F413372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 191 | 336 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100013446|Ga0068869_1000134462 |
| Length | 127 |
| Sequence | MPVFFLQLHLQPKRESMYKLKINFEEKGVAPVTFENLEPNQTLLEICLKNDIELHHNCGGVCACTTCHLYIDKGMDSIDEITDKEEDFIDRAVNPRLSSRLGCQSLLLDGDGEIEITLPDQTQFLGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 2 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 134 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 138 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 139 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 142 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 143 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 146 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 147 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 148 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 149 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 152 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0 |
| Rhizoplane | 0.59 |
| Rhizosphere | 95.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10004241 | 3300002459 | Bacteria | 2909 |
| 2 | JGI25157J39369_1014248 | 3300002741 | Bacteria | 990 |
| 3 | Ga0065714_10303813 | 3300005288 | Bacteria | 690 |
| 4 | Ga0065704_10388427 | 3300005289 | Unclassified | 765 |
| 5 | Ga0065712_10084512 | 3300005290 | Unclassified | 2758 |
| 6 | Ga0065715_10039073 | 3300005293 | Bacteria | 1100 |
| 7 | Ga0065715_10468693 | 3300005293 | Bacteria | 808 |
| 8 | Ga0070683_100670415 | 3300005329 | Bacteria | 993 |
| 9 | Ga0070690_100686952 | 3300005330 | Bacteria | 785 |
| 10 | Ga0070670_100037560 | 3300005331 | Bacteria | 4167 |
| 11 | Ga0070670_100489105 | 3300005331 | Bacteria | 1093 |
| 12 | Ga0070670_101258709 | 3300005331 | Bacteria | 677 |
| 13 | Ga0070670_101783565 | 3300005331 | Bacteria | 566 |
| 14 | Ga0070670_101829273 | 3300005331 | Bacteria | 559 |
| 15 | Ga0068869_100013446 | 3300005334 | Bacteria | 5445 |
| 16 | Ga0068869_100846781 | 3300005334 | Bacteria | 789 |
| 17 | Ga0068869_101132704 | 3300005334 | Bacteria | 685 |
| 18 | Ga0070666_10494516 | 3300005335 | Bacteria | 886 |
| 19 | Ga0068868_100152036 | 3300005338 | Bacteria | 1906 |
| 20 | Ga0070689_100044909 | 3300005340 | Bacteria | 3400 |
| 21 | Ga0070689_100153792 | 3300005340 | Bacteria | 1856 |
| 22 | Ga0070687_100280320 | 3300005343 | Unclassified | 1049 |
| 23 | Ga0070687_101342622 | 3300005343 | Unclassified | 532 |
| 24 | Ga0070661_101776071 | 3300005344 | Bacteria | 523 |
| 25 | Ga0070668_100169244 | 3300005347 | Bacteria | 1778 |
| 26 | Ga0070668_100412062 | 3300005347 | Bacteria | 1156 |
| 27 | Ga0070668_100608273 | 3300005347 | Unclassified | 957 |
| 28 | Ga0070669_100046507 | 3300005353 | Bacteria | 3165 |
| 29 | Ga0070669_100469571 | 3300005353 | Bacteria | 1039 |
| 30 | Ga0070669_101339046 | 3300005353 | Unclassified | 620 |
| 31 | Ga0070675_101400897 | 3300005354 | Bacteria | 644 |
| 32 | Ga0070675_101452117 | 3300005354 | Bacteria | 632 |
| 33 | Ga0070671_101244359 | 3300005355 | Bacteria | 656 |
| 34 | Ga0070674_100856747 | 3300005356 | Bacteria | 788 |
| 35 | Ga0070673_100078786 | 3300005364 | Bacteria | 2666 |
| 36 | Ga0070673_100552612 | 3300005364 | Bacteria | 1046 |
| 37 | Ga0070688_100049396 | 3300005365 | Bacteria | 2617 |
| 38 | Ga0070667_101976847 | 3300005367 | Bacteria | 549 |
| 39 | Ga0070700_100128366 | 3300005441 | Bacteria | 1708 |
| 40 | Ga0070694_101697218 | 3300005444 | Unclassified | 537 |
| 41 | Ga0070678_100593199 | 3300005456 | Bacteria | 988 |
| 42 | Ga0070678_101538095 | 3300005456 | Bacteria | 624 |
| 43 | Ga0068867_100434284 | 3300005459 | Bacteria | 1115 |
| 44 | Ga0068867_100843090 | 3300005459 | Bacteria | 821 |
| 45 | Ga0068867_100849793 | 3300005459 | Unclassified | 818 |
| 46 | Ga0068867_101039610 | 3300005459 | Bacteria | 745 |
| 47 | Ga0068867_101522298 | 3300005459 | Unclassified | 623 |
| 48 | Ga0070685_10137649 | 3300005466 | Bacteria | 1533 |
| 49 | Ga0070685_10282194 | 3300005466 | Bacteria | 1112 |
| 50 | Ga0070685_10330224 | 3300005466 | Bacteria | 1036 |
| 51 | Ga0070706_101531506 | 3300005467 | Bacteria | 609 |
| 52 | Ga0070698_100001455 | 3300005471 | Bacteria | 26296 |
| 53 | Ga0070698_100002086 | 3300005471 | Bacteria | 22201 |
| 54 | Ga0068853_100008858 | 3300005539 | Bacteria | 8097 |
| 55 | Ga0068853_100700424 | 3300005539 | Bacteria | 966 |
| 56 | Ga0070672_100150532 | 3300005543 | Bacteria | 1925 |
| 57 | Ga0070672_100330906 | 3300005543 | Unclassified | 1296 |
| 58 | Ga0070672_101314866 | 3300005543 | Unclassified | 646 |
| 59 | Ga0070686_100346008 | 3300005544 | Bacteria | 1115 |
| 60 | Ga0070695_100885563 | 3300005545 | Bacteria | 720 |
| 61 | Ga0070693_100297682 | 3300005547 | Bacteria | 1086 |
| 62 | Ga0070664_101810890 | 3300005564 | Unclassified | 579 |
| 63 | Ga0070664_102203168 | 3300005564 | Bacteria | 523 |
| 64 | Ga0068857_100045001 | 3300005577 | Bacteria | 3915 |
| 65 | Ga0070702_100958872 | 3300005615 | Bacteria | 674 |
| 66 | Ga0068852_100406273 | 3300005616 | Bacteria | 1340 |
| 67 | Ga0068859_100097843 | 3300005617 | Unclassified | 2988 |
| 68 | Ga0068859_100172006 | 3300005617 | Unclassified | 2247 |
| 69 | Ga0068859_100323343 | 3300005617 | Unclassified | 1636 |
| 70 | Ga0068859_100383627 | 3300005617 | Bacteria | 1501 |
| 71 | Ga0068864_100135085 | 3300005618 | Bacteria | 2220 |
| 72 | Ga0068864_100216431 | 3300005618 | Bacteria | 1766 |
| 73 | Ga0068864_100385192 | 3300005618 | Bacteria | 1329 |
| 74 | Ga0068864_101497575 | 3300005618 | Unclassified | 678 |
| 75 | Ga0068864_102458130 | 3300005618 | Bacteria | 527 |
| 76 | Ga0068861_100062234 | 3300005719 | Bacteria | 2866 |
| 77 | Ga0068861_100143337 | 3300005719 | Bacteria | 1952 |
| 78 | Ga0068861_100838284 | 3300005719 | Unclassified | 866 |
| 79 | Ga0068851_10047674 | 3300005834 | Bacteria | 2170 |
| 80 | Ga0068870_10011641 | 3300005840 | Unclassified | 4087 |
