F413298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 234 | 307 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300053158|Ga0500627_0053887|Ga0500627_0053887_505_1575 |
| Length | 356 |
| Sequence | MAARRSVKHFVQFAAFLSGLAERYVVQYCYLQLLVSSDPSKAIFQESSVQKVISAVVALFVVLSSLPAFAQASPPSEASRKAELVAAWQAASAAGAAGPKDVSLIDQAALKLPAGYFFVPQAEGARVLRALGNVVNDTSIVGLVVGTGPNDGWIVVIRYIKEGYIKDDDAKNWNADDLLKNLKDGVEESNKDRVARGFPEMQVIGWVQPPNYDAATHRLVWSLLAKDKDEADNAAKSINYNTYALGRDGYFSLNLLSNSERIAGDKSVAHELLGDLAYNTGKRYEDFSASTDRIAEYGLMALVGGVAAKKLGLFALAAAFVLKFAKIILIGLGVFGAGVLNFFRRKPRSDAADGPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 3 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 4 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 5 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 6 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 7 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 8 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 9 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 10 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 11 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 12 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 13 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 14 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 15 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 16 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 17 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 18 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 19 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 20 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 21 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 22 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 23 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 24 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 155 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 156 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 198 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 199 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 200 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 206 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 207 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 208 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 209 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 210 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 211 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 213 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 214 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 215 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 216 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 217 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 219 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 220 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 222 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 223 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 225 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 226 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 227 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 228 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 229 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 230 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 231 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 232 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 233 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 234 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.1 |
| Metatranscriptomes | 0 |
| Isolates | 8.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.95 |
| Nodule | 5.93 |
| Rhizoplane | 5.34 |
| Rhizosphere | 62.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10036733 | 3300001989 | Bacteria | 1653 |
| 2 | JGI24735J21928_10007772 | 3300002067 | Bacteria | 3486 |
| 3 | JGI25153J46596_10014208 | 3300003215 | Bacteria | 3323 |
| 4 | rootH1_10010499 | 3300003323 | Bacteria | 1784 |
| 5 | JGI25404J52841_10004205 | 3300003659 | Bacteria | 2897 |
| 6 | JGI25404J52841_10025189 | 3300003659 | Bacteria | 1281 |
| 7 | Ga0065165_1002068 | 3300005262 | Bacteria | 18536 |
| 8 | Ga0065704_10175112 | 3300005289 | Unclassified | 1268 |
| 9 | Ga0070658_10093109 | 3300005327 | Bacteria | 2486 |
| 10 | Ga0070676_10073739 | 3300005328 | Bacteria | 2054 |
| 11 | Ga0070690_100030534 | 3300005330 | Bacteria | 3350 |
| 12 | Ga0068869_100065640 | 3300005334 | Bacteria | 2672 |
| 13 | Ga0068869_100077412 | 3300005334 | Bacteria | 2474 |
| 14 | Ga0068868_100036714 | 3300005338 | Bacteria | 3795 |
| 15 | Ga0070660_100236141 | 3300005339 | Bacteria | 1488 |
| 16 | Ga0070661_100144869 | 3300005344 | Unclassified | 1792 |
| 17 | Ga0070692_10000276 | 3300005345 | Bacteria | 14447 |
| 18 | Ga0070692_10216796 | 3300005345 | Bacteria | 1129 |
| 19 | Ga0070668_100064035 | 3300005347 | Bacteria | 2850 |
| 20 | Ga0070668_100533793 | 3300005347 | Eukaryota | 1019 |
| 21 | Ga0070669_100070574 | 3300005353 | Bacteria | 2583 |
| 22 | Ga0070663_100004564 | 3300005455 | Bacteria | 8157 |
| 23 | Ga0070663_100014875 | 3300005455 | Bacteria | 5004 |
| 24 | Ga0070663_100032647 | 3300005455 | Bacteria | 3590 |
| 25 | Ga0070678_100372494 | 3300005456 | Bacteria | 1233 |
| 26 | Ga0068867_100001106 | 3300005459 | Bacteria | 18425 |
| 27 | Ga0068867_100217809 | 3300005459 | Bacteria | 1537 |
| 28 | Ga0068853_100215810 | 3300005539 | Unclassified | 1750 |
| 29 | Ga0068853_100433754 | 3300005539 | Bacteria | 1234 |
| 30 | Ga0070672_100032353 | 3300005543 | Bacteria | 3946 |
| 31 | Ga0070665_100024005 | 3300005548 | Bacteria | 6140 |
| 32 | Ga0070665_100127843 | 3300005548 | Bacteria | 2544 |
| 33 | Ga0070665_100362663 | 3300005548 | Bacteria | 1455 |
| 34 | Ga0068855_100046398 | 3300005563 | Bacteria | 5137 |
| 35 | Ga0070664_100015713 | 3300005564 | Bacteria | 6196 |
| 36 | Ga0070664_100122906 | 3300005564 | Bacteria | 2274 |
| 37 | Ga0068854_100046952 | 3300005578 | Bacteria | 3077 |
| 38 | Ga0068856_100029657 | 3300005614 | Bacteria | 5344 |
| 39 | Ga0070702_100182405 | 3300005615 | Bacteria | 1375 |
| 40 | Ga0068852_100345134 | 3300005616 | Bacteria | 1452 |
| 41 | Ga0068852_100356680 | 3300005616 | Unclassified | 1429 |
| 42 | Ga0068859_100049893 | 3300005617 | Bacteria | 4204 |
| 43 | Ga0068859_100099495 | 3300005617 | Bacteria | 2963 |
| 44 | Ga0068859_100304008 | 3300005617 | Bacteria | 1688 |
| 45 | Ga0068859_100325254 | 3300005617 | Bacteria | 1631 |
| 46 | Ga0068864_100040427 | 3300005618 | Bacteria | 3990 |
| 47 | Ga0068861_100026757 | 3300005719 | Bacteria | 4196 |
| 48 | Ga0068861_100191761 | 3300005719 | Bacteria | 1709 |
| 49 | Ga0068863_100045198 | 3300005841 | Bacteria | 4179 |
| 50 | Ga0068863_100069765 | 3300005841 | Bacteria | 3323 |
| 51 | Ga0068858_100063209 | 3300005842 | Bacteria | 3425 |
| 52 | Ga0068858_100205185 | 3300005842 | Bacteria | 1865 |
| 53 | Ga0068860_100000323 | 3300005843 | Bacteria | 64975 |
| 54 | Ga0068860_100078625 | 3300005843 | Bacteria | 3136 |
| 55 | Ga0068860_100257883 | 3300005843 | Bacteria | 1699 |
| 56 | Ga0068862_100315492 | 3300005844 | Bacteria | 1442 |
| 57 | Ga0081455_10017797 | 3300005937 | Bacteria | 6795 |
| 58 | Ga0081455_10032598 | 3300005937 | Bacteria | 4693 |
| 59 | Ga0081540_1000430 | 3300005983 | Bacteria | 41337 |
| 60 | Ga0081540_1000979 | 3300005983 | Bacteria | 25757 |
| 61 | Ga0081540_1001476 | 3300005983 | Bacteria | 20290 |
| 62 | Ga0081540_1058747 | 3300005983 | Bacteria | 1850 |
| 63 | Ga0081539_10016359 | 3300005985 | Bacteria | 5304 |
| 64 | Ga0075365_10059669 | 3300006038 | Bacteria | 2543 |
| 65 | Ga0075368_10032834 | 3300006042 | Bacteria | 2017 |
| 66 | Ga0075363_100109188 | 3300006048 | Bacteria | 1537 |
| 67 | Ga0075364_10010761 | 3300006051 | Bacteria | 5534 |
| 68 | Ga0075367_10049903 | 3300006178 | Bacteria | 2468 |
| 69 | Ga0075367_10122589 | 3300006178 | Bacteria | 1602 |
| 70 | Ga0075366_10001132 | 3300006195 | Bacteria | 13148 |
| 71 | Ga0075366_10011727 | 3300006195 | Bacteria | 4954 |
| 72 | Ga0075366_10052627 | 3300006195 | Bacteria | 2419 |
| 73 | Ga0075366_10208621 | 3300006195 | Bacteria | 1189 |
| 74 | Ga0097621_100051751 | 3300006237 | Bacteria | 3343 |
| 75 | Ga0075370_10070484 | 3300006353 | Bacteria | 1999 |
| 76 | Ga0075370_10134133 | 3300006353 | Bacteria | 1446 |
| 77 | Ga0075428_100566937 | 3300006844 | Bacteria | 1213 |
| 78 | Ga0075434_100292186 | 3300006871 | Bacteria | 1650 |
| 79 | Ga0068865_100211395 | 3300006881 | Bacteria | 1512 |
| 80 | Ga0097620_100049893 | 3300006931 | Bacteria | 4204 |
| 81 | Ga0097620_100099488 | 3300006931 | Bacteria | 2963 |
| 82 | Ga0097620_100303992 | 3300006931 | Bacteria | 1688 |
| 83 | Ga0097620_100325246 | 3300006931 | Bacteria | 1631 |
| 84 | Ga0075435_100002041 | 3300007076 | Bacteria | 13227 |
| 85 | Ga0105251_10002058 | 3300009011 | Bacteria | 16260 |
| 86 | Ga0105240_10028529 | 3300009093 | Bacteria | 7289 |
| 87 | Ga0105240_10262998 | 3300009093 | Bacteria | 1989 |
| 88 | Ga0105240_10381900 | 3300009093 | Bacteria | 1591 |
| 89 | Ga0105245_10003627 | 3300009098 | Bacteria | 13778 |
| 90 | Ga0105245_10071250 | 3300009098 | Bacteria | 3156 |
| 91 | Ga0105247_10007717 | 3300009101 | Bacteria | 6584 |
| 92 | Ga0105247_10101747 | 3300009101 | Bacteria | 1838 |
| 93 | Ga0105247_10131195 | 3300009101 | Bacteria | 1633 |
| 94 | Ga0105243_10007836 | 3300009148 | Bacteria | 8211 |
| 95 | Ga0105241_10030194 | 3300009174 | Bacteria | 4048 |
| 96 | Ga0105241_10092226 | 3300009174 | Bacteria | 2391 |
| 97 | Ga0105242_10307673 | 3300009176 | Bacteria | 1449 |
| 98 | Ga0105248_10048415 | 3300009177 | Bacteria | 4768 |
| 99 | Ga0105248_10225539 | 3300009177 | Bacteria | 2109 |
| 100 | Ga0105237_10000862 | 3300009545 | Bacteria | 41239 |
| 101 | Ga0105237_10060299 | 3300009545 | Bacteria | 3796 |
| 102 | Ga0105237_10172043 | 3300009545 | Bacteria | 2166 |
| 103 | Ga0105238_10048100 | 3300009551 | Bacteria | 4299 |
| 104 | Ga0105238_10139965 | 3300009551 | Bacteria | 2397 |
| 105 | Ga0105238_10140598 | 3300009551 | Unclassified | 2391 |
| 106 | Ga0105249_10187453 | 3300009553 | Bacteria | 2017 |
| 107 | Ga0105249_10219525 | 3300009553 | Bacteria | 1870 |
| 108 | Ga0105239_10000075 | 3300010375 | Bacteria | 140531 |
| 109 | Ga0105239_10024398 | 3300010375 | Bacteria | 6663 |
| 110 | Ga0105239_10177208 | 3300010375 | Bacteria | 2384 |
| 111 | Ga0105246_10008855 | 3300011119 | Bacteria | 6193 |
| 112 | Ga0105246_10057501 | 3300011119 | Bacteria | 2691 |
| 113 | Ga0157374_10020152 | 3300013296 | Bacteria | 5912 |
| 114 | Ga0157374_10194819 | 3300013296 | Bacteria | 1983 |
| 115 | Ga0157378_10063384 | 3300013297 | Bacteria | 3303 |
| 116 | Ga0163162_10130547 | 3300013306 | Bacteria | 2621 |
| 117 | Ga0157375_10124042 | 3300013308 | Bacteria | 2696 |
| 118 | Ga0163163_10066269 | 3300014325 | Bacteria | 3586 |
| 119 | Ga0157377_10000091 | 3300014745 | Bacteria | 66087 |
| 120 | Ga0157379_10054486 | 3300014968 | Bacteria | 3573 |
| 121 | Ga0157379_10112793 | 3300014968 | Bacteria | 2443 |
| 122 | Ga0157376_10009148 | 3300014969 | Bacteria | 7183 |
| 123 | Ga0209758_1014223 | 3300025297 | Bacteria | 4254 |
| 124 | Ga0209758_1047694 | 3300025297 | Bacteria | 1530 |
| 125 | Ga0207426_1005640 | 3300025302 | Bacteria | 5662 |
| 126 | Ga0207642_10023052 | 3300025899 | Bacteria | 2481 |
| 127 | Ga0207688_10009910 | 3300025901 | Bacteria | 5187 |
| 128 | Ga0207647_10052164 | 3300025904 | Bacteria | 2525 |
| 129 | Ga0207647_10068775 | 3300025904 | Bacteria | 2142 |
| 130 | Ga0207645_10119608 | 3300025907 | Bacteria | 1709 |
| 131 | Ga0207643_10170801 | 3300025908 | Bacteria | 1312 |
| 132 | Ga0207705_10139440 | 3300025909 | Unclassified | 1810 |
| 133 | Ga0207654_10029561 | 3300025911 | Bacteria | 3002 |
| 134 | Ga0207654_10108697 | 3300025911 | Bacteria | 1721 |
| 135 | Ga0207654_10159954 | 3300025911 | Bacteria | 1454 |
| 136 | Ga0207695_10024306 | 3300025913 | Bacteria | 6820 |
| 137 | Ga0207695_10212345 | 3300025913 | Bacteria | 1845 |
| 138 | Ga0207695_10235305 | 3300025913 | Unclassified | 1734 |
| 139 | Ga0207671_10006436 | 3300025914 | Bacteria | 10455 |
| 140 | Ga0207657_10206817 | 3300025919 | Bacteria | 1576 |
| 141 | Ga0207681_10047692 | 3300025923 | Bacteria | 2888 |
| 142 | Ga0207694_10077843 | 3300025924 | Bacteria | 2599 |
| 143 | Ga0207659_10178256 | 3300025926 | Bacteria | 1681 |
| 144 | Ga0207687_10017629 | 3300025927 | Bacteria | 4704 |
| 145 | Ga0207706_10029762 | 3300025933 | Bacteria | 4873 |
| 146 | Ga0207706_10047133 | 3300025933 | Bacteria | 3814 |
| 147 | Ga0207709_10173853 | 3300025935 | Bacteria | 1514 |
| 148 | Ga0207704_10186803 | 3300025938 | Bacteria | 1503 |
| 149 | Ga0207691_10005526 | 3300025940 | Bacteria | 12209 |
| 150 | Ga0207691_10330047 | 3300025940 | Bacteria | 1307 |
| 151 | Ga0207711_10034475 | 3300025941 | Bacteria | 4286 |
| 152 | Ga0207711_10113128 | 3300025941 | Bacteria | 2416 |
| 153 | Ga0207689_10048875 | 3300025942 | Bacteria | 3489 |
| 154 | Ga0207689_10106963 | 3300025942 | Bacteria | 2299 |
| 155 | Ga0207712_10222639 | 3300025961 | Bacteria | 1509 |
| 156 | Ga0207668_10069733 | 3300025972 | Bacteria | 2504 |
| 157 | Ga0207640_10180880 | 3300025981 | Bacteria | 1581 |
| 158 | Ga0207640_10265845 | 3300025981 | Bacteria | 1339 |
| 159 | Ga0207640_10306247 | 3300025981 | Bacteria | 1259 |
| 160 | Ga0207658_10479684 | 3300025986 | Bacteria | 1105 |
| 161 | Ga0207677_10051334 | 3300026023 | Bacteria | 2796 |
| 162 | Ga0207677_10065941 | 3300026023 | Bacteria | 2529 |
| 163 | Ga0207639_10211212 | 3300026041 | Bacteria | 1671 |
| 164 | Ga0207639_10382950 | 3300026041 | Bacteria | 1264 |
| 165 | Ga0207678_10003138 | 3300026067 | Bacteria | 14954 |
| 166 | Ga0207678_10015753 | 3300026067 | Bacteria | 6645 |
| 167 | Ga0207678_10043997 | 3300026067 | Bacteria | 3864 |
| 168 | Ga0207678_10077234 | 3300026067 | Bacteria | 2852 |
| 169 | Ga0207641_10052507 | 3300026088 | Bacteria | 3453 |
| 170 | Ga0207641_10087726 | 3300026088 | Bacteria | 2715 |
| 171 | Ga0207641_10334521 | 3300026088 | Bacteria | 1439 |
| 172 | Ga0207648_10002366 | 3300026089 | Bacteria | 20335 |
| 173 | Ga0207648_10332041 | 3300026089 | Bacteria | 1368 |
| 174 | Ga0207676_10121183 | 3300026095 | Bacteria | 2206 |
| 175 | Ga0207676_10330452 | 3300026095 | Bacteria | 1403 |
| 176 | Ga0207674_10146900 | 3300026116 | Bacteria | 2316 |
| 177 | Ga0207675_100037577 | 3300026118 | Bacteria | 4516 |
| 178 | Ga0207675_100233848 | 3300026118 | Bacteria | 1774 |
| 179 | Ga0207683_10405927 | 3300026121 | Bacteria | 1254 |
| 180 | Ga0207698_10213443 | 3300026142 | Bacteria | 1738 |
| 181 | Ga0207428_10310786 | 3300027907 | Unclassified | 1165 |
| 182 | Ga0268266_10060423 | 3300028379 | Bacteria | 3267 |
| 183 | Ga0268266_10165190 | 3300028379 | Bacteria | 2005 |
| 184 | Ga0268265_10158283 | 3300028380 | Bacteria | 1920 |
| 185 | Ga0268265_10452371 | 3300028380 | Bacteria | 1200 |
| 186 | Ga0268264_10000149 | 3300028381 | Bacteria | 163972 |
| 187 | Ga0268264_10060037 | 3300028381 | Bacteria | 3187 |
| 188 | Ga0268264_10196128 | 3300028381 | Bacteria | 1844 |
| 189 | Ga0307517_10000249 | 3300028786 | Bacteria | 91911 |
| 190 | Ga0307511_10110202 | 3300030521 | Bacteria | 1756 |
| 191 | Ga0265328_10000169 | 3300031239 | Bacteria | 30144 |
| 192 | Ga0265328_10009214 | 3300031239 | Bacteria | 4028 |
| 193 | Ga0265316_10000026 | 3300031344 | Bacteria | 165508 |
| 194 | Ga0307513_10211562 | 3300031456 | Bacteria | 1770 |
| 195 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 196 | Ga0307405_10036597 | 3300031731 | Bacteria | 2942 |
| 197 | Ga0307412_10476251 | 3300031911 | Bacteria | 1034 |
| 198 | Ga0307510_10002529 | 3300033180 | Bacteria | 20856 |
| 199 | Ga0307510_10023638 | 3300033180 | Bacteria | 7120 |
| 200 | Ga0373955_0016821 | 3300035172 | Bacteria | 3606 |
| 201 | Ga0373942_0053740 | 3300035207 | Bacteria | 1136 |
| 202 | Ga0373937_0009243 | 3300036401 | Bacteria | 8556 |
| 203 | Ga0395900_0322925 | 3300037418 | Bacteria | 1523 |
| 204 | Ga0395905_0000110 | 3300037471 | Bacteria | 137078 |
| 205 | Ga0395905_0214280 | 3300037471 | Bacteria | 1804 |
| 206 | Ga0395901_0130177 | 3300038443 | Bacteria | 2644 |
| 207 | Ga0436365_0898899 | 3300039437 | Bacteria | 4001 |
| 208 | Ga0436360_0513617 | 3300039438 | Bacteria | 4457 |
| 209 | Ga0439455_0014685 | 3300042012 | Bacteria | 1791 |
| 210 | Ga0450911_000104 | 3300042115 | Bacteria | 34662 |
| 211 | Ga0466957_0143501 | 3300044842 | Bacteria | 1540 |
| 212 | Ga0495603_0002761 | 3300046455 | Bacteria | 10347 |
| 213 | Ga0495590_0001609 | 3300046457 | Bacteria | 9655 |
| 214 | Ga0495596_0049333 | 3300046500 | Bacteria | 1650 |
| 215 | Ga0495606_0070452 | 3300046507 | Bacteria | 2205 |
| 216 | Ga0495606_0085677 | 3300046507 | Bacteria | 1949 |
| 217 | Ga0495616_0043645 | 3300046513 | Bacteria | 2277 |
| 218 | Ga0495654_0042485 | 3300046530 | Bacteria | 2257 |
| 219 | Ga0495640_0148779 | 3300046533 | Bacteria | 1506 |
| 220 | Ga0495597_0006814 | 3300046542 | Bacteria | 5872 |
| 221 | Ga0495668_0049743 | 3300046616 | Bacteria | 2324 |
| 222 | Ga0495611_0094231 | 3300046648 | Bacteria | 1385 |
| 223 | Ga0495625_0159942 | 3300046660 | Bacteria | 1510 |
| 224 | Ga0495670_0051011 | 3300046691 | Bacteria | 2071 |
| 225 | Ga0495671_0007932 | 3300046692 | Bacteria | 6007 |
| 226 | Ga0495683_0003748 | 3300047323 | Bacteria | 8784 |
| 227 | Ga0495687_030603 | 3300047443 | Bacteria | 2477 |
| 228 | Ga0495686_0032801 | 3300047472 | Bacteria | 3359 |
| 229 | Ga0496100_0037523 | 3300048903 | Bacteria | 3063 |
| 230 | Ga0496101_0000747 | 3300048904 | Bacteria | 19270 |
| 231 | Ga0496101_0091922 | 3300048904 | Bacteria | 2259 |
| 232 | Ga0496102_0011573 | 3300048905 | Bacteria | 7611 |
| 233 | Ga0496102_0179557 | 3300048905 | Bacteria | 1994 |
| 234 | Ga0496103_0023786 | 3300048906 | Bacteria | 3694 |
| 235 | Ga0496104_0149253 | 3300048907 | Bacteria | 2245 |
| 236 | Ga0496105_0204888 | 3300048908 | Bacteria | 1609 |
| 237 | Ga0496106_0002372 | 3300048909 | Bacteria | 14021 |
| 238 | Ga0496106_0110275 | 3300048909 | Bacteria | 2142 |
| 239 | Ga0496107_0030109 | 3300048910 | Bacteria | 3867 |
| 240 | Ga0496107_0078223 | 3300048910 | Bacteria | 2410 |
| 241 | Ga0496107_0213019 | 3300048910 | Bacteria | 1437 |
| 242 | Ga0496109_0061405 | 3300048912 | Bacteria | 3436 |
| 243 | Ga0496110_0030201 | 3300048913 | Bacteria | 4669 |
| 244 | Ga0496111_0003505 | 3300048914 | Bacteria | 9705 |
| 245 | Ga0496112_0075547 | 3300048915 | Bacteria | 3332 |
| 246 | Ga0496113_0050290 | 3300048916 | Bacteria | 3107 |
| 247 | Ga0496116_0003366 | 3300048919 | Bacteria | 15870 |
| 248 | Ga0496118_0037519 | 3300048921 | Bacteria | 3898 |
| 249 | Ga0496118_0112823 | 3300048921 | Bacteria | 1798 |
| 250 | Ga0496119_0088606 | 3300048922 | Bacteria | 1764 |
| 251 | Ga0496121_0000247 | 3300048924 | Bacteria | 114839 |
| 252 | Ga0496121_0003540 | 3300048924 | Bacteria | 22123 |
| 253 | Ga0496121_0010446 | 3300048924 | Bacteria | 10474 |
| 254 | Ga0496121_0029113 | 3300048924 | Bacteria | 5119 |
| 255 | Ga0496121_0034530 | 3300048924 | Bacteria | 4551 |
| 256 | Ga0496121_0045202 | 3300048924 | Bacteria | 3786 |
| 257 | Ga0496121_0075293 | 3300048924 | Bacteria | 2697 |
| 258 | Ga0496122_0014041 | 3300048925 | Bacteria | 7777 |
| 259 | Ga0496124_0009536 | 3300048927 | Bacteria | 9980 |
| 260 | Ga0496124_0112742 | 3300048927 | Bacteria | 2186 |
| 261 | Ga0496125_0002393 | 3300048928 | Bacteria | 24439 |
| 262 | Ga0496125_0008704 | 3300048928 | Bacteria | 10562 |
| 263 | Ga0496125_0041412 | 3300048928 | Bacteria | 3938 |
| 264 | Ga0496125_0046305 | 3300048928 | Bacteria | 3649 |
| 265 | Ga0496125_0203022 | 3300048928 | Bacteria | 1295 |
| 266 | Ga0496126_0012491 | 3300048929 | Bacteria | 8696 |
| 267 | Ga0496126_0067897 | 3300048929 | Bacteria | 3185 |
| 268 | Ga0496126_0139834 | 3300048929 | Bacteria | 2085 |
| 269 | Ga0496126_0168375 | 3300048929 | Bacteria | 1868 |
| 270 | Ga0496126_0200602 | 3300048929 | Bacteria | 1685 |
| 271 | Ga0496126_0273984 | 3300048929 | Bacteria | 1400 |
| 272 | Ga0495678_037999 | 3300049459 | Bacteria | 1952 |
| 273 | Ga0495682_0056413 | 3300049460 | Bacteria | 1424 |
| 274 | Ga0501249_000370 | 3300049679 | Bacteria | 11828 |
| 275 | nmdc:mga0yw44_41853_c1 | 3300050492 | Bacteria | 2729 |
| 276 | nmdc:mga0k408_16850_c1 | 3300050493 | Bacteria | 4062 |
| 277 | nmdc:mga0k408_49787_c1 | 3300050493 | Bacteria | 2425 |
| 278 | nmdc:mga06z11_82532_c1 | 3300050494 | Bacteria | 1728 |
| 279 | nmdc:mga07m45_59504_c1 | 3300050496 | Bacteria | 2161 |
| 280 | nmdc:mga08y16_212021_c1 | 3300050511 | Bacteria | 2006 |
| 281 | nmdc:mga0n895_277271_c1 | 3300050512 | Bacteria | 1700 |
| 282 | nmdc:mga0rr50_8040_c1 | 3300050513 | Bacteria | 6541 |
| 283 | nmdc:mga0sz30_53935_c1 | 3300050516 | Bacteria | 1709 |
| 284 | Ga0500578_0116947 | 3300053086 | Bacteria | 1678 |
| 285 | Ga0500578_0131572 | 3300053086 | Bacteria | 1569 |
| 286 | Ga0500643_026314 | 3300053087 | Bacteria | 1823 |
| 287 | Ga0500647_0069392 | 3300053091 | Bacteria | 1695 |
| 288 | Ga0500640_011050 | 3300053095 | Bacteria | 3668 |
| 289 | Ga0500650_0093955 | 3300053098 | Bacteria | 1404 |
| 290 | Ga0500555_024307 | 3300053103 | Bacteria | 1737 |
| 291 | Ga0500569_002669 | 3300053109 | Bacteria | 3553 |
| 292 | Ga0500572_037149 | 3300053111 | Bacteria | 1394 |
| 293 | Ga0500595_008325 | 3300053119 | Bacteria | 4243 |
| 294 | Ga0500608_016820 | 3300053122 | Bacteria | 3311 |
| 295 | Ga0500617_064525 | 3300053124 | Bacteria | 1616 |
| 296 | Ga0500564_091024 | 3300053138 | Bacteria | 1357 |
| 297 | Ga0500588_0004407 | 3300053146 | Bacteria | 3051 |
| 298 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 299 | Ga0500619_002762 | 3300053154 | Bacteria | 3453 |
| 300 | Ga0500620_054519 | 3300053155 | Bacteria | 1348 |
| 301 | Ga0500622_0069500 | 3300053156 | Bacteria | 1784 |
| 302 | Ga0500627_0053887 | 3300053158 | Bacteria | 1758 |
| 303 | Ga0500638_037204 | 3300053162 | Bacteria | 2361 |
| 304 | Ga0500636_0001005 | 3300053177 | Bacteria | 15085 |
| 305 | Ga0500637_0082296 | 3300053178 | Bacteria | 1860 |
| 306 | Ga0500609_005513 | 3300053731 | Bacteria | 1730 |
| 307 | Ga0500601_000855 | 3300053737 | Bacteria | 3702 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006353 | Ga0075370_10070484 | Ga0075370_100704843 | 232 |
| 2 | 3300048928 | Ga0496125_0002393 | Ga0496125_0002393_11170_12087 | 239 |
| 3 | 3300038443 | Ga0395901_0130177 | Ga0395901_0130177_400_1248 | 247 |
| 4 | 3300025914 | Ga0207671_10006436 | Ga0207671_100064367 | 249 |
| 5 | 3300048924 | Ga0496121_0075293 | Ga0496121_0075293_1205_2224 | 249 |
| 6 | 3300048929 | Ga0496126_0139834 | Ga0496126_0139834_716_1735 | 249 |
| 7 | 3300026067 | Ga0207678_10015753 | Ga0207678_100157534 | 250 |
| 8 | 3300035207 | Ga0373942_0053740 | Ga0373942_0053740_290_1111 | 251 |
| 9 | 3300048915 | Ga0496112_0075547 | Ga0496112_0075547_52_864 | 251 |
| 10 | 3300009174 | Ga0105241_10092226 | Ga0105241_100922261 | 252 |
| 11 | 3300009551 | Ga0105238_10140598 | Ga0105238_101405981 | 252 |
| 12 | 3300048929 | Ga0496126_0273984 | Ga0496126_0273984_248_1177 | 253 |
| 13 | 3300005344 | Ga0070661_100144869 | Ga0070661_1001448692 | 255 |
| 14 | 3300005564 | Ga0070664_100015713 | Ga0070664_1000157132 | 255 |
| 15 | 3300009093 | Ga0105240_10381900 | Ga0105240_103819002 | 255 |
| 16 | 3300025911 | Ga0207654_10029561 | Ga0207654_100295612 | 255 |
| 17 | 3300025924 | Ga0207694_10077843 | Ga0207694_100778433 | 255 |
| 18 | 3300025933 | Ga0207706_10029762 | Ga0207706_100297626 | 255 |
| 19 | 3300026116 | Ga0207674_10146900 | Ga0207674_101469001 | 255 |
| 20 | 3300003659 | JGI25404J52841_10004205 | JGI25404J52841_100042051 | 256 |
| 21 | 3300037418 | Ga0395900_0322925 | Ga0395900_0322925_339_1256 | 256 |
| 22 | 3300037471 | Ga0395905_0000110 | Ga0395905_0000110_75578_76501 | 256 |
| 23 | 3300005455 | Ga0070663_100032647 | Ga0070663_1000326473 | 257 |
| 24 | 3300005539 | Ga0068853_100215810 | Ga0068853_1002158102 | 257 |
| 25 | 3300025913 | Ga0207695_10235305 | Ga0207695_102353051 | 257 |
| 26 | 3300006195 | Ga0075366_10052627 | Ga0075366_100526272 | 258 |
| 27 | 3300050493 | nmdc:mga0k408_49787_c1 | nmdc:mga0k408_49787_c1_1050_1943 | 258 |
| 28 | 3300031239 | Ga0265328_10009214 | Ga0265328_100092143 | 259 |
| 29 | 3300031911 | Ga0307412_10476251 | Ga0307412_104762511 | 259 |
| 30 | 3300053098 | Ga0500650_0093955 | Ga0500650_0093955_352_1251 | 259 |
| 31 | 3300005330 | Ga0070690_100030534 | Ga0070690_1000305342 | 260 |
| 32 | 3300009098 | Ga0105245_10003627 | Ga0105245_100036276 | 260 |
| 33 | 3300011119 | Ga0105246_10057501 | Ga0105246_100575012 | 260 |
| 34 | 3300026023 | Ga0207677_10051334 | Ga0207677_100513341 | 260 |
| 35 | 3300005347 | Ga0070668_100533793 | Ga0070668_1005337931 | 261 |
| 36 | 3300006195 | Ga0075366_10001132 | Ga0075366_100011328 | 261 |
| 37 | 3300025913 | Ga0207695_10024306 | Ga0207695_100243063 | 261 |
| 38 | 3300025986 | Ga0207658_10479684 | Ga0207658_104796841 | 261 |
| 39 | 3300027907 | Ga0207428_10310786 | Ga0207428_103107861 | 261 |
| 40 | 3300048928 | Ga0496125_0203022 | Ga0496125_0203022_172_1089 | 261 |
| 41 | 3300050511 | nmdc:mga08y16_212021_c1 | nmdc:mga08y16_212021_c1_850_1785 | 261 |
| 42 | 3300031239 | Ga0265328_10000169 | Ga0265328_100001693 | 262 |
| 43 | 3300039438 | Ga0436360_0513617 | Ga0436360_0513617_2991_3929 | 262 |
| 44 | 3300053124 | Ga0500617_064525 | Ga0500617_064525_208_1188 | 262 |
| 45 | 3300005289 | Ga0065704_10175112 | Ga0065704_101751122 | 263 |
| 46 | 3300005328 | Ga0070676_10073739 | Ga0070676_100737392 | 263 |
| 47 | 3300005347 | Ga0070668_100064035 | Ga0070668_1000640352 | 263 |
| 48 | 3300005353 | Ga0070669_100070574 | Ga0070669_1000705742 | 263 |
| 49 | 3300005459 | Ga0068867_100217809 | Ga0068867_1002178091 | 263 |
| 50 | 3300005548 | Ga0070665_100127843 | Ga0070665_1001278432 | 263 |
| 51 | 3300005843 | Ga0068860_100257883 | Ga0068860_1002578832 | 263 |
| 52 | 3300005983 | Ga0081540_1001476 | Ga0081540_100147611 | 263 |
| 53 | 3300006195 | Ga0075366_10208621 | Ga0075366_102086212 | 263 |
| 54 | 3300006353 | Ga0075370_10134133 | Ga0075370_101341333 | 263 |
| 55 | 3300009176 | Ga0105242_10307673 | Ga0105242_103076731 | 263 |
| 56 | 3300009553 | Ga0105249_10187453 | Ga0105249_101874532 | 263 |
| 57 | 3300025907 | Ga0207645_10119608 | Ga0207645_101196082 | 263 |
| 58 | 3300025923 | Ga0207681_10047692 | Ga0207681_100476923 | 263 |
| 59 | 3300025972 | Ga0207668_10069733 | Ga0207668_100697332 | 263 |
| 60 | 3300025981 | Ga0207640_10306247 | Ga0207640_103062472 | 263 |
| 61 | 3300026089 | Ga0207648_10332041 | Ga0207648_103320412 | 263 |
| 62 | 3300028379 | Ga0268266_10165190 | Ga0268266_101651902 | 263 |
| 63 | 3300028380 | Ga0268265_10452371 | Ga0268265_104523711 | 263 |
| 64 | 3300042012 | Ga0439455_0014685 | Ga0439455_0014685_595_1506 | 263 |
| 65 | 3300046660 | Ga0495625_0159942 | Ga0495625_0159942_283_1194 | 263 |
| 66 | 3300048928 | Ga0496125_0046305 | Ga0496125_0046305_1194_2111 | 263 |
| 67 | 3300031344 | Ga0265316_10000026 | Ga0265316_1000002675 | 264 |
| 68 | 3300007076 | Ga0075435_100002041 | Ga0075435_10000204116 | 265 |
| 69 | 3300048928 | Ga0496125_0008704 | Ga0496125_0008704_9550_10455 | 265 |
| 70 | 3300053146 | Ga0500588_0004407 | Ga0500588_0004407_290_1177 | 265 |
| 71 | 3300053731 | Ga0500609_005513 | Ga0500609_005513_66_953 | 265 |
| 72 | 3300005617 | Ga0068859_100099495 | Ga0068859_1000994952 | 266 |
| 73 | 3300005842 | Ga0068858_100205185 | Ga0068858_1002051852 | 266 |
| 74 | 3300006931 | Ga0097620_100099488 | Ga0097620_1000994883 | 266 |
| 75 | 3300009101 | Ga0105247_10007717 | Ga0105247_100077174 | 266 |
| 76 | 3300009545 | Ga0105237_10172043 | Ga0105237_101720432 | 266 |
| 77 | 3300010375 | Ga0105239_10177208 | Ga0105239_101772082 | 266 |
| 78 | 3300036401 | Ga0373937_0009243 | Ga0373937_0009243_6794_7708 | 266 |
| 79 | 3300046533 | Ga0495640_0148779 | Ga0495640_0148779_189_1103 | 266 |
| 80 | 3300048922 | Ga0496119_0088606 | Ga0496119_0088606_821_1729 | 266 |
| 81 | 3300050513 | nmdc:mga0rr50_8040_c1 | nmdc:mga0rr50_8040_c1_1178_2122 | 266 |
| 82 | 3300053086 | Ga0500578_0131572 | Ga0500578_0131572_361_1341 | 266 |
| 83 | iso_pu_bacteria | 2858950400 | 2858955667 | 266 |
| 84 | 3300005616 | Ga0068852_100356680 | Ga0068852_1003566801 | 267 |
| 85 | 3300005841 | Ga0068863_100069765 | Ga0068863_1000697652 | 267 |
| 86 | 3300005843 | Ga0068860_100078625 | Ga0068860_1000786252 | 267 |
| 87 | 3300026088 | Ga0207641_10052507 | Ga0207641_100525072 | 267 |
| 88 | 3300028381 | Ga0268264_10060037 | Ga0268264_100600372 | 267 |
| 89 | 3300035172 | Ga0373955_0016821 | Ga0373955_0016821_650_1594 | 267 |
| 90 | 3300042115 | Ga0450911_000104 | Ga0450911_000104_29458_30363 | 267 |
| 91 | 3300044842 | Ga0466957_0143501 | Ga0466957_0143501_383_1312 | 267 |
| 92 | 3300053086 | Ga0500578_0116947 | Ga0500578_0116947_413_1342 | 267 |
| 93 | 3300039437 | Ga0436365_0898899 | Ga0436365_0898899_672_1604 | 268 |
| 94 | 3300048927 | Ga0496124_0112742 | Ga0496124_0112742_774_1679 | 268 |
| 95 | 3300048929 | Ga0496126_0067897 | Ga0496126_0067897_1888_2793 | 268 |
| 96 | 3300005345 | Ga0070692_10000276 | Ga0070692_1000027611 | 269 |
| 97 | 3300005455 | Ga0070663_100004564 | Ga0070663_1000045646 | 269 |
| 98 | 3300005459 | Ga0068867_100001106 | Ga0068867_10000110613 | 269 |
| 99 | 3300005578 | Ga0068854_100046952 | Ga0068854_1000469522 | 269 |
| 100 | 3300009093 | Ga0105240_10028529 | Ga0105240_100285298 | 269 |
| 101 | 3300009148 | Ga0105243_10007836 | Ga0105243_100078369 | 269 |
| 102 | 3300009545 | Ga0105237_10000862 | Ga0105237_100008624 | 269 |
| 103 | 3300010375 | Ga0105239_10000075 | Ga0105239_10000075112 | 269 |
| 104 | 3300014745 | Ga0157377_10000091 | Ga0157377_1000009136 | 269 |
| 105 | 3300025935 | Ga0207709_10173853 | Ga0207709_101738531 | 269 |
| 106 | 3300025981 | Ga0207640_10180880 | Ga0207640_101808802 | 269 |
| 107 | 3300026067 | Ga0207678_10003138 | Ga0207678_100031383 | 269 |
| 108 | 3300026089 | Ga0207648_10002366 | Ga0207648_1000236615 | 269 |
| 109 | 3300046692 | Ga0495671_0007932 | Ga0495671_0007932_1797_2711 | 269 |
| 110 | 3300048924 | Ga0496121_0000247 | Ga0496121_0000247_5747_6661 | 269 |
| 111 | 3300048929 | Ga0496126_0012491 | Ga0496126_0012491_3046_3960 | 269 |
| 112 | 3300048929 | Ga0496126_0200602 | Ga0496126_0200602_427_1356 | 269 |
| 113 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1487937_1488872 | 269 |
| 114 | iso_pu_bacteria | 8019565922 | 8019568768 | 269 |
| 115 | 3300005543 | Ga0070672_100032353 | Ga0070672_1000323531 | 270 |
| 116 | 3300025940 | Ga0207691_10005526 | Ga0207691_100055262 | 270 |
| 117 | 3300026041 | Ga0207639_10211212 | Ga0207639_102112122 | 270 |
| 118 | 3300037471 | Ga0395905_0214280 | Ga0395905_0214280_496_1419 | 270 |
| 119 | 3300049679 | Ga0501249_000370 | Ga0501249_000370_7934_8983 | 270 |
| 120 | 3300003215 | JGI25153J46596_10014208 | JGI25153J46596_100142084 | 271 |
| 121 | 3300003659 | JGI25404J52841_10025189 | JGI25404J52841_100251891 | 271 |
| 122 | 3300005334 | Ga0068869_100065640 | Ga0068869_1000656402 | 271 |
| 123 | 3300005334 | Ga0068869_100077412 | Ga0068869_1000774122 | 271 |
| 124 | 3300005338 | Ga0068868_100036714 | Ga0068868_1000367142 | 271 |
| 125 | 3300005339 | Ga0070660_100236141 | Ga0070660_1002361412 | 271 |
| 126 | 3300005345 | Ga0070692_10216796 | Ga0070692_102167961 | 271 |
| 127 | 3300005455 | Ga0070663_100014875 | Ga0070663_1000148753 | 271 |
| 128 | 3300005539 | Ga0068853_100433754 | Ga0068853_1004337541 | 271 |
| 129 | 3300005548 | Ga0070665_100024005 | Ga0070665_1000240052 | 271 |
| 130 | 3300005563 | Ga0068855_100046398 | Ga0068855_1000463984 | 271 |
| 131 | 3300005564 | Ga0070664_100122906 | Ga0070664_1001229062 | 271 |
| 132 | 3300005614 | Ga0068856_100029657 | Ga0068856_1000296575 | 271 |
| 133 | 3300005615 | Ga0070702_100182405 | Ga0070702_1001824052 | 271 |
| 134 | 3300005616 | Ga0068852_100345134 | Ga0068852_1003451342 | 271 |
| 135 | 3300005617 | Ga0068859_100049893 | Ga0068859_1000498934 | 271 |
| 136 | 3300005617 | Ga0068859_100304008 | Ga0068859_1003040081 | 271 |
| 137 | 3300005617 | Ga0068859_100325254 | Ga0068859_1003252541 | 271 |
| 138 | 3300005618 | Ga0068864_100040427 | Ga0068864_1000404273 | 271 |
| 139 | 3300005719 | Ga0068861_100026757 | Ga0068861_1000267573 | 271 |
| 140 | 3300005719 | Ga0068861_100191761 | Ga0068861_1001917613 | 271 |
| 141 | 3300005841 | Ga0068863_100045198 | Ga0068863_1000451984 | 271 |
| 142 | 3300005842 | Ga0068858_100063209 | Ga0068858_1000632092 | 271 |
| 143 | 3300005843 | Ga0068860_100000323 | Ga0068860_10000032318 | 271 |
| 144 | 3300005844 | Ga0068862_100315492 | Ga0068862_1003154922 | 271 |
| 145 | 3300005937 | Ga0081455_10017797 | Ga0081455_100177977 | 271 |
| 146 | 3300005937 | Ga0081455_10032598 | Ga0081455_100325985 | 271 |
| 147 | 3300005983 | Ga0081540_1000430 | Ga0081540_100043024 | 271 |
| 148 | 3300005983 | Ga0081540_1000979 | Ga0081540_100097914 | 271 |
| 149 | 3300005983 | Ga0081540_1058747 | Ga0081540_10587473 | 271 |
| 150 | 3300006038 | Ga0075365_10059669 | Ga0075365_100596693 | 271 |
| 151 | 3300006042 | Ga0075368_10032834 | Ga0075368_100328341 | 271 |
| 152 | 3300006048 | Ga0075363_100109188 | Ga0075363_1001091882 | 271 |
| 153 | 3300006051 | Ga0075364_10010761 | Ga0075364_100107612 | 271 |
| 154 | 3300006178 | Ga0075367_10049903 | Ga0075367_100499033 | 271 |
| 155 | 3300006178 | Ga0075367_10122589 | Ga0075367_101225892 | 271 |
| 156 | 3300006195 | Ga0075366_10011727 | Ga0075366_100117276 | 271 |
| 157 | 3300006237 | Ga0097621_100051751 | Ga0097621_1000517514 | 271 |
| 158 | 3300006844 | Ga0075428_100566937 | Ga0075428_1005669371 | 271 |
| 159 | 3300006871 | Ga0075434_100292186 | Ga0075434_1002921862 | 271 |
| 160 | 3300006881 | Ga0068865_100211395 | Ga0068865_1002113952 | 271 |
| 161 | 3300006931 | Ga0097620_100049893 | Ga0097620_1000498934 | 271 |
| 162 | 3300006931 | Ga0097620_100303992 | Ga0097620_1003039921 | 271 |
| 163 | 3300006931 | Ga0097620_100325246 | Ga0097620_1003252462 | 271 |
| 164 | 3300009093 | Ga0105240_10262998 | Ga0105240_102629982 | 271 |
| 165 | 3300009098 | Ga0105245_10071250 | Ga0105245_100712503 | 271 |
| 166 | 3300009101 | Ga0105247_10101747 | Ga0105247_101017472 | 271 |
| 167 | 3300009174 | Ga0105241_10030194 | Ga0105241_100301944 | 271 |
| 168 | 3300009177 | Ga0105248_10048415 | Ga0105248_100484154 | 271 |
| 169 | 3300009177 | Ga0105248_10225539 | Ga0105248_102255392 | 271 |
| 170 | 3300009545 | Ga0105237_10060299 | Ga0105237_100602993 | 271 |
| 171 | 3300009551 | Ga0105238_10048100 | Ga0105238_100481002 | 271 |
| 172 | 3300009553 | Ga0105249_10219525 | Ga0105249_102195251 | 271 |
| 173 | 3300010375 | Ga0105239_10024398 | Ga0105239_100243987 | 271 |
| 174 | 3300011119 | Ga0105246_10008855 | Ga0105246_100088555 | 271 |
| 175 | 3300013296 | Ga0157374_10194819 | Ga0157374_101948192 | 271 |
| 176 | 3300013297 | Ga0157378_10063384 | Ga0157378_100633844 | 271 |
| 177 | 3300013308 | Ga0157375_10124042 | Ga0157375_101240423 | 271 |
| 178 | 3300014325 | Ga0163163_10066269 | Ga0163163_100662693 | 271 |
| 179 | 3300014968 | Ga0157379_10054486 | Ga0157379_100544863 | 271 |
| 180 | 3300014968 | Ga0157379_10112793 | Ga0157379_101127933 | 271 |
| 181 | 3300014969 | Ga0157376_10009148 | Ga0157376_100091488 | 271 |
| 182 | 3300025297 | Ga0209758_1014223 | Ga0209758_10142232 | 271 |
| 183 | 3300025297 | Ga0209758_1047694 | Ga0209758_10476942 | 271 |
| 184 | 3300025899 | Ga0207642_10023052 | Ga0207642_100230523 | 271 |
| 185 | 3300025901 | Ga0207688_10009910 | Ga0207688_100099104 | 271 |
| 186 | 3300025904 | Ga0207647_10052164 | Ga0207647_100521642 | 271 |
| 187 | 3300025908 | Ga0207643_10170801 | Ga0207643_101708011 | 271 |
| 188 | 3300025911 | Ga0207654_10108697 | Ga0207654_101086972 | 271 |
| 189 | 3300025913 | Ga0207695_10212345 | Ga0207695_102123452 | 271 |
| 190 | 3300025919 | Ga0207657_10206817 | Ga0207657_102068173 | 271 |
| 191 | 3300025926 | Ga0207659_10178256 | Ga0207659_101782562 | 271 |
| 192 | 3300025927 | Ga0207687_10017629 | Ga0207687_100176294 | 271 |
| 193 | 3300025933 | Ga0207706_10047133 | Ga0207706_100471333 | 271 |
| 194 | 3300025938 | Ga0207704_10186803 | Ga0207704_101868032 | 271 |
| 195 | 3300025940 | Ga0207691_10330047 | Ga0207691_103300472 | 271 |
| 196 | 3300025941 | Ga0207711_10034475 | Ga0207711_100344754 | 271 |
| 197 | 3300025941 | Ga0207711_10113128 | Ga0207711_101131284 | 271 |
| 198 | 3300025942 | Ga0207689_10048875 | Ga0207689_100488753 | 271 |
| 199 | 3300025942 | Ga0207689_10106963 | Ga0207689_101069633 | 271 |
| 200 | 3300025961 | Ga0207712_10222639 | Ga0207712_102226392 | 271 |
| 201 | 3300025981 | Ga0207640_10265845 | Ga0207640_102658452 | 271 |
| 202 | 3300026023 | Ga0207677_10065941 | Ga0207677_100659411 | 271 |
| 203 | 3300026041 | Ga0207639_10382950 | Ga0207639_103829502 | 271 |
| 204 | 3300026067 | Ga0207678_10043997 | Ga0207678_100439974 | 271 |
| 205 | 3300026088 | Ga0207641_10087726 | Ga0207641_100877261 | 271 |
| 206 | 3300026088 | Ga0207641_10334521 | Ga0207641_103345211 | 271 |
| 207 | 3300026095 | Ga0207676_10121183 | Ga0207676_101211832 | 271 |
| 208 | 3300026095 | Ga0207676_10330452 | Ga0207676_103304521 | 271 |
| 209 | 3300026118 | Ga0207675_100037577 | Ga0207675_1000375774 | 271 |
| 210 | 3300026118 | Ga0207675_100233848 | Ga0207675_1002338482 | 271 |
| 211 | 3300026142 | Ga0207698_10213443 | Ga0207698_102134432 | 271 |
| 212 | 3300028379 | Ga0268266_10060423 | Ga0268266_100604233 | 271 |
| 213 | 3300028380 | Ga0268265_10158283 | Ga0268265_101582831 | 271 |
| 214 | 3300028381 | Ga0268264_10000149 | Ga0268264_1000014987 | 271 |
| 215 | 3300028381 | Ga0268264_10196128 | Ga0268264_101961282 | 271 |
| 216 | 3300030521 | Ga0307511_10110202 | Ga0307511_101102021 | 271 |
| 217 | 3300031456 | Ga0307513_10211562 | Ga0307513_102115621 | 271 |
| 218 | 3300031616 | Ga0307508_10000009 | Ga0307508_1000000952 | 271 |
| 219 | 3300031731 | Ga0307405_10036597 | Ga0307405_100365974 | 271 |
| 220 | 3300033180 | Ga0307510_10002529 | Ga0307510_1000252916 | 271 |
| 221 | 3300046455 | Ga0495603_0002761 | Ga0495603_0002761_3038_3964 | 271 |
| 222 | 3300046500 | Ga0495596_0049333 | Ga0495596_0049333_49_1029 | 271 |
| 223 | 3300046513 | Ga0495616_0043645 | Ga0495616_0043645_1106_2023 | 271 |
| 224 | 3300046530 | Ga0495654_0042485 | Ga0495654_0042485_1135_2061 | 271 |
| 225 | 3300046616 | Ga0495668_0049743 | Ga0495668_0049743_163_1080 | 271 |
| 226 | 3300046648 | Ga0495611_0094231 | Ga0495611_0094231_349_1275 | 271 |
| 227 | 3300046691 | Ga0495670_0051011 | Ga0495670_0051011_903_1820 | 271 |
| 228 | 3300048904 | Ga0496101_0091922 | Ga0496101_0091922_292_1209 | 271 |
| 229 | 3300048905 | Ga0496102_0179557 | Ga0496102_0179557_95_1012 | 271 |
| 230 | 3300048909 | Ga0496106_0110275 | Ga0496106_0110275_559_1476 | 271 |
| 231 | 3300048910 | Ga0496107_0078223 | Ga0496107_0078223_963_1880 | 271 |
| 232 | 3300048924 | Ga0496121_0010446 | Ga0496121_0010446_7407_8312 | 271 |
| 233 | 3300048924 | Ga0496121_0034530 | Ga0496121_0034530_648_1628 | 271 |
| 234 | 3300048924 | Ga0496121_0045202 | Ga0496121_0045202_1633_2559 | 271 |
| 235 | 3300048929 | Ga0496126_0168375 | Ga0496126_0168375_558_1538 | 271 |
| 236 | 3300050492 | nmdc:mga0yw44_41853_c1 | nmdc:mga0yw44_41853_c1_1519_2436 | 271 |
| 237 | 3300050493 | nmdc:mga0k408_16850_c1 | nmdc:mga0k408_16850_c1_275_1192 | 271 |
| 238 | 3300050494 | nmdc:mga06z11_82532_c1 | nmdc:mga06z11_82532_c1_509_1426 | 271 |
| 239 | 3300050496 | nmdc:mga07m45_59504_c1 | nmdc:mga07m45_59504_c1_908_1888 | 271 |
| 240 | 3300050512 | nmdc:mga0n895_277271_c1 | nmdc:mga0n895_277271_c1_79_996 | 271 |
| 241 | 3300050516 | nmdc:mga0sz30_53935_c1 | nmdc:mga0sz30_53935_c1_601_1518 | 271 |
| 242 | 3300053087 | Ga0500643_026314 | Ga0500643_026314_246_1172 | 271 |
| 243 | 3300053103 | Ga0500555_024307 | Ga0500555_024307_410_1390 | 271 |
| 244 | 3300053156 | Ga0500622_0069500 | Ga0500622_0069500_485_1465 | 271 |
| 245 | 3300053158 | Ga0500627_0053887 | Ga0500627_0053887_505_1575 | 271 |
| 246 | iso_pu_bacteria | 2876808645 | 2876809938 | 271 |
| 247 | iso_pu_bacteria | 2879110137 | 2879110231 | 271 |
| 248 | iso_pu_bacteria | 8006984368 | 8006986604 | 271 |
| 249 | 3300003323 | rootH1_10010499 | rootH1_100104992 | 272 |
| 250 | 3300005262 | Ga0065165_1002068 | Ga0065165_100206816 | 272 |
| 251 | 3300005985 | Ga0081539_10016359 | Ga0081539_100163597 | 272 |
| 252 | 3300028786 | Ga0307517_10000249 | Ga0307517_1000024985 | 272 |
| 253 | 3300033180 | Ga0307510_10023638 | Ga0307510_100236382 | 272 |
| 254 | 3300046507 | Ga0495606_0085677 | Ga0495606_0085677_846_1799 | 272 |
| 255 | 3300047443 | Ga0495687_030603 | Ga0495687_030603_411_1340 | 272 |
| 256 | 3300047472 | Ga0495686_0032801 | Ga0495686_0032801_359_1288 | 272 |
| 257 | 3300048910 | Ga0496107_0213019 | Ga0496107_0213019_206_1135 | 272 |
| 258 | 3300048924 | Ga0496121_0029113 | Ga0496121_0029113_3005_3934 | 272 |
| 259 | 3300049460 | Ga0495682_0056413 | Ga0495682_0056413_379_1332 | 272 |
| 260 | 3300053091 | Ga0500647_0069392 | Ga0500647_0069392_620_1549 | 272 |
| 261 | 3300053095 | Ga0500640_011050 | Ga0500640_011050_2640_3569 | 272 |
| 262 | 3300053109 | Ga0500569_002669 | Ga0500569_002669_1403_2332 | 272 |
| 263 | 3300053111 | Ga0500572_037149 | Ga0500572_037149_425_1354 | 272 |
| 264 | 3300053119 | Ga0500595_008325 | Ga0500595_008325_3038_3967 | 272 |
| 265 | 3300053122 | Ga0500608_016820 | Ga0500608_016820_1029_1958 | 272 |
| 266 | 3300053138 | Ga0500564_091024 | Ga0500564_091024_325_1254 | 272 |
| 267 | 3300053154 | Ga0500619_002762 | Ga0500619_002762_1953_2882 | 272 |
| 268 | 3300053155 | Ga0500620_054519 | Ga0500620_054519_300_1229 | 272 |
| 269 | 3300053162 | Ga0500638_037204 | Ga0500638_037204_1265_2194 | 272 |
| 270 | 3300053177 | Ga0500636_0001005 | Ga0500636_0001005_7762_8691 | 272 |
| 271 | 3300053178 | Ga0500637_0082296 | Ga0500637_0082296_813_1742 | 272 |
| 272 | 3300053737 | Ga0500601_000855 | Ga0500601_000855_777_1706 | 272 |
| 273 | iso_pu_bacteria | 2511231028 | 2511400958 | 272 |
| 274 | iso_pu_bacteria | 2517093001 | 2517105658 | 272 |
| 275 | iso_pu_bacteria | 2824704595 | 2824709625 | 272 |
| 276 | iso_pu_bacteria | 2824753945 | 2824755358 | 272 |
| 277 | iso_pu_bacteria | 2824763712 | 2824771133 | 272 |
| 278 | iso_pu_bacteria | 2841957949 | 2841959192 | 272 |
| 279 | iso_pu_bacteria | 2876761206 | 2876769520 | 272 |
| 280 | iso_pu_bacteria | 2904690495 | 2904694657 | 272 |
| 281 | iso_pu_bacteria | 2904711408 | 2904718776 | 272 |
| 282 | iso_pu_bacteria | 2908756301 | 2908760207 | 272 |
| 283 | iso_pu_bacteria | 2935675223 | 2935683718 | 272 |
| 284 | iso_pu_bacteria | 2935684952 | 2935691983 | 272 |
| 285 | iso_pu_bacteria | 2935713505 | 2935721822 | 272 |
| 286 | iso_pu_bacteria | 2935722832 | 2935731180 | 272 |
| 287 | iso_pu_bacteria | 2935732158 | 2935738958 | 272 |
| 288 | iso_pu_bacteria | 2935741537 | 2935747857 | 272 |
| 289 | iso_pu_bacteria | 2935750917 | 2935756441 | 272 |
| 290 | iso_pu_bacteria | 2935760218 | 2935761577 | 272 |
| 291 | iso_pu_bacteria | 2935810662 | 2935812107 | 272 |
| 292 | iso_pu_bacteria | 2936037263 | 2936038701 | 272 |
| 293 | iso_pu_bacteria | 2940556831 | 2940562355 | 272 |
| 294 | iso_pu_bacteria | 8006933436 | 8006940469 | 272 |
| 295 | iso_pu_bacteria | 8006973647 | 8006980158 | 272 |
| 296 | iso_pu_bacteria | 8019555841 | 8019556541 | 272 |
| 297 | 3300048921 | Ga0496118_0037519 | Ga0496118_0037519_1227_2171 | 274 |
| 298 | 3300048928 | Ga0496125_0041412 | Ga0496125_0041412_2086_3030 | 274 |
| 299 | iso_pu_bacteria | 8057101203 | 8057104565 | 274 |
| 300 | 3300001989 | JGI24739J22299_10036733 | JGI24739J22299_100367332 | 278 |
| 301 | 3300002067 | JGI24735J21928_10007772 | JGI24735J21928_100077724 | 278 |
| 302 | 3300005327 | Ga0070658_10093109 | Ga0070658_100931092 | 278 |
| 303 | 3300005456 | Ga0070678_100372494 | Ga0070678_1003724941 | 278 |
| 304 | 3300005548 | Ga0070665_100362663 | Ga0070665_1003626631 | 278 |
| 305 | 3300009011 | Ga0105251_10002058 | Ga0105251_100020585 | 278 |
| 306 | 3300009101 | Ga0105247_10131195 | Ga0105247_101311951 | 278 |
| 307 | 3300009551 | Ga0105238_10139965 | Ga0105238_101399652 | 278 |
| 308 | 3300013296 | Ga0157374_10020152 | Ga0157374_100201526 | 278 |
| 309 | 3300013306 | Ga0163162_10130547 | Ga0163162_101305472 | 278 |
| 310 | 3300025302 | Ga0207426_1005640 | Ga0207426_10056403 | 278 |
| 311 | 3300025904 | Ga0207647_10068775 | Ga0207647_100687752 | 278 |
| 312 | 3300025909 | Ga0207705_10139440 | Ga0207705_101394401 | 278 |
| 313 | 3300025911 | Ga0207654_10159954 | Ga0207654_101599541 | 278 |
| 314 | 3300026067 | Ga0207678_10077234 | Ga0207678_100772342 | 278 |
| 315 | 3300026121 | Ga0207683_10405927 | Ga0207683_104059271 | 278 |
| 316 | 3300046457 | Ga0495590_0001609 | Ga0495590_0001609_2348_3283 | 278 |
| 317 | 3300046507 | Ga0495606_0070452 | Ga0495606_0070452_1143_2078 | 278 |
| 318 | 3300046542 | Ga0495597_0006814 | Ga0495597_0006814_4413_5348 | 278 |
| 319 | 3300047323 | Ga0495683_0003748 | Ga0495683_0003748_5713_6648 | 278 |
| 320 | 3300048903 | Ga0496100_0037523 | Ga0496100_0037523_250_1185 | 278 |
| 321 | 3300048904 | Ga0496101_0000747 | Ga0496101_0000747_4538_5473 | 278 |
| 322 | 3300048905 | Ga0496102_0011573 | Ga0496102_0011573_769_1704 | 278 |
| 323 | 3300048906 | Ga0496103_0023786 | Ga0496103_0023786_478_1413 | 278 |
| 324 | 3300048907 | Ga0496104_0149253 | Ga0496104_0149253_698_1633 | 278 |
| 325 | 3300048908 | Ga0496105_0204888 | Ga0496105_0204888_355_1290 | 278 |
| 326 | 3300048909 | Ga0496106_0002372 | Ga0496106_0002372_2307_3242 | 278 |
| 327 | 3300048910 | Ga0496107_0030109 | Ga0496107_0030109_2276_3211 | 278 |
| 328 | 3300048912 | Ga0496109_0061405 | Ga0496109_0061405_1256_2191 | 278 |
| 329 | 3300048913 | Ga0496110_0030201 | Ga0496110_0030201_1552_2487 | 278 |
| 330 | 3300048914 | Ga0496111_0003505 | Ga0496111_0003505_6537_7472 | 278 |
| 331 | 3300048916 | Ga0496113_0050290 | Ga0496113_0050290_1393_2328 | 278 |
| 332 | 3300048919 | Ga0496116_0003366 | Ga0496116_0003366_2197_3132 | 278 |
| 333 | 3300048921 | Ga0496118_0112823 | Ga0496118_0112823_24_959 | 278 |
| 334 | 3300048924 | Ga0496121_0003540 | Ga0496121_0003540_2290_3225 | 278 |
| 335 | 3300048925 | Ga0496122_0014041 | Ga0496122_0014041_4639_5574 | 278 |
| 336 | 3300048927 | Ga0496124_0009536 | Ga0496124_0009536_1646_2581 | 278 |
| 337 | 3300049459 | Ga0495678_037999 | Ga0495678_037999_563_1498 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7onx-assembly1.cif.gz_A | crystal structure of pbp3 from p. aeruginosa | 0.6398 | 152 | 197 |
| 7rcz-assembly1.cif.gz_A | crystal structure of c. difficile spovd in complex with ampicillin | 0.6264 | 150 | 196 |
| 5tsh-assembly1.cif.gz_E | pilb from geobacter metallireducens bound to amp-pnp | 0.6153 | 156 | 200 |
| 7kiv-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa pbp3 in complex with avibactam | 0.6099 | 152 | 212 |
| 4n7s-assembly2.cif.gz_D | crystal structure of tse3-tsi3 complex with zinc ion | 0.6042 | 41 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0I2J7_57_237_2.40.128.20 | Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain | 0.6857 | 137 | 182 | 2.40.128.20 |
| af_P32074_820_932_3.30.310.10 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein | 0.6429 | 91 | 197 | 3.30.310.10 |
| af_A0A0R0EKI7_78_225_3.40.1000.10 | Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich | 0.6352 | 76 | 204 | 3.40.1000.10 |
| af_F4JED3_2_127_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6282 | 139 | 197 | 3.10.450.50 |
| 4n7sD00 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6042 | 41 | 194 | 2.60.120.1690 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B2UB77-F1-model_v4 | Putative transmembrane protein | 0.9643 | 12 | 198 |
|
| AF-A0A660MD38-F1-model_v4 | DUF2167 domain-containing protein | 0.9571 | 25 | 205 |
|
| AF-A0A659R7I8-F1-model_v4 | DUF2167 domain-containing protein | 0.9461 | 19 | 217 |
|
| AF-A0A2V7VN44-F1-model_v4 | DUF2167 domain-containing protein | 0.9448 | 36 | 241 |
|
| AF-A0A4Q2X1K4-F1-model_v4 | DUF2167 domain-containing protein | 0.916 | 41 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar