA8-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9593 3 92 GO:0009055
GO:0051537
GO:0140647
AF-A0A3M1YKU4-F1-model_v4 Ferredoxin 0.9547 1 111 GO:0009055
GO:0051537
GO:0140647
AF-A0A2G0CF15-F1-model_v4 Ferredoxin 0.9514 1 111 GO:0009055
GO:0051537
GO:0140647
AF-A0A4Q5RI28-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.949 2 106 GO:0009055
GO:0051537
GO:0140647

Feature Viewer

pLDDT pTM Quality
89.42 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map