| 81 | Ga0068870_10897803 | 3300005840 | Bacteria | 626 |
| 82 | Ga0068863_100258983 | 3300005841 | Bacteria | 1681 |
| 83 | Ga0068863_100262375 | 3300005841 | Bacteria | 1670 |
| 84 | Ga0068863_101136145 | 3300005841 | Bacteria | 786 |
| 85 | Ga0068863_101385571 | 3300005841 | Archaea | 711 |
| 86 | Ga0068863_102318613 | 3300005841 | Bacteria | 546 |
| 87 | Ga0068858_100116672 | 3300005842 | Bacteria | 2495 |
| 88 | Ga0068860_100206522 | 3300005843 | Bacteria | 1905 |
| 89 | Ga0068860_100610493 | 3300005843 | Unclassified | 1097 |
| 90 | Ga0068860_100698687 | 3300005843 | Unclassified | 1024 |
| 91 | Ga0068862_101132194 | 3300005844 | Bacteria | 779 |
| 92 | Ga0075366_10567027 | 3300006195 | Unclassified | 703 |
| 93 | Ga0097621_100324629 | 3300006237 | Bacteria | 1364 |
| 94 | Ga0068871_100171713 | 3300006358 | Bacteria | 1859 |
| 95 | Ga0068871_100280120 | 3300006358 | Bacteria | 1458 |
| 96 | Ga0075428_100001878 | 3300006844 | Bacteria | 22540 |
| 97 | Ga0075428_100061237 | 3300006844 | Bacteria | 4121 |
| 98 | Ga0075430_100095144 | 3300006846 | Bacteria | 2490 |
| 99 | Ga0075431_100307378 | 3300006847 | Bacteria | 1601 |
| 100 | Ga0075429_100001931 | 3300006880 | Bacteria | 17186 |
| 101 | Ga0075429_100052501 | 3300006880 | Bacteria | 3547 |
| 102 | Ga0068865_101577525 | 3300006881 | Unclassified | 590 |
| 103 | Ga0068865_101747389 | 3300006881 | Bacteria | 561 |
| 104 | Ga0097620_100097845 | 3300006931 | Unclassified | 2988 |
| 105 | Ga0097620_100172008 | 3300006931 | Unclassified | 2247 |
| 106 | Ga0097620_100323345 | 3300006931 | Unclassified | 1636 |
| 107 | Ga0097620_100383630 | 3300006931 | Bacteria | 1501 |
| 108 | Ga0111539_10167394 | 3300009094 | Bacteria | 2569 |
| 109 | Ga0111539_10579674 | 3300009094 | Unclassified | 1307 |
| 110 | Ga0111539_10930513 | 3300009094 | Unclassified | 1011 |
| 111 | Ga0105245_10418825 | 3300009098 | Bacteria | 1342 |
| 112 | Ga0105247_10009905 | 3300009101 | Bacteria | 5774 |
| 113 | Ga0105247_10941546 | 3300009101 | Unclassified | 670 |
| 114 | Ga0114129_10062503 | 3300009147 | Bacteria | 5201 |
| 115 | Ga0114129_10263410 | 3300009147 | Unclassified | 2309 |
| 116 | Ga0105243_10440189 | 3300009148 | Unclassified | 1220 |
| 117 | Ga0105242_10008224 | 3300009176 | Bacteria | 8016 |
| 118 | Ga0105242_10014405 | 3300009176 | Bacteria | 6127 |
| 119 | Ga0105242_10016179 | 3300009176 | Bacteria | 5794 |
| 120 | Ga0105242_11232207 | 3300009176 | Bacteria | 769 |
| 121 | Ga0105248_10164302 | 3300009177 | Bacteria | 2503 |
| 122 | Ga0105249_10000611 | 3300009553 | Bacteria | 32583 |
| 123 | Ga0105249_10001393 | 3300009553 | Bacteria | 21161 |
| 124 | Ga0105249_10031748 | 3300009553 | Unclassified | 4778 |
| 125 | Ga0105249_10075099 | 3300009553 | Bacteria | 3130 |
| 126 | Ga0105249_10100046 | 3300009553 | Unclassified | 2726 |
| 127 | Ga0105249_10397091 | 3300009553 | Unclassified | 1408 |
| 128 | Ga0105249_10756917 | 3300009553 | Bacteria | 1034 |
| 129 | Ga0105249_10944751 | 3300009553 | Unclassified | 930 |
| 130 | Ga0105249_11381858 | 3300009553 | Bacteria | 776 |
| 131 | Ga0105246_10408702 | 3300011119 | Unclassified | 1129 |
| 132 | Ga0157373_10666629 | 3300013100 | Bacteria | 760 |
| 133 | Ga0157371_10039559 | 3300013102 | Bacteria | 3372 |
| 134 | Ga0157371_10314641 | 3300013102 | Unclassified | 1135 |
| 135 | Ga0157370_10387087 | 3300013104 | Bacteria | 1288 |
| 136 | Ga0157369_10126651 | 3300013105 | Unclassified | 2707 |
| 137 | Ga0157369_11424192 | 3300013105 | Unclassified | 705 |
| 138 | Ga0157369_12392917 | 3300013105 | Unclassified | 535 |
| 139 | Ga0157374_12380073 | 3300013296 | Unclassified | 557 |
| 140 | Ga0157378_10425351 | 3300013297 | Bacteria | 1313 |
| 141 | Ga0157378_12234622 | 3300013297 | Bacteria | 598 |
| 142 | Ga0157378_12650583 | 3300013297 | Unclassified | 554 |
| 143 | Ga0157378_12822782 | 3300013297 | Unclassified | 538 |
| 144 | Ga0163162_11360414 | 3300013306 | Bacteria | 807 |
| 145 | Ga0163162_12109917 | 3300013306 | Unclassified | 646 |
| 146 | Ga0163162_12469828 | 3300013306 | Unclassified | 597 |
| 147 | Ga0157372_10233696 | 3300013307 | Bacteria | 2132 |
| 148 | Ga0157372_10538220 | 3300013307 | Bacteria | 1362 |
| 149 | Ga0157372_11701141 | 3300013307 | Bacteria | 726 |
| 150 | Ga0157375_10390972 | 3300013308 | Bacteria | 1557 |
| 151 | Ga0157375_10964309 | 3300013308 | Bacteria | 994 |
| 152 | Ga0157375_11988280 | 3300013308 | Bacteria | 691 |
| 153 | Ga0157375_12370902 | 3300013308 | Unclassified | 633 |
| 154 | Ga0163163_10244122 | 3300014325 | Unclassified | 1846 |
| 155 | Ga0163163_10250732 | 3300014325 | Unclassified | 1821 |
| 156 | Ga0163163_10639108 | 3300014325 | Bacteria | 1128 |
| 157 | Ga0163163_11860881 | 3300014325 | Bacteria | 662 |
| 158 | Ga0163163_12423628 | 3300014325 | Bacteria | 583 |
| 159 | Ga0163163_13349801 | 3300014325 | Bacteria | 500 |
| 160 | Ga0157380_10026841 | 3300014326 | Bacteria | 4375 |
| 161 | Ga0157380_10513970 | 3300014326 | Bacteria | 1166 |
| 162 | Ga0157380_10727187 | 3300014326 | Bacteria | 1001 |
| 163 | Ga0157380_10826314 | 3300014326 | Bacteria | 946 |
| 164 | Ga0157380_11937091 | 3300014326 | Bacteria | 650 |
| 165 | Ga0157380_13120171 | 3300014326 | Bacteria | 529 |
| 166 | Ga0157377_11326385 | 3300014745 | Bacteria | 564 |
| 167 | Ga0157377_11669254 | 3300014745 | Unclassified | 513 |
| 168 | Ga0157377_11756348 | 3300014745 | Bacteria | 502 |
| 169 | Ga0157379_10295644 | 3300014968 | Bacteria | 1475 |
| 170 | Ga0157376_10684397 | 3300014969 | Unclassified | 1029 |
| 171 | Ga0163161_10199530 | 3300017792 | Bacteria | 1541 |
| 172 | Ga0163161_10235991 | 3300017792 | Unclassified | 1421 |
| 173 | Ga0163161_10834315 | 3300017792 | Bacteria | 777 |
| 174 | Ga0207666_1040998 | 3300025271 | Bacteria | 724 |
| 175 | Ga0209455_1019102 | 3300025272 | Bacteria | 1392 |
| 176 | Ga0207697_10030666 | 3300025315 | Bacteria | 2200 |
| 177 | Ga0207682_10040074 | 3300025893 | Bacteria | 1907 |
| 178 | Ga0207710_10009414 | 3300025900 | Bacteria | 4111 |
| 179 | Ga0207680_10610229 | 3300025903 | Bacteria | 780 |
| 180 | Ga0207685_10041275 | 3300025905 | Unclassified | 1725 |
| 181 | Ga0207645_10131578 | 3300025907 | Bacteria | 1628 |
| 182 | Ga0207645_10212616 | 3300025907 | Bacteria | 1274 |
| 183 | Ga0207645_10500300 | 3300025907 | Bacteria | 823 |
| 184 | Ga0207643_10003695 | 3300025908 | Bacteria | 8233 |
| 185 | Ga0207705_10382712 | 3300025909 | Unclassified | 1087 |
| 186 | Ga0207684_11435056 | 3300025910 | Bacteria | 564 |
| 187 | Ga0207662_10309557 | 3300025918 | Bacteria | 1052 |
| 188 | Ga0207650_10006365 | 3300025925 | Bacteria | 8040 |
| 189 | Ga0207650_10062814 | 3300025925 | Bacteria | 2775 |
| 190 | Ga0207650_10583032 | 3300025925 | Bacteria | 939 |
| 191 | Ga0207650_10595219 | 3300025925 | Unclassified | 930 |
| 192 | Ga0207650_10954049 | 3300025925 | Bacteria | 729 |
| 193 | Ga0207659_11384262 | 3300025926 | Unclassified | 603 |
| 194 | Ga0207686_10002249 | 3300025934 | Bacteria | 10600 |
| 195 | Ga0207686_10053869 | 3300025934 | Bacteria | 2517 |
| 196 | Ga0207686_10147419 | 3300025934 | Bacteria | 1634 |
| 197 | Ga0207709_10146280 | 3300025935 | Unclassified | 1631 |
| 198 | Ga0207670_10081086 | 3300025936 | Bacteria | 2270 |
| 199 | Ga0207669_10259144 | 3300025937 | Bacteria | 1300 |
| 200 | Ga0207704_10018696 | 3300025938 | Bacteria | 3624 |
| 201 | Ga0207691_10116141 | 3300025940 | Bacteria | 2375 |
| 202 | Ga0207691_10421549 | 3300025940 | Unclassified | 1137 |
| 203 | Ga0207689_10032640 | 3300025942 | Bacteria | 4329 |
| 204 | Ga0207689_10063754 | 3300025942 | Bacteria | 3032 |
| 205 | Ga0207689_11158559 | 3300025942 | Unclassified | 651 |
| 206 | Ga0207661_11472060 | 3300025944 | Bacteria | 624 |
| 207 | Ga0207661_11674333 | 3300025944 | Bacteria | 581 |
| 208 | Ga0207679_11310999 | 3300025945 | Bacteria | 664 |
| 209 | Ga0207651_10154937 | 3300025960 | Bacteria | 1788 |
| 210 | Ga0207712_10003748 | 3300025961 | Bacteria | 9593 |
| 211 | Ga0207712_10003945 | 3300025961 | Bacteria | 9373 |
| 212 | Ga0207712_10247327 | 3300025961 | Bacteria | 1440 |
| 213 | Ga0207712_10562743 | 3300025961 | Bacteria | 982 |
| 214 | Ga0207712_10739269 | 3300025961 | Unclassified | 861 |
| 215 | Ga0207712_11114452 | 3300025961 | Bacteria | 703 |
| 216 | Ga0207712_11515870 | 3300025961 | Unclassified | 601 |
| 217 | Ga0207712_11914947 | 3300025961 | Bacteria | 531 |
| 218 | Ga0207668_10222044 | 3300025972 | Bacteria | 1518 |
| 219 | Ga0207640_10847197 | 3300025981 | Bacteria | 795 |
| 220 | Ga0207658_10905451 | 3300025986 | Bacteria | 803 |
| 221 | Ga0207658_11144237 | 3300025986 | Bacteria | 711 |
| 222 | Ga0207658_11708259 | 3300025986 | Unclassified | 575 |
| 223 | Ga0207658_11954433 | 3300025986 | Bacteria | 534 |
| 224 | Ga0207677_10425680 | 3300026023 | Unclassified | 1132 |
| 225 | Ga0207677_10632819 | 3300026023 | Bacteria | 942 |
| 226 | Ga0207703_10174992 | 3300026035 | Bacteria | 1890 |
| 227 | Ga0207639_10419971 | 3300026041 | Bacteria | 1209 |
| 228 | Ga0207708_10036076 | 3300026075 | Bacteria | 3763 |
| 229 | Ga0207708_11064616 | 3300026075 | Bacteria | 704 |
| 230 | Ga0207641_10000873 | 3300026088 | Bacteria | 31566 |
| 231 | Ga0207641_10055829 | 3300026088 | Bacteria | 3354 |
| 232 | Ga0207641_10240867 | 3300026088 | Bacteria | 1685 |
| 233 | Ga0207641_10766910 | 3300026088 | Bacteria | 953 |
| 234 | Ga0207641_11566667 | 3300026088 | Unclassified | 661 |
| 235 | Ga0207641_11587473 | 3300026088 | Bacteria | 656 |
| 236 | Ga0207648_10034852 | 3300026089 | Bacteria | 4437 |
| 237 | Ga0207648_10058604 | 3300026089 | Bacteria | 3358 |
| 238 | Ga0207648_10094820 | 3300026089 | Bacteria | 2610 |
| 239 | Ga0207648_10513027 | 3300026089 | Unclassified | 1098 |
| 240 | Ga0207648_11961674 | 3300026089 | Bacteria | 547 |
| 241 | Ga0207676_10014462 | 3300026095 | Bacteria | 5680 |
| 242 | Ga0207676_10426119 | 3300026095 | Bacteria | 1245 |
| 243 | Ga0207674_10150353 | 3300026116 | Bacteria | 2286 |
| 244 | Ga0207675_100017141 | 3300026118 | Bacteria | 6764 |
| 245 | Ga0207675_100097037 | 3300026118 | Bacteria | 2775 |
| 246 | Ga0207675_100800013 | 3300026118 | Bacteria | 956 |
| 247 | Ga0207675_102746717 | 3300026118 | Bacteria | 500 |
| 248 | Ga0207683_10098563 | 3300026121 | Unclassified | 2608 |
| 249 | Ga0207698_10466460 | 3300026142 | Bacteria | 1222 |
| 250 | Ga0207428_10085039 | 3300027907 | Unclassified | 2464 |
| 251 | Ga0268265_10485013 | 3300028380 | Unclassified | 1162 |
| 252 | Ga0268265_10845262 | 3300028380 | Bacteria | 895 |
| 253 | Ga0268264_10533310 | 3300028381 | Unclassified | 1149 |
| 254 | Ga0268264_11143985 | 3300028381 | Unclassified | 787 |
| 255 | Ga0268264_11352695 | 3300028381 | Bacteria | 722 |
| 256 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 257 | Ga0265327_10000906 | 3300031251 | Bacteria | 43527 |
| 258 | Ga0307408_101535249 | 3300031548 | Bacteria | 631 |
| 259 | Ga0307410_10828363 | 3300031852 | Bacteria | 789 |
| 260 | Ga0307416_101508214 | 3300032002 | Bacteria | 778 |
| 261 | Ga0307414_10204524 | 3300032004 | Bacteria | 1609 |
| 262 | Ga0307414_10589533 | 3300032004 | Bacteria | 996 |
| 263 | Ga0307415_100220637 | 3300032126 | Bacteria | 1520 |
| 264 | Ga0307507_10345259 | 3300033179 | Unclassified | 879 |
| 265 | Ga0373957_0433847 | 3300035120 | Bacteria | 568 |
| 266 | Ga0395900_0045533 | 3300037418 | Unclassified | 4519 |
| 267 | Ga0395905_0000527 | 3300037471 | Bacteria | 52435 |
| 268 | Ga0395905_0127684 | 3300037471 | Bacteria | 2391 |
| 269 | Ga0439439_0027945 | 3300041406 | Bacteria | 1427 |
| 270 | Ga0439453_0139578 | 3300041408 | Bacteria | 568 |
| 271 | Ga0451793_1365790 | 3300041452 | Bacteria | 836 |
| 272 | Ga0451804_0685085 | 3300041463 | Unclassified | 735 |
| 273 | Ga0451835_0610908 | 3300041492 | Bacteria | 1056 |
| 274 | Ga0451837_0308600 | 3300041494 | Unclassified | 612 |
| 275 | Ga0451841_0075618 | 3300041498 | Bacteria | 513 |
| 276 | Ga0451853_1725440 | 3300041512 | Bacteria | 502 |
| 277 | Ga0439431_0014969 | 3300041997 | Bacteria | 1802 |
| 278 | Ga0439441_027666 | 3300042001 | Bacteria | 1083 |
| 279 | Ga0439442_019238 | 3300042002 | Bacteria | 1413 |
| 280 | Ga0439454_065522 | 3300042011 | Bacteria | 637 |
| 281 | Ga0450898_025533 | 3300042134 | Bacteria | 1060 |
| 282 | Ga0439434_0170207 | 3300042435 | Bacteria | 726 |
| 283 | Ga0439435_0049992 | 3300042436 | Bacteria | 1194 |
| 284 | Ga0453683_0664787 | 3300044673 | Bacteria | 681 |
| 285 | Ga0453684_0092803 | 3300044712 | Bacteria | 3720 |
| 286 | Ga0453684_0147846 | 3300044712 | Bacteria | 2796 |
| 287 | Ga0453684_0258773 | 3300044712 | Bacteria | 1995 |
| 288 | Ga0453684_1237266 | 3300044712 | Bacteria | 782 |
| 289 | Ga0453684_1847344 | 3300044712 | Bacteria | 613 |
| 290 | Ga0495594_0176498 | 3300046499 | Bacteria | 1216 |
| 291 | Ga0495643_0129766 | 3300046522 | Bacteria | 1266 |
| 292 | Ga0495644_0466099 | 3300046523 | Bacteria | 504 |
| 293 | Ga0495598_0128848 | 3300046537 | Bacteria | 865 |
| 294 | Ga0495621_0091681 | 3300046539 | Unclassified | 1146 |
| 295 | Ga0495668_0000863 | 3300046616 | Bacteria | 34191 |
| 296 | Ga0495670_0292630 | 3300046691 | Bacteria | 872 |
| 297 | Ga0495670_0526529 | 3300046691 | Unclassified | 643 |
| 298 | Ga0495600_0417188 | 3300046809 | Bacteria | 833 |
| 299 | Ga0495672_0069425 | 3300047320 | Unclassified | 2000 |
| 300 | Ga0495676_0996909 | 3300047321 | Bacteria | 535 |
| 301 | Ga0495686_0021166 | 3300047472 | Bacteria | 4325 |
| 302 | Ga0495686_0028441 | 3300047472 | Bacteria | 3641 |
| 303 | Ga0501032_0017004 | 3300049569 | Bacteria | 5110 |
| 304 | Ga0501034_0062889 | 3300049571 | Bacteria | 3726 |
| 305 | Ga0501036_0006877 | 3300049572 | Bacteria | 9244 |
| 306 | Ga0501037_0059366 | 3300049573 | Bacteria | 2791 |
| 307 | Ga0501038_0054670 | 3300049574 | Bacteria | 3433 |
| 308 | Ga0501039_0041440 | 3300049575 | Bacteria | 3557 |
| 309 | Ga0501043_0009419 | 3300049579 | Bacteria | 7667 |
| 310 | Ga0501046_0374348 | 3300049580 | Unclassified | 1031 |
| 311 | Ga0501047_0073517 | 3300049581 | Bacteria | 3291 |
| 312 | Ga0501048_0042214 | 3300049582 | Bacteria | 3266 |
| 313 | Ga0501070_0039093 | 3300049586 | Bacteria | 3958 |
| 314 | Ga0501072_0809356 | 3300049588 | Bacteria | 734 |
| 315 | Ga0501074_0010801 | 3300049590 | Bacteria | 6631 |
| 316 | Ga0501079_0135959 | 3300049741 | Bacteria | 1914 |
| 317 | Ga0501083_0014203 | 3300049744 | Bacteria | 5570 |
| 318 | Ga0501035_0102294 | 3300049822 | Unclassified | 2513 |
| 319 | Ga0501044_0181951 | 3300049823 | Unclassified | 2068 |
| 320 | nmdc:mga0k408_488862_c1 | 3300050493 | Unclassified | 730 |
| 321 | nmdc:mga05p37_359854_c1 | 3300050507 | Bacteria | 1711 |
| 322 | nmdc:mga05p37_568354_c1 | 3300050507 | Bacteria | 1287 |
| 323 | nmdc:mga05p37_782713_c1 | 3300050507 | Bacteria | 1046 |
| 324 | nmdc:mga09592_81361_c1 | 3300050508 | Bacteria | 2760 |
| 325 | nmdc:mga09592_823_c1 | 3300050508 | Bacteria | 24005 |
| 326 | nmdc:mga0qj67_257108_c1 | 3300050509 | Bacteria | 1417 |
| 327 | nmdc:mga0qj67_43430_c1 | 3300050509 | Bacteria | 3540 |
| 328 | nmdc:mga06r32_289786_c1 | 3300050510 | Bacteria | 1624 |
| 329 | nmdc:mga06r32_316572_c1 | 3300050510 | Unclassified | 1546 |
| 330 | nmdc:mga08y16_1015400_c1 | 3300050511 | Unclassified | 809 |
| 331 | nmdc:mga08y16_116351_c1 | 3300050511 | Bacteria | 2783 |
| 332 | nmdc:mga08y16_1749003_c1 | 3300050511 | Bacteria | 576 |
| 333 | Ga0500646_0115726 | 3300053090 | Unclassified | 857 |
| 334 | Ga0500568_0070675 | 3300053139 | Bacteria | 1337 |
| 335 | Ga0501084_0138728 | 3300054114 | Bacteria | 2047 |
| 336 | Ga0501082_0286227 | 3300060353 | Bacteria | 1435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10388427 | Ga0065704_103884271 | 103 |
| 2 | 3300042001 | Ga0439441_027666 | Ga0439441_027666_26_361 | 103 |
| 3 | 3300025944 | Ga0207661_11472060 | Ga0207661_114720602 | 104 |
| 4 | 3300025986 | Ga0207658_11954433 | Ga0207658_119544331 | 104 |
| 5 | iso_pu_bacteria | 2839989709 | 2839990244 | 105 |
| 6 | iso_pu_bacteria | 2977232053 | 2977236866 | 106 |
| 7 | 3300005331 | Ga0070670_101829273 | Ga0070670_1018292731 | 107 |
| 8 | 3300025272 | Ga0209455_1019102 | Ga0209455_10191023 | 107 |
| 9 | 3300031548 | Ga0307408_101535249 | Ga0307408_1015352491 | 107 |
| 10 | 3300032004 | Ga0307414_10589533 | Ga0307414_105895332 | 107 |
| 11 | 3300002741 | JGI25157J39369_1014248 | JGI25157J39369_10142482 | 108 |
| 12 | 3300005331 | Ga0070670_100489105 | Ga0070670_1004891052 | 109 |
| 13 | 3300025925 | Ga0207650_10595219 | Ga0207650_105952192 | 109 |
| 14 | 3300005334 | Ga0068869_100846781 | Ga0068869_1008467812 | 110 |
| 15 | 3300005343 | Ga0070687_101342622 | Ga0070687_1013426221 | 110 |
| 16 | 3300005347 | Ga0070668_100608273 | Ga0070668_1006082732 | 110 |
| 17 | 3300005617 | Ga0068859_100097843 | Ga0068859_1000978434 | 110 |
| 18 | 3300005843 | Ga0068860_100698687 | Ga0068860_1006986871 | 110 |
| 19 | 3300006237 | Ga0097621_100324629 | Ga0097621_1003246292 | 110 |
| 20 | 3300006931 | Ga0097620_100097845 | Ga0097620_1000978452 | 110 |
| 21 | 3300009176 | Ga0105242_10016179 | Ga0105242_100161792 | 110 |
| 22 | 3300009553 | Ga0105249_11381858 | Ga0105249_113818582 | 110 |
| 23 | 3300013297 | Ga0157378_10425351 | Ga0157378_104253512 | 110 |
| 24 | 3300013306 | Ga0163162_11360414 | Ga0163162_113604142 | 110 |
| 25 | 3300025907 | Ga0207645_10131578 | Ga0207645_101315783 | 110 |
| 26 | 3300025934 | Ga0207686_10147419 | Ga0207686_101474192 | 110 |
| 27 | 3300025942 | Ga0207689_10032640 | Ga0207689_100326405 | 110 |
| 28 | 3300025961 | Ga0207712_11114452 | Ga0207712_111144521 | 110 |
| 29 | 3300026089 | Ga0207648_10034852 | Ga0207648_100348524 | 110 |
| 30 | 3300028381 | Ga0268264_11352695 | Ga0268264_113526951 | 110 |
| 31 | 3300002459 | JGI24751J29686_10004241 | JGI24751J29686_100042415 | 111 |
| 32 | 3300005288 | Ga0065714_10303813 | Ga0065714_103038131 | 111 |
| 33 | 3300005290 | Ga0065712_10084512 | Ga0065712_100845124 | 111 |
| 34 | 3300005293 | Ga0065715_10039073 | Ga0065715_100390731 | 111 |
| 35 | 3300005293 | Ga0065715_10468693 | Ga0065715_104686931 | 111 |
| 36 | 3300005329 | Ga0070683_100670415 | Ga0070683_1006704151 | 111 |
| 37 | 3300005330 | Ga0070690_100686952 | Ga0070690_1006869521 | 111 |
| 38 | 3300005331 | Ga0070670_100037560 | Ga0070670_1000375602 | 111 |
| 39 | 3300005331 | Ga0070670_101258709 | Ga0070670_1012587091 | 111 |
| 40 | 3300005331 | Ga0070670_101783565 | Ga0070670_1017835652 | 111 |
| 41 | 3300005334 | Ga0068869_100013446 | Ga0068869_1000134462 | 111 |
| 42 | 3300005334 | Ga0068869_101132704 | Ga0068869_1011327041 | 111 |
| 43 | 3300005335 | Ga0070666_10494516 | Ga0070666_104945161 | 111 |
| 44 | 3300005338 | Ga0068868_100152036 | Ga0068868_1001520362 | 111 |
| 45 | 3300005340 | Ga0070689_100044909 | Ga0070689_1000449092 | 111 |
| 46 | 3300005340 | Ga0070689_100153792 | Ga0070689_1001537922 | 111 |
| 47 | 3300005343 | Ga0070687_100280320 | Ga0070687_1002803202 | 111 |
| 48 | 3300005344 | Ga0070661_101776071 | Ga0070661_1017760711 | 111 |
| 49 | 3300005347 | Ga0070668_100169244 | Ga0070668_1001692443 | 111 |
| 50 | 3300005347 | Ga0070668_100412062 | Ga0070668_1004120621 | 111 |
| 51 | 3300005353 | Ga0070669_100046507 | Ga0070669_1000465075 | 111 |
| 52 | 3300005353 | Ga0070669_100469571 | Ga0070669_1004695711 | 111 |
| 53 | 3300005353 | Ga0070669_101339046 | Ga0070669_1013390461 | 111 |
| 54 | 3300005354 | Ga0070675_101400897 | Ga0070675_1014008972 | 111 |
| 55 | 3300005354 | Ga0070675_101452117 | Ga0070675_1014521171 | 111 |
| 56 | 3300005355 | Ga0070671_101244359 | Ga0070671_1012443592 | 111 |
| 57 | 3300005356 | Ga0070674_100856747 | Ga0070674_1008567472 | 111 |
| 58 | 3300005364 | Ga0070673_100078786 | Ga0070673_1000787864 | 111 |
| 59 | 3300005364 | Ga0070673_100552612 | Ga0070673_1005526122 | 111 |
| 60 | 3300005365 | Ga0070688_100049396 | Ga0070688_1000493962 | 111 |
| 61 | 3300005367 | Ga0070667_101976847 | Ga0070667_1019768471 | 111 |
| 62 | 3300005441 | Ga0070700_100128366 | Ga0070700_1001283661 | 111 |
| 63 | 3300005444 | Ga0070694_101697218 | Ga0070694_1016972181 | 111 |
| 64 | 3300005456 | Ga0070678_100593199 | Ga0070678_1005931993 | 111 |
| 65 | 3300005456 | Ga0070678_101538095 | Ga0070678_1015380951 | 111 |
| 66 | 3300005459 | Ga0068867_100434284 | Ga0068867_1004342843 | 111 |
| 67 | 3300005459 | Ga0068867_100843090 | Ga0068867_1008430902 | 111 |
| 68 | 3300005459 | Ga0068867_100849793 | Ga0068867_1008497931 | 111 |
| 69 | 3300005459 | Ga0068867_101039610 | Ga0068867_1010396101 | 111 |
| 70 | 3300005459 | Ga0068867_101522298 | Ga0068867_1015222982 | 111 |
| 71 | 3300005466 | Ga0070685_10137649 | Ga0070685_101376492 | 111 |
| 72 | 3300005466 | Ga0070685_10282194 | Ga0070685_102821942 | 111 |
| 73 | 3300005466 | Ga0070685_10330224 | Ga0070685_103302242 | 111 |
| 74 | 3300005467 | Ga0070706_101531506 | Ga0070706_1015315061 | 111 |
| 75 | 3300005471 | Ga0070698_100001455 | Ga0070698_10000145523 | 111 |
| 76 | 3300005471 | Ga0070698_100002086 | Ga0070698_10000208628 | 111 |
| 77 | 3300005539 | Ga0068853_100008858 | Ga0068853_1000088582 | 111 |
| 78 | 3300005539 | Ga0068853_100700424 | Ga0068853_1007004242 | 111 |
| 79 | 3300005543 | Ga0070672_100150532 | Ga0070672_1001505321 | 111 |
| 80 | 3300005543 | Ga0070672_100330906 | Ga0070672_1003309061 | 111 |
| 81 | 3300005543 | Ga0070672_101314866 | Ga0070672_1013148662 | 111 |
| 82 | 3300005544 | Ga0070686_100346008 | Ga0070686_1003460083 | 111 |
| 83 | 3300005545 | Ga0070695_100885563 | Ga0070695_1008855631 | 111 |
| 84 | 3300005547 | Ga0070693_100297682 | Ga0070693_1002976822 | 111 |
| 85 | 3300005564 | Ga0070664_101810890 | Ga0070664_1018108902 | 111 |
| 86 | 3300005564 | Ga0070664_102203168 | Ga0070664_1022031681 | 111 |
| 87 | 3300005577 | Ga0068857_100045001 | Ga0068857_1000450015 | 111 |
| 88 | 3300005615 | Ga0070702_100958872 | Ga0070702_1009588721 | 111 |
| 89 | 3300005616 | Ga0068852_100406273 | Ga0068852_1004062732 | 111 |
| 90 | 3300005617 | Ga0068859_100172006 | Ga0068859_1001720064 | 111 |
| 91 | 3300005617 | Ga0068859_100323343 | Ga0068859_1003233433 | 111 |
| 92 | 3300005617 | Ga0068859_100383627 | Ga0068859_1003836271 | 111 |
| 93 | 3300005618 | Ga0068864_100135085 | Ga0068864_1001350852 | 111 |
| 94 | 3300005618 | Ga0068864_100216431 | Ga0068864_1002164312 | 111 |
| 95 | 3300005618 | Ga0068864_100385192 | Ga0068864_1003851922 | 111 |
| 96 | 3300005618 | Ga0068864_101497575 | Ga0068864_1014975752 | 111 |
| 97 | 3300005618 | Ga0068864_102458130 | Ga0068864_1024581301 | 111 |
| 98 | 3300005719 | Ga0068861_100062234 | Ga0068861_1000622342 | 111 |
| 99 | 3300005719 | Ga0068861_100143337 | Ga0068861_1001433373 | 111 |
| 100 | 3300005719 | Ga0068861_100838284 | Ga0068861_1008382842 | 111 |
| 101 | 3300005834 | Ga0068851_10047674 | Ga0068851_100476743 | 111 |
| 102 | 3300005840 | Ga0068870_10011641 | Ga0068870_100116413 | 111 |
| 103 | 3300005840 | Ga0068870_10897803 | Ga0068870_108978032 | 111 |
| 104 | 3300005841 | Ga0068863_100258983 | Ga0068863_1002589832 | 111 |
| 105 | 3300005841 | Ga0068863_100262375 | Ga0068863_1002623753 | 111 |
| 106 | 3300005841 | Ga0068863_101136145 | Ga0068863_1011361451 | 111 |
| 107 | 3300005841 | Ga0068863_101385571 | Ga0068863_1013855712 | 111 |
| 108 | 3300005841 | Ga0068863_102318613 | Ga0068863_1023186131 | 111 |
| 109 | 3300005842 | Ga0068858_100116672 | Ga0068858_1001166723 | 111 |
| 110 | 3300005843 | Ga0068860_100206522 | Ga0068860_1002065224 | 111 |
| 111 | 3300005843 | Ga0068860_100610493 | Ga0068860_1006104932 | 111 |
| 112 | 3300005844 | Ga0068862_101132194 | Ga0068862_1011321942 | 111 |
| 113 | 3300006195 | Ga0075366_10567027 | Ga0075366_105670272 | 111 |
| 114 | 3300006358 | Ga0068871_100171713 | Ga0068871_1001717133 | 111 |
| 115 | 3300006358 | Ga0068871_100280120 | Ga0068871_1002801202 | 111 |
| 116 | 3300006844 | Ga0075428_100001878 | Ga0075428_1000018788 | 111 |
| 117 | 3300006844 | Ga0075428_100061237 | Ga0075428_1000612374 | 111 |
| 118 | 3300006846 | Ga0075430_100095144 | Ga0075430_1000951443 | 111 |
| 119 | 3300006847 | Ga0075431_100307378 | Ga0075431_1003073782 | 111 |
| 120 | 3300006880 | Ga0075429_100001931 | Ga0075429_10000193111 | 111 |
| 121 | 3300006880 | Ga0075429_100052501 | Ga0075429_1000525016 | 111 |
| 122 | 3300006881 | Ga0068865_101577525 | Ga0068865_1015775252 | 111 |
| 123 | 3300006881 | Ga0068865_101747389 | Ga0068865_1017473891 | 111 |
| 124 | 3300006931 | Ga0097620_100172008 | Ga0097620_1001720084 | 111 |
| 125 | 3300006931 | Ga0097620_100323345 | Ga0097620_1003233453 | 111 |
| 126 | 3300006931 | Ga0097620_100383630 | Ga0097620_1003836303 | 111 |
| 127 | 3300009094 | Ga0111539_10167394 | Ga0111539_101673943 | 111 |
| 128 | 3300009094 | Ga0111539_10579674 | Ga0111539_105796741 | 111 |
| 129 | 3300009094 | Ga0111539_10930513 | Ga0111539_109305132 | 111 |
| 130 | 3300009098 | Ga0105245_10418825 | Ga0105245_104188253 | 111 |
| 131 | 3300009101 | Ga0105247_10009905 | Ga0105247_100099057 | 111 |
| 132 | 3300009101 | Ga0105247_10941546 | Ga0105247_109415462 | 111 |
| 133 | 3300009147 | Ga0114129_10062503 | Ga0114129_100625032 | 111 |
| 134 | 3300009147 | Ga0114129_10263410 | Ga0114129_102634102 | 111 |
| 135 | 3300009148 | Ga0105243_10440189 | Ga0105243_104401892 | 111 |
| 136 | 3300009176 | Ga0105242_10008224 | Ga0105242_100082244 | 111 |
| 137 | 3300009176 | Ga0105242_10014405 | Ga0105242_100144057 | 111 |
| 138 | 3300009176 | Ga0105242_11232207 | Ga0105242_112322071 | 111 |
| 139 | 3300009177 | Ga0105248_10164302 | Ga0105248_101643025 | 111 |
| 140 | 3300009553 | Ga0105249_10000611 | Ga0105249_1000061133 | 111 |
| 141 | 3300009553 | Ga0105249_10001393 | Ga0105249_1000139312 | 111 |
| 142 | 3300009553 | Ga0105249_10031748 | Ga0105249_100317486 | 111 |
| 143 | 3300009553 | Ga0105249_10075099 | Ga0105249_100750992 | 111 |
| 144 | 3300009553 | Ga0105249_10100046 | Ga0105249_101000465 | 111 |
| 145 | 3300009553 | Ga0105249_10397091 | Ga0105249_103970912 | 111 |
| 146 | 3300009553 | Ga0105249_10756917 | Ga0105249_107569172 | 111 |
| 147 | 3300009553 | Ga0105249_10944751 | Ga0105249_109447511 | 111 |
| 148 | 3300011119 | Ga0105246_10408702 | Ga0105246_104087021 | 111 |
| 149 | 3300013100 | Ga0157373_10666629 | Ga0157373_106666292 | 111 |
| 150 | 3300013102 | Ga0157371_10039559 | Ga0157371_100395591 | 111 |
| 151 | 3300013102 | Ga0157371_10314641 | Ga0157371_103146412 | 111 |
| 152 | 3300013104 | Ga0157370_10387087 | Ga0157370_103870871 | 111 |
| 153 | 3300013105 | Ga0157369_10126651 | Ga0157369_101266513 | 111 |
| 154 | 3300013105 | Ga0157369_11424192 | Ga0157369_114241921 | 111 |
| 155 | 3300013105 | Ga0157369_12392917 | Ga0157369_123929171 | 111 |
| 156 | 3300013296 | Ga0157374_12380073 | Ga0157374_123800731 | 111 |
| 157 | 3300013297 | Ga0157378_12234622 | Ga0157378_122346222 | 111 |
| 158 | 3300013297 | Ga0157378_12650583 | Ga0157378_126505831 | 111 |
| 159 | 3300013297 | Ga0157378_12822782 | Ga0157378_128227822 | 111 |
| 160 | 3300013306 | Ga0163162_12109917 | Ga0163162_121099171 | 111 |
| 161 | 3300013306 | Ga0163162_12469828 | Ga0163162_124698281 | 111 |
| 162 | 3300013307 | Ga0157372_10233696 | Ga0157372_102336964 | 111 |
| 163 | 3300013307 | Ga0157372_10538220 | Ga0157372_105382203 | 111 |
| 164 | 3300013307 | Ga0157372_11701141 | Ga0157372_117011412 | 111 |
| 165 | 3300013308 | Ga0157375_10390972 | Ga0157375_103909722 | 111 |
| 166 | 3300013308 | Ga0157375_10964309 | Ga0157375_109643092 | 111 |
| 167 | 3300013308 | Ga0157375_11988280 | Ga0157375_119882801 | 111 |
| 168 | 3300013308 | Ga0157375_12370902 | Ga0157375_123709022 | 111 |
| 169 | 3300014325 | Ga0163163_10244122 | Ga0163163_102441221 | 111 |
| 170 | 3300014325 | Ga0163163_10250732 | Ga0163163_102507323 | 111 |
| 171 | 3300014325 | Ga0163163_10639108 | Ga0163163_106391081 | 111 |
| 172 | 3300014325 | Ga0163163_11860881 | Ga0163163_118608811 | 111 |
| 173 | 3300014325 | Ga0163163_12423628 | Ga0163163_124236281 | 111 |
| 174 | 3300014325 | Ga0163163_13349801 | Ga0163163_133498011 | 111 |
| 175 | 3300014326 | Ga0157380_10026841 | Ga0157380_100268411 | 111 |
| 176 | 3300014326 | Ga0157380_10513970 | Ga0157380_105139702 | 111 |
| 177 | 3300014326 | Ga0157380_10727187 | Ga0157380_107271872 | 111 |
| 178 | 3300014326 | Ga0157380_10826314 | Ga0157380_108263141 | 111 |
| 179 | 3300014326 | Ga0157380_11937091 | Ga0157380_119370912 | 111 |
| 180 | 3300014326 | Ga0157380_13120171 | Ga0157380_131201711 | 111 |
| 181 | 3300014745 | Ga0157377_11326385 | Ga0157377_113263851 | 111 |
| 182 | 3300014745 | Ga0157377_11669254 | Ga0157377_116692542 | 111 |
| 183 | 3300014745 | Ga0157377_11756348 | Ga0157377_117563481 | 111 |
| 184 | 3300014968 | Ga0157379_10295644 | Ga0157379_102956442 | 111 |
| 185 | 3300014969 | Ga0157376_10684397 | Ga0157376_106843972 | 111 |
| 186 | 3300017792 | Ga0163161_10199530 | Ga0163161_101995302 | 111 |
| 187 | 3300017792 | Ga0163161_10235991 | Ga0163161_102359912 | 111 |
| 188 | 3300017792 | Ga0163161_10834315 | Ga0163161_108343151 | 111 |
| 189 | 3300025271 | Ga0207666_1040998 | Ga0207666_10409982 | 111 |
| 190 | 3300025315 | Ga0207697_10030666 | Ga0207697_100306663 | 111 |
| 191 | 3300025893 | Ga0207682_10040074 | Ga0207682_100400742 | 111 |
| 192 | 3300025900 | Ga0207710_10009414 | Ga0207710_100094142 | 111 |
| 193 | 3300025903 | Ga0207680_10610229 | Ga0207680_106102292 | 111 |
| 194 | 3300025905 | Ga0207685_10041275 | Ga0207685_100412753 | 111 |
| 195 | 3300025907 | Ga0207645_10212616 | Ga0207645_102126162 | 111 |
| 196 | 3300025907 | Ga0207645_10500300 | Ga0207645_105003002 | 111 |
| 197 | 3300025908 | Ga0207643_10003695 | Ga0207643_100036953 | 111 |
| 198 | 3300025909 | Ga0207705_10382712 | Ga0207705_103827121 | 111 |
| 199 | 3300025910 | Ga0207684_11435056 | Ga0207684_114350561 | 111 |
| 200 | 3300025918 | Ga0207662_10309557 | Ga0207662_103095572 | 111 |
| 201 | 3300025925 | Ga0207650_10006365 | Ga0207650_1000636510 | 111 |
| 202 | 3300025925 | Ga0207650_10062814 | Ga0207650_100628142 | 111 |
| 203 | 3300025925 | Ga0207650_10583032 | Ga0207650_105830322 | 111 |
| 204 | 3300025925 | Ga0207650_10954049 | Ga0207650_109540491 | 111 |
| 205 | 3300025926 | Ga0207659_11384262 | Ga0207659_113842621 | 111 |
| 206 | 3300025934 | Ga0207686_10002249 | Ga0207686_100022497 | 111 |
| 207 | 3300025934 | Ga0207686_10053869 | Ga0207686_100538694 | 111 |
| 208 | 3300025935 | Ga0207709_10146280 | Ga0207709_101462803 | 111 |
| 209 | 3300025936 | Ga0207670_10081086 | Ga0207670_100810861 | 111 |
| 210 | 3300025937 | Ga0207669_10259144 | Ga0207669_102591442 | 111 |
| 211 | 3300025938 | Ga0207704_10018696 | Ga0207704_100186965 | 111 |
| 212 | 3300025940 | Ga0207691_10116141 | Ga0207691_101161412 | 111 |
| 213 | 3300025940 | Ga0207691_10421549 | Ga0207691_104215492 | 111 |
| 214 | 3300025942 | Ga0207689_10063754 | Ga0207689_100637541 | 111 |
| 215 | 3300025942 | Ga0207689_11158559 | Ga0207689_111585592 | 111 |
| 216 | 3300025944 | Ga0207661_11674333 | Ga0207661_116743332 | 111 |
| 217 | 3300025945 | Ga0207679_11310999 | Ga0207679_113109991 | 111 |
| 218 | 3300025960 | Ga0207651_10154937 | Ga0207651_101549371 | 111 |
| 219 | 3300025961 | Ga0207712_10003748 | Ga0207712_100037483 | 111 |
| 220 | 3300025961 | Ga0207712_10003945 | Ga0207712_100039454 | 111 |
| 221 | 3300025961 | Ga0207712_10247327 | Ga0207712_102473271 | 111 |
| 222 | 3300025961 | Ga0207712_10562743 | Ga0207712_105627432 | 111 |
| 223 | 3300025961 | Ga0207712_10739269 | Ga0207712_107392692 | 111 |
| 224 | 3300025961 | Ga0207712_11515870 | Ga0207712_115158701 | 111 |
| 225 | 3300025961 | Ga0207712_11914947 | Ga0207712_119149471 | 111 |
| 226 | 3300025972 | Ga0207668_10222044 | Ga0207668_102220443 | 111 |
| 227 | 3300025981 | Ga0207640_10847197 | Ga0207640_108471971 | 111 |
| 228 | 3300025986 | Ga0207658_10905451 | Ga0207658_109054511 | 111 |
| 229 | 3300025986 | Ga0207658_11144237 | Ga0207658_111442371 | 111 |
| 230 | 3300025986 | Ga0207658_11708259 | Ga0207658_117082592 | 111 |
| 231 | 3300026023 | Ga0207677_10425680 | Ga0207677_104256802 | 111 |
| 232 | 3300026023 | Ga0207677_10632819 | Ga0207677_106328192 | 111 |
| 233 | 3300026035 | Ga0207703_10174992 | Ga0207703_101749923 | 111 |
| 234 | 3300026041 | Ga0207639_10419971 | Ga0207639_104199712 | 111 |
| 235 | 3300026075 | Ga0207708_10036076 | Ga0207708_100360763 | 111 |
| 236 | 3300026075 | Ga0207708_11064616 | Ga0207708_110646162 | 111 |
| 237 | 3300026088 | Ga0207641_10000873 | Ga0207641_1000087327 | 111 |
| 238 | 3300026088 | Ga0207641_10055829 | Ga0207641_100558293 | 111 |
| 239 | 3300026088 | Ga0207641_10240867 | Ga0207641_102408672 | 111 |
| 240 | 3300026088 | Ga0207641_10766910 | Ga0207641_107669102 | 111 |
| 241 | 3300026088 | Ga0207641_11566667 | Ga0207641_115666672 | 111 |
| 242 | 3300026088 | Ga0207641_11587473 | Ga0207641_115874731 | 111 |
| 243 | 3300026089 | Ga0207648_10058604 | Ga0207648_100586041 | 111 |
| 244 | 3300026089 | Ga0207648_10094820 | Ga0207648_100948202 | 111 |
| 245 | 3300026089 | Ga0207648_10513027 | Ga0207648_105130272 | 111 |
| 246 | 3300026089 | Ga0207648_11961674 | Ga0207648_119616741 | 111 |
| 247 | 3300026095 | Ga0207676_10014462 | Ga0207676_100144625 | 111 |
| 248 | 3300026095 | Ga0207676_10426119 | Ga0207676_104261193 | 111 |
| 249 | 3300026116 | Ga0207674_10150353 | Ga0207674_101503533 | 111 |
| 250 | 3300026118 | Ga0207675_100017141 | Ga0207675_1000171416 | 111 |
| 251 | 3300026118 | Ga0207675_100097037 | Ga0207675_1000970374 | 111 |
| 252 | 3300026118 | Ga0207675_100800013 | Ga0207675_1008000132 | 111 |
| 253 | 3300026118 | Ga0207675_102746717 | Ga0207675_1027467171 | 111 |
| 254 | 3300026121 | Ga0207683_10098563 | Ga0207683_100985633 | 111 |
| 255 | 3300026142 | Ga0207698_10466460 | Ga0207698_104664602 | 111 |
| 256 | 3300027907 | Ga0207428_10085039 | Ga0207428_100850393 | 111 |
| 257 | 3300028380 | Ga0268265_10485013 | Ga0268265_104850132 | 111 |
| 258 | 3300028380 | Ga0268265_10845262 | Ga0268265_108452622 | 111 |
| 259 | 3300028381 | Ga0268264_10533310 | Ga0268264_105333102 | 111 |
| 260 | 3300028381 | Ga0268264_11143985 | Ga0268264_111439852 | 111 |
| 261 | 3300028794 | Ga0307515_10000001 | Ga0307515_10000001374 | 111 |
| 262 | 3300031251 | Ga0265327_10000906 | Ga0265327_1000090620 | 111 |
| 263 | 3300031852 | Ga0307410_10828363 | Ga0307410_108283632 | 111 |
| 264 | 3300032002 | Ga0307416_101508214 | Ga0307416_1015082141 | 111 |
| 265 | 3300032004 | Ga0307414_10204524 | Ga0307414_102045243 | 111 |
| 266 | 3300032126 | Ga0307415_100220637 | Ga0307415_1002206373 | 111 |
| 267 | 3300033179 | Ga0307507_10345259 | Ga0307507_103452591 | 111 |
| 268 | 3300035120 | Ga0373957_0433847 | Ga0373957_0433847_189_524 | 111 |
| 269 | 3300037418 | Ga0395900_0045533 | Ga0395900_0045533_2248_2583 | 111 |
| 270 | 3300037471 | Ga0395905_0000527 | Ga0395905_0000527_665_1000 | 111 |
| 271 | 3300037471 | Ga0395905_0127684 | Ga0395905_0127684_142_477 | 111 |
| 272 | 3300041406 | Ga0439439_0027945 | Ga0439439_0027945_232_567 | 111 |
| 273 | 3300041408 | Ga0439453_0139578 | Ga0439453_0139578_19_354 | 111 |
| 274 | 3300041452 | Ga0451793_1365790 | Ga0451793_1365790_68_403 | 111 |
| 275 | 3300041463 | Ga0451804_0685085 | Ga0451804_0685085_343_678 | 111 |
| 276 | 3300041492 | Ga0451835_0610908 | Ga0451835_0610908_426_779 | 111 |
| 277 | 3300041494 | Ga0451837_0308600 | Ga0451837_0308600_142_477 | 111 |
| 278 | 3300041498 | Ga0451841_0075618 | Ga0451841_0075618_27_362 | 111 |
| 279 | 3300041512 | Ga0451853_1725440 | Ga0451853_1725440_103_438 | 111 |
| 280 | 3300041997 | Ga0439431_0014969 | Ga0439431_0014969_710_1045 | 111 |
| 281 | 3300042002 | Ga0439442_019238 | Ga0439442_019238_329_664 | 111 |
| 282 | 3300042011 | Ga0439454_065522 | Ga0439454_065522_219_554 | 111 |
| 283 | 3300042134 | Ga0450898_025533 | Ga0450898_025533_643_978 | 111 |
| 284 | 3300042435 | Ga0439434_0170207 | Ga0439434_0170207_182_517 | 111 |
| 285 | 3300042436 | Ga0439435_0049992 | Ga0439435_0049992_163_498 | 111 |
| 286 | 3300044673 | Ga0453683_0664787 | Ga0453683_0664787_129_464 | 111 |
| 287 | 3300044712 | Ga0453684_0092803 | Ga0453684_0092803_3267_3707 | 111 |
| 288 | 3300044712 | Ga0453684_0147846 | Ga0453684_0147846_34_369 | 111 |
| 289 | 3300044712 | Ga0453684_0258773 | Ga0453684_0258773_658_993 | 111 |
| 290 | 3300044712 | Ga0453684_1237266 | Ga0453684_1237266_124_465 | 111 |
| 291 | 3300044712 | Ga0453684_1847344 | Ga0453684_1847344_213_557 | 111 |
| 292 | 3300046499 | Ga0495594_0176498 | Ga0495594_0176498_526_861 | 111 |
| 293 | 3300046522 | Ga0495643_0129766 | Ga0495643_0129766_733_1068 | 111 |
| 294 | 3300046523 | Ga0495644_0466099 | Ga0495644_0466099_112_447 | 111 |
| 295 | 3300046537 | Ga0495598_0128848 | Ga0495598_0128848_139_474 | 111 |
| 296 | 3300046539 | Ga0495621_0091681 | Ga0495621_0091681_593_928 | 111 |
| 297 | 3300046616 | Ga0495668_0000863 | Ga0495668_0000863_5568_5903 | 111 |
| 298 | 3300046691 | Ga0495670_0292630 | Ga0495670_0292630_126_461 | 111 |
| 299 | 3300046691 | Ga0495670_0526529 | Ga0495670_0526529_255_590 | 111 |
| 300 | 3300046809 | Ga0495600_0417188 | Ga0495600_0417188_245_580 | 111 |
| 301 | 3300047320 | Ga0495672_0069425 | Ga0495672_0069425_518_853 | 111 |
| 302 | 3300047321 | Ga0495676_0996909 | Ga0495676_0996909_95_430 | 111 |
| 303 | 3300047472 | Ga0495686_0021166 | Ga0495686_0021166_173_508 | 111 |
| 304 | 3300047472 | Ga0495686_0028441 | Ga0495686_0028441_1771_2106 | 111 |
| 305 | 3300049569 | Ga0501032_0017004 | Ga0501032_0017004_2873_3208 | 111 |
| 306 | 3300049571 | Ga0501034_0062889 | Ga0501034_0062889_131_466 | 111 |
| 307 | 3300049572 | Ga0501036_0006877 | Ga0501036_0006877_5359_5694 | 111 |
| 308 | 3300049573 | Ga0501037_0059366 | Ga0501037_0059366_815_1150 | 111 |
| 309 | 3300049574 | Ga0501038_0054670 | Ga0501038_0054670_2646_2981 | 111 |
| 310 | 3300049575 | Ga0501039_0041440 | Ga0501039_0041440_2500_2835 | 111 |
| 311 | 3300049579 | Ga0501043_0009419 | Ga0501043_0009419_1835_2170 | 111 |
| 312 | 3300049580 | Ga0501046_0374348 | Ga0501046_0374348_140_475 | 111 |
| 313 | 3300049581 | Ga0501047_0073517 | Ga0501047_0073517_462_797 | 111 |
| 314 | 3300049582 | Ga0501048_0042214 | Ga0501048_0042214_308_643 | 111 |
| 315 | 3300049586 | Ga0501070_0039093 | Ga0501070_0039093_160_495 | 111 |
| 316 | 3300049588 | Ga0501072_0809356 | Ga0501072_0809356_14_349 | 111 |
| 317 | 3300049590 | Ga0501074_0010801 | Ga0501074_0010801_2682_3017 | 111 |
| 318 | 3300049741 | Ga0501079_0135959 | Ga0501079_0135959_433_768 | 111 |
| 319 | 3300049744 | Ga0501083_0014203 | Ga0501083_0014203_2889_3224 | 111 |
| 320 | 3300049822 | Ga0501035_0102294 | Ga0501035_0102294_1481_1816 | 111 |
| 321 | 3300049823 | Ga0501044_0181951 | Ga0501044_0181951_95_430 | 111 |
| 322 | 3300050493 | nmdc:mga0k408_488862_c1 | nmdc:mga0k408_488862_c1_250_585 | 111 |
| 323 | 3300050507 | nmdc:mga05p37_359854_c1 | nmdc:mga05p37_359854_c1_165_500 | 111 |
| 324 | 3300050507 | nmdc:mga05p37_568354_c1 | nmdc:mga05p37_568354_c1_338_673 | 111 |
| 325 | 3300050507 | nmdc:mga05p37_782713_c1 | nmdc:mga05p37_782713_c1_79_414 | 111 |
| 326 | 3300050508 | nmdc:mga09592_81361_c1 | nmdc:mga09592_81361_c1_1624_1959 | 111 |
| 327 | 3300050508 | nmdc:mga09592_823_c1 | nmdc:mga09592_823_c1_17768_18103 | 111 |
| 328 | 3300050509 | nmdc:mga0qj67_257108_c1 | nmdc:mga0qj67_257108_c1_386_721 | 111 |
| 329 | 3300050509 | nmdc:mga0qj67_43430_c1 | nmdc:mga0qj67_43430_c1_2327_2662 | 111 |
| 330 | 3300050510 | nmdc:mga06r32_289786_c1 | nmdc:mga06r32_289786_c1_903_1238 | 111 |
| 331 | 3300050510 | nmdc:mga06r32_316572_c1 | nmdc:mga06r32_316572_c1_521_856 | 111 |
| 332 | 3300050511 | nmdc:mga08y16_1015400_c1 | nmdc:mga08y16_1015400_c1_161_496 | 111 |
| 333 | 3300050511 | nmdc:mga08y16_116351_c1 | nmdc:mga08y16_116351_c1_1395_1730 | 111 |
| 334 | 3300050511 | nmdc:mga08y16_1749003_c1 | nmdc:mga08y16_1749003_c1_83_418 | 111 |
| 335 | 3300053090 | Ga0500646_0115726 | Ga0500646_0115726_401_739 | 111 |
| 336 | 3300053139 | Ga0500568_0070675 | Ga0500568_0070675_217_552 | 111 |
| 337 | 3300054114 | Ga0501084_0138728 | Ga0501084_0138728_861_1196 | 111 |
| 338 | 3300060353 | Ga0501082_0286227 | Ga0501082_0286227_307_642 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.8825 | 3 | 103 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.8662 | 1 | 111 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.8516 | 1 | 111 |
| 4ltu-assembly2.cif.gz_B | crystal structure of ferredoxin from rhodopseudomonas palustris haa2 | 0.8383 | 3 | 105 |
| 1l5p-assembly3.cif.gz_C | crystal structure of trichomonas vaginalis ferredoxin | 0.83 | 3 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8806 | 3 | 103 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8383 | 3 | 105 | 3.10.20.30 |
| 1l5pC00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.83 | 3 | 102 | 3.10.20.30 |
| 3lxfB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8202 | 3 | 102 | 3.10.20.30 |
| 2wlbB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8187 | 3 | 103 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838TPU9-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9627 | 1 | 111 |
GO:0005829
GO:0009055 GO:0051537 GO:0140647 |
| AF-A0A520BWA8-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9593 | 3 | 92 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A3M1YKU4-F1-model_v4 | Ferredoxin | 0.9547 | 1 | 111 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A2G0CF15-F1-model_v4 | Ferredoxin | 0.9514 | 1 | 111 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A4Q5RI28-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.949 | 2 | 106 |
GO:0009055
GO:0051537 GO:0140647 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar