F413298

General Info

Members Datasets Scaffolds Average Seq Length
337 234 307 301

Family's Representative Sequence

Representative Sequence 3300053158|Ga0500627_0053887|Ga0500627_0053887_505_1575
Length 356
Sequence MAARRSVKHFVQFAAFLSGLAERYVVQYCYLQLLVSSDPSKAIFQESSVQKVISAVVALFVVLSSLPAFAQASPPSEASRKAELVAAWQAASAAGAAGPKDVSLIDQAALKLPAGYFFVPQAEGARVLRALGNVVNDTSIVGLVVGTGPNDGWIVVIRYIKEGYIKDDDAKNWNADDLLKNLKDGVEESNKDRVARGFPEMQVIGWVQPPNYDAATHRLVWSLLAKDKDEADNAAKSINYNTYALGRDGYFSLNLLSNSERIAGDKSVAHELLGDLAYNTGKRYEDFSASTDRIAEYGLMALVGGVAAKKLGLFALAAAFVLKFAKIILIGLGVFGAGVLNFFRRKPRSDAADGPA

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
3 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
4 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
5 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
6 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
7 2858950400 Achromobacter sp. K91 Isolate Unclassified
8 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
12 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
13 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
14 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
15 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
16 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
17 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
18 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
19 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
20 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
21 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
22 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
23 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
24 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
156 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
209 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
216 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
221 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
224 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
228 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
229 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
230 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
231 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
232 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
233 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
234 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.1
Metatranscriptomes 0
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.95
Nodule 5.93
Rhizoplane 5.34
Rhizosphere 62.61
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10036733 3300001989 Bacteria 1653
2 JGI24735J21928_10007772 3300002067 Bacteria 3486
3 JGI25153J46596_10014208 3300003215 Bacteria 3323
4 rootH1_10010499 3300003323 Bacteria 1784
5 JGI25404J52841_10004205 3300003659 Bacteria 2897
6 JGI25404J52841_10025189 3300003659 Bacteria 1281
7 Ga0065165_1002068 3300005262 Bacteria 18536
8 Ga0065704_10175112 3300005289 Unclassified 1268
9 Ga0070658_10093109 3300005327 Bacteria 2486
10 Ga0070676_10073739 3300005328 Bacteria 2054
11 Ga0070690_100030534 3300005330 Bacteria 3350
12 Ga0068869_100065640 3300005334 Bacteria 2672
13 Ga0068869_100077412 3300005334 Bacteria 2474
14 Ga0068868_100036714 3300005338 Bacteria 3795
15 Ga0070660_100236141 3300005339 Bacteria 1488
16 Ga0070661_100144869 3300005344 Unclassified 1792
17 Ga0070692_10000276 3300005345 Bacteria 14447
18 Ga0070692_10216796 3300005345 Bacteria 1129
19 Ga0070668_100064035 3300005347 Bacteria 2850
20 Ga0070668_100533793 3300005347 Eukaryota 1019
21 Ga0070669_100070574 3300005353 Bacteria 2583
22 Ga0070663_100004564 3300005455 Bacteria 8157
23 Ga0070663_100014875 3300005455 Bacteria 5004
24 Ga0070663_100032647 3300005455 Bacteria 3590
25 Ga0070678_100372494 3300005456 Bacteria 1233
26 Ga0068867_100001106 3300005459 Bacteria 18425
27 Ga0068867_100217809 3300005459 Bacteria 1537
28 Ga0068853_100215810 3300005539 Unclassified 1750
29 Ga0068853_100433754 3300005539 Bacteria 1234
30 Ga0070672_100032353 3300005543 Bacteria 3946
31 Ga0070665_100024005 3300005548 Bacteria 6140
32 Ga0070665_100127843 3300005548 Bacteria 2544
33 Ga0070665_100362663 3300005548 Bacteria 1455
34 Ga0068855_100046398 3300005563 Bacteria 5137
35 Ga0070664_100015713 3300005564 Bacteria 6196
36 Ga0070664_100122906 3300005564 Bacteria 2274
37 Ga0068854_100046952 3300005578 Bacteria 3077
38 Ga0068856_100029657 3300005614 Bacteria 5344
39 Ga0070702_100182405 3300005615 Bacteria 1375
40 Ga0068852_100345134 3300005616 Bacteria 1452
41 Ga0068852_100356680 3300005616 Unclassified 1429
42 Ga0068859_100049893 3300005617 Bacteria 4204
43 Ga0068859_100099495 3300005617 Bacteria 2963
44 Ga0068859_100304008 3300005617 Bacteria 1688
45 Ga0068859_100325254 3300005617 Bacteria 1631
46 Ga0068864_100040427 3300005618 Bacteria 3990
47 Ga0068861_100026757 3300005719 Bacteria 4196
48 Ga0068861_100191761 3300005719 Bacteria 1709
49 Ga0068863_100045198 3300005841 Bacteria 4179
50 Ga0068863_100069765 3300005841 Bacteria 3323
51 Ga0068858_100063209 3300005842 Bacteria 3425
52 Ga0068858_100205185 3300005842 Bacteria 1865
53 Ga0068860_100000323 3300005843 Bacteria 64975
54 Ga0068860_100078625 3300005843 Bacteria 3136
55 Ga0068860_100257883 3300005843 Bacteria 1699
56 Ga0068862_100315492 3300005844 Bacteria 1442
57 Ga0081455_10017797 3300005937 Bacteria 6795
58 Ga0081455_10032598 3300005937 Bacteria 4693
59 Ga0081540_1000430 3300005983 Bacteria 41337
60 Ga0081540_1000979 3300005983 Bacteria 25757
61 Ga0081540_1001476 3300005983 Bacteria 20290
62 Ga0081540_1058747 3300005983 Bacteria 1850
63 Ga0081539_10016359 3300005985 Bacteria 5304
64 Ga0075365_10059669 3300006038 Bacteria 2543
65 Ga0075368_10032834 3300006042 Bacteria 2017
66 Ga0075363_100109188 3300006048 Bacteria 1537
67 Ga0075364_10010761 3300006051 Bacteria 5534
68 Ga0075367_10049903 3300006178 Bacteria 2468
69 Ga0075367_10122589 3300006178 Bacteria 1602
70 Ga0075366_10001132 3300006195 Bacteria 13148
71 Ga0075366_10011727 3300006195 Bacteria 4954
72 Ga0075366_10052627 3300006195 Bacteria 2419
73 Ga0075366_10208621 3300006195 Bacteria 1189
74 Ga0097621_100051751 3300006237 Bacteria 3343
75 Ga0075370_10070484 3300006353 Bacteria 1999
76 Ga0075370_10134133 3300006353 Bacteria 1446
77 Ga0075428_100566937 3300006844 Bacteria 1213
78 Ga0075434_100292186 3300006871 Bacteria 1650
79 Ga0068865_100211395 3300006881 Bacteria 1512
80 Ga0097620_100049893 3300006931 Bacteria 4204
81 Ga0097620_100099488 3300006931 Bacteria 2963
82 Ga0097620_100303992 3300006931 Bacteria 1688
83 Ga0097620_100325246 3300006931 Bacteria 1631
84 Ga0075435_100002041 3300007076 Bacteria 13227
85 Ga0105251_10002058 3300009011 Bacteria 16260
86 Ga0105240_10028529 3300009093 Bacteria 7289
87 Ga0105240_10262998 3300009093 Bacteria 1989
88 Ga0105240_10381900 3300009093 Bacteria 1591
89 Ga0105245_10003627 3300009098 Bacteria 13778
90 Ga0105245_10071250 3300009098 Bacteria 3156
91 Ga0105247_10007717 3300009101 Bacteria 6584
92 Ga0105247_10101747 3300009101 Bacteria 1838
93 Ga0105247_10131195 3300009101 Bacteria 1633
94 Ga0105243_10007836 3300009148 Bacteria 8211
95 Ga0105241_10030194 3300009174 Bacteria 4048
96 Ga0105241_10092226 3300009174 Bacteria 2391
97 Ga0105242_10307673 3300009176 Bacteria 1449
98 Ga0105248_10048415 3300009177 Bacteria 4768
99 Ga0105248_10225539 3300009177 Bacteria 2109
100 Ga0105237_10000862 3300009545 Bacteria 41239
101 Ga0105237_10060299 3300009545 Bacteria 3796
102 Ga0105237_10172043 3300009545 Bacteria 2166
103 Ga0105238_10048100 3300009551 Bacteria 4299
104 Ga0105238_10139965 3300009551 Bacteria 2397
105 Ga0105238_10140598 3300009551 Unclassified 2391
106 Ga0105249_10187453 3300009553 Bacteria 2017
107 Ga0105249_10219525 3300009553 Bacteria 1870
108 Ga0105239_10000075 3300010375 Bacteria 140531
109 Ga0105239_10024398 3300010375 Bacteria 6663
110 Ga0105239_10177208 3300010375 Bacteria 2384
111 Ga0105246_10008855 3300011119 Bacteria 6193
112 Ga0105246_10057501 3300011119 Bacteria 2691
113 Ga0157374_10020152 3300013296 Bacteria 5912
114 Ga0157374_10194819 3300013296 Bacteria 1983
115 Ga0157378_10063384 3300013297 Bacteria 3303
116 Ga0163162_10130547 3300013306 Bacteria 2621
117 Ga0157375_10124042 3300013308 Bacteria 2696
118 Ga0163163_10066269 3300014325 Bacteria 3586
119 Ga0157377_10000091 3300014745 Bacteria 66087
120 Ga0157379_10054486 3300014968 Bacteria 3573
121 Ga0157379_10112793 3300014968 Bacteria 2443
122 Ga0157376_10009148 3300014969 Bacteria 7183
123 Ga0209758_1014223 3300025297 Bacteria 4254
124 Ga0209758_1047694 3300025297 Bacteria 1530
125 Ga0207426_1005640 3300025302 Bacteria 5662
126 Ga0207642_10023052 3300025899 Bacteria 2481
127 Ga0207688_10009910 3300025901 Bacteria 5187
128 Ga0207647_10052164 3300025904 Bacteria 2525
129 Ga0207647_10068775 3300025904 Bacteria 2142
130 Ga0207645_10119608 3300025907 Bacteria 1709
131 Ga0207643_10170801 3300025908 Bacteria 1312
132 Ga0207705_10139440 3300025909 Unclassified 1810
133 Ga0207654_10029561 3300025911 Bacteria 3002
134 Ga0207654_10108697 3300025911 Bacteria 1721
135 Ga0207654_10159954 3300025911 Bacteria 1454
136 Ga0207695_10024306 3300025913 Bacteria 6820
137 Ga0207695_10212345 3300025913 Bacteria 1845
138 Ga0207695_10235305 3300025913 Unclassified 1734
139 Ga0207671_10006436 3300025914 Bacteria 10455
140 Ga0207657_10206817 3300025919 Bacteria 1576
141 Ga0207681_10047692 3300025923 Bacteria 2888
142 Ga0207694_10077843 3300025924 Bacteria 2599
143 Ga0207659_10178256 3300025926 Bacteria 1681
144 Ga0207687_10017629 3300025927 Bacteria 4704
145 Ga0207706_10029762 3300025933 Bacteria 4873
146 Ga0207706_10047133 3300025933 Bacteria 3814
147 Ga0207709_10173853 3300025935 Bacteria 1514
148 Ga0207704_10186803 3300025938 Bacteria 1503
149 Ga0207691_10005526 3300025940 Bacteria 12209
150 Ga0207691_10330047 3300025940 Bacteria 1307
151 Ga0207711_10034475 3300025941 Bacteria 4286
152 Ga0207711_10113128 3300025941 Bacteria 2416
153 Ga0207689_10048875 3300025942 Bacteria 3489
154 Ga0207689_10106963 3300025942 Bacteria 2299
155 Ga0207712_10222639 3300025961 Bacteria 1509
156 Ga0207668_10069733 3300025972 Bacteria 2504
157 Ga0207640_10180880 3300025981 Bacteria 1581
158 Ga0207640_10265845 3300025981 Bacteria 1339
159 Ga0207640_10306247 3300025981 Bacteria 1259
160 Ga0207658_10479684 3300025986 Bacteria 1105
161 Ga0207677_10051334 3300026023 Bacteria 2796
162 Ga0207677_10065941 3300026023 Bacteria 2529
163 Ga0207639_10211212 3300026041 Bacteria 1671
164 Ga0207639_10382950 3300026041 Bacteria 1264
165 Ga0207678_10003138 3300026067 Bacteria 14954
166 Ga0207678_10015753 3300026067 Bacteria 6645
167 Ga0207678_10043997 3300026067 Bacteria 3864
168 Ga0207678_10077234 3300026067 Bacteria 2852
169 Ga0207641_10052507 3300026088 Bacteria 3453
170 Ga0207641_10087726 3300026088 Bacteria 2715
171 Ga0207641_10334521 3300026088 Bacteria 1439
172 Ga0207648_10002366 3300026089 Bacteria 20335
173 Ga0207648_10332041 3300026089 Bacteria 1368
174 Ga0207676_10121183 3300026095 Bacteria 2206
175 Ga0207676_10330452 3300026095 Bacteria 1403
176 Ga0207674_10146900 3300026116 Bacteria 2316
177 Ga0207675_100037577 3300026118 Bacteria 4516
178 Ga0207675_100233848 3300026118 Bacteria 1774
179 Ga0207683_10405927 3300026121 Bacteria 1254
180 Ga0207698_10213443 3300026142 Bacteria 1738
181 Ga0207428_10310786 3300027907 Unclassified 1165
182 Ga0268266_10060423 3300028379 Bacteria 3267
183 Ga0268266_10165190 3300028379 Bacteria 2005
184 Ga0268265_10158283 3300028380 Bacteria 1920
185 Ga0268265_10452371 3300028380 Bacteria 1200
186 Ga0268264_10000149 3300028381 Bacteria 163972
187 Ga0268264_10060037 3300028381 Bacteria 3187
188 Ga0268264_10196128 3300028381 Bacteria 1844
189 Ga0307517_10000249 3300028786 Bacteria 91911
190 Ga0307511_10110202 3300030521 Bacteria 1756
191 Ga0265328_10000169 3300031239 Bacteria 30144
192 Ga0265328_10009214 3300031239 Bacteria 4028
193 Ga0265316_10000026 3300031344 Bacteria 165508
194 Ga0307513_10211562 3300031456 Bacteria 1770
195 Ga0307508_10000009 3300031616 Bacteria 256966
196 Ga0307405_10036597 3300031731 Bacteria 2942
197 Ga0307412_10476251 3300031911 Bacteria 1034
198 Ga0307510_10002529 3300033180 Bacteria 20856
199 Ga0307510_10023638 3300033180 Bacteria 7120
200 Ga0373955_0016821 3300035172 Bacteria 3606
201 Ga0373942_0053740 3300035207 Bacteria 1136
202 Ga0373937_0009243 3300036401 Bacteria 8556
203 Ga0395900_0322925 3300037418 Bacteria 1523
204 Ga0395905_0000110 3300037471 Bacteria 137078
205 Ga0395905_0214280 3300037471 Bacteria 1804
206 Ga0395901_0130177 3300038443 Bacteria 2644
207 Ga0436365_0898899 3300039437 Bacteria 4001
208 Ga0436360_0513617 3300039438 Bacteria 4457
209 Ga0439455_0014685 3300042012 Bacteria 1791
210 Ga0450911_000104 3300042115 Bacteria 34662
211 Ga0466957_0143501 3300044842 Bacteria 1540
212 Ga0495603_0002761 3300046455 Bacteria 10347
213 Ga0495590_0001609 3300046457 Bacteria 9655
214 Ga0495596_0049333 3300046500 Bacteria 1650
215 Ga0495606_0070452 3300046507 Bacteria 2205
216 Ga0495606_0085677 3300046507 Bacteria 1949
217 Ga0495616_0043645 3300046513 Bacteria 2277
218 Ga0495654_0042485 3300046530 Bacteria 2257
219 Ga0495640_0148779 3300046533 Bacteria 1506
220 Ga0495597_0006814 3300046542 Bacteria 5872
221 Ga0495668_0049743 3300046616 Bacteria 2324
222 Ga0495611_0094231 3300046648 Bacteria 1385
223 Ga0495625_0159942 3300046660 Bacteria 1510
224 Ga0495670_0051011 3300046691 Bacteria 2071
225 Ga0495671_0007932 3300046692 Bacteria 6007
226 Ga0495683_0003748 3300047323 Bacteria 8784
227 Ga0495687_030603 3300047443 Bacteria 2477
228 Ga0495686_0032801 3300047472 Bacteria 3359
229 Ga0496100_0037523 3300048903 Bacteria 3063
230 Ga0496101_0000747 3300048904 Bacteria 19270
231 Ga0496101_0091922 3300048904 Bacteria 2259
232 Ga0496102_0011573 3300048905 Bacteria 7611
233 Ga0496102_0179557 3300048905 Bacteria 1994
234 Ga0496103_0023786 3300048906 Bacteria 3694
235 Ga0496104_0149253 3300048907 Bacteria 2245
236 Ga0496105_0204888 3300048908 Bacteria 1609
237 Ga0496106_0002372 3300048909 Bacteria 14021
238 Ga0496106_0110275 3300048909 Bacteria 2142
239 Ga0496107_0030109 3300048910 Bacteria 3867
240 Ga0496107_0078223 3300048910 Bacteria 2410
241 Ga0496107_0213019 3300048910 Bacteria 1437
242 Ga0496109_0061405 3300048912 Bacteria 3436
243 Ga0496110_0030201 3300048913 Bacteria 4669
244 Ga0496111_0003505 3300048914 Bacteria 9705
245 Ga0496112_0075547 3300048915 Bacteria 3332
246 Ga0496113_0050290 3300048916 Bacteria 3107
247 Ga0496116_0003366 3300048919 Bacteria 15870
248 Ga0496118_0037519 3300048921 Bacteria 3898
249 Ga0496118_0112823 3300048921 Bacteria 1798
250 Ga0496119_0088606 3300048922 Bacteria 1764
251 Ga0496121_0000247 3300048924 Bacteria 114839
252 Ga0496121_0003540 3300048924 Bacteria 22123
253 Ga0496121_0010446 3300048924 Bacteria 10474
254 Ga0496121_0029113 3300048924 Bacteria 5119
255 Ga0496121_0034530 3300048924 Bacteria 4551
256 Ga0496121_0045202 3300048924 Bacteria 3786
257 Ga0496121_0075293 3300048924 Bacteria 2697
258 Ga0496122_0014041 3300048925 Bacteria 7777
259 Ga0496124_0009536 3300048927 Bacteria 9980
260 Ga0496124_0112742 3300048927 Bacteria 2186
261 Ga0496125_0002393 3300048928 Bacteria 24439
262 Ga0496125_0008704 3300048928 Bacteria 10562
263 Ga0496125_0041412 3300048928 Bacteria 3938
264 Ga0496125_0046305 3300048928 Bacteria 3649
265 Ga0496125_0203022 3300048928 Bacteria 1295
266 Ga0496126_0012491 3300048929 Bacteria 8696
267 Ga0496126_0067897 3300048929 Bacteria 3185
268 Ga0496126_0139834 3300048929 Bacteria 2085
269 Ga0496126_0168375 3300048929 Bacteria 1868
270 Ga0496126_0200602 3300048929 Bacteria 1685
271 Ga0496126_0273984 3300048929 Bacteria 1400
272 Ga0495678_037999 3300049459 Bacteria 1952
273 Ga0495682_0056413 3300049460 Bacteria 1424
274 Ga0501249_000370 3300049679 Bacteria 11828
275 nmdc:mga0yw44_41853_c1 3300050492 Bacteria 2729
276 nmdc:mga0k408_16850_c1 3300050493 Bacteria 4062
277 nmdc:mga0k408_49787_c1 3300050493 Bacteria 2425
278 nmdc:mga06z11_82532_c1 3300050494 Bacteria 1728
279 nmdc:mga07m45_59504_c1 3300050496 Bacteria 2161
280 nmdc:mga08y16_212021_c1 3300050511 Bacteria 2006
281 nmdc:mga0n895_277271_c1 3300050512 Bacteria 1700
282 nmdc:mga0rr50_8040_c1 3300050513 Bacteria 6541
283 nmdc:mga0sz30_53935_c1 3300050516 Bacteria 1709
284 Ga0500578_0116947 3300053086 Bacteria 1678
285 Ga0500578_0131572 3300053086 Bacteria 1569
286 Ga0500643_026314 3300053087 Bacteria 1823
287 Ga0500647_0069392 3300053091 Bacteria 1695
288 Ga0500640_011050 3300053095 Bacteria 3668
289 Ga0500650_0093955 3300053098 Bacteria 1404
290 Ga0500555_024307 3300053103 Bacteria 1737
291 Ga0500569_002669 3300053109 Bacteria 3553
292 Ga0500572_037149 3300053111 Bacteria 1394
293 Ga0500595_008325 3300053119 Bacteria 4243
294 Ga0500608_016820 3300053122 Bacteria 3311
295 Ga0500617_064525 3300053124 Bacteria 1616
296 Ga0500564_091024 3300053138 Bacteria 1357
297 Ga0500588_0004407 3300053146 Bacteria 3051
298 Ga0500616_0000002 3300053153 Bacteria 1611257
299 Ga0500619_002762 3300053154 Bacteria 3453
300 Ga0500620_054519 3300053155 Bacteria 1348
301 Ga0500622_0069500 3300053156 Bacteria 1784
302 Ga0500627_0053887 3300053158 Bacteria 1758
303 Ga0500638_037204 3300053162 Bacteria 2361
304 Ga0500636_0001005 3300053177 Bacteria 15085
305 Ga0500637_0082296 3300053178 Bacteria 1860
306 Ga0500609_005513 3300053731 Bacteria 1730
307 Ga0500601_000855 3300053737 Bacteria 3702

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10070484 Ga0075370_100704843 232
2 3300048928 Ga0496125_0002393 Ga0496125_0002393_11170_12087 239
3 3300038443 Ga0395901_0130177 Ga0395901_0130177_400_1248 247
4 3300025914 Ga0207671_10006436 Ga0207671_100064367 249
5 3300048924 Ga0496121_0075293 Ga0496121_0075293_1205_2224 249
6 3300048929 Ga0496126_0139834 Ga0496126_0139834_716_1735 249
7 3300026067 Ga0207678_10015753 Ga0207678_100157534 250
8 3300035207 Ga0373942_0053740 Ga0373942_0053740_290_1111 251
9 3300048915 Ga0496112_0075547 Ga0496112_0075547_52_864 251
10 3300009174 Ga0105241_10092226 Ga0105241_100922261 252
11 3300009551 Ga0105238_10140598 Ga0105238_101405981 252
12 3300048929 Ga0496126_0273984 Ga0496126_0273984_248_1177 253
13 3300005344 Ga0070661_100144869 Ga0070661_1001448692 255
14 3300005564 Ga0070664_100015713 Ga0070664_1000157132 255
15 3300009093 Ga0105240_10381900 Ga0105240_103819002 255
16 3300025911 Ga0207654_10029561 Ga0207654_100295612 255
17 3300025924 Ga0207694_10077843 Ga0207694_100778433 255
18 3300025933 Ga0207706_10029762 Ga0207706_100297626 255
19 3300026116 Ga0207674_10146900 Ga0207674_101469001 255
20 3300003659 JGI25404J52841_10004205 JGI25404J52841_100042051 256
21 3300037418 Ga0395900_0322925 Ga0395900_0322925_339_1256 256
22 3300037471 Ga0395905_0000110 Ga0395905_0000110_75578_76501 256
23 3300005455 Ga0070663_100032647 Ga0070663_1000326473 257
24 3300005539 Ga0068853_100215810 Ga0068853_1002158102 257
25 3300025913 Ga0207695_10235305 Ga0207695_102353051 257
26 3300006195 Ga0075366_10052627 Ga0075366_100526272 258
27 3300050493 nmdc:mga0k408_49787_c1 nmdc:mga0k408_49787_c1_1050_1943 258
28 3300031239 Ga0265328_10009214 Ga0265328_100092143 259
29 3300031911 Ga0307412_10476251 Ga0307412_104762511 259
30 3300053098 Ga0500650_0093955 Ga0500650_0093955_352_1251 259
31 3300005330 Ga0070690_100030534 Ga0070690_1000305342 260
32 3300009098 Ga0105245_10003627 Ga0105245_100036276 260
33 3300011119 Ga0105246_10057501 Ga0105246_100575012 260
34 3300026023 Ga0207677_10051334 Ga0207677_100513341 260
35 3300005347 Ga0070668_100533793 Ga0070668_1005337931 261
36 3300006195 Ga0075366_10001132 Ga0075366_100011328 261
37 3300025913 Ga0207695_10024306 Ga0207695_100243063 261
38 3300025986 Ga0207658_10479684 Ga0207658_104796841 261
39 3300027907 Ga0207428_10310786 Ga0207428_103107861 261
40 3300048928 Ga0496125_0203022 Ga0496125_0203022_172_1089 261
41 3300050511 nmdc:mga08y16_212021_c1 nmdc:mga08y16_212021_c1_850_1785 261
42 3300031239 Ga0265328_10000169 Ga0265328_100001693 262
43 3300039438 Ga0436360_0513617 Ga0436360_0513617_2991_3929 262
44 3300053124 Ga0500617_064525 Ga0500617_064525_208_1188 262
45 3300005289 Ga0065704_10175112 Ga0065704_101751122 263
46 3300005328 Ga0070676_10073739 Ga0070676_100737392 263
47 3300005347 Ga0070668_100064035 Ga0070668_1000640352 263
48 3300005353 Ga0070669_100070574 Ga0070669_1000705742 263
49 3300005459 Ga0068867_100217809 Ga0068867_1002178091 263
50 3300005548 Ga0070665_100127843 Ga0070665_1001278432 263
51 3300005843 Ga0068860_100257883 Ga0068860_1002578832 263
52 3300005983 Ga0081540_1001476 Ga0081540_100147611 263
53 3300006195 Ga0075366_10208621 Ga0075366_102086212 263
54 3300006353 Ga0075370_10134133 Ga0075370_101341333 263
55 3300009176 Ga0105242_10307673 Ga0105242_103076731 263
56 3300009553 Ga0105249_10187453 Ga0105249_101874532 263
57 3300025907 Ga0207645_10119608 Ga0207645_101196082 263
58 3300025923 Ga0207681_10047692 Ga0207681_100476923 263
59 3300025972 Ga0207668_10069733 Ga0207668_100697332 263
60 3300025981 Ga0207640_10306247 Ga0207640_103062472 263
61 3300026089 Ga0207648_10332041 Ga0207648_103320412 263
62 3300028379 Ga0268266_10165190 Ga0268266_101651902 263
63 3300028380 Ga0268265_10452371 Ga0268265_104523711 263
64 3300042012 Ga0439455_0014685 Ga0439455_0014685_595_1506 263
65 3300046660 Ga0495625_0159942 Ga0495625_0159942_283_1194 263
66 3300048928 Ga0496125_0046305 Ga0496125_0046305_1194_2111 263
67 3300031344 Ga0265316_10000026 Ga0265316_1000002675 264
68 3300007076 Ga0075435_100002041 Ga0075435_10000204116 265
69 3300048928 Ga0496125_0008704 Ga0496125_0008704_9550_10455 265
70 3300053146 Ga0500588_0004407 Ga0500588_0004407_290_1177 265
71 3300053731 Ga0500609_005513 Ga0500609_005513_66_953 265
72 3300005617 Ga0068859_100099495 Ga0068859_1000994952 266
73 3300005842 Ga0068858_100205185 Ga0068858_1002051852 266
74 3300006931 Ga0097620_100099488 Ga0097620_1000994883 266
75 3300009101 Ga0105247_10007717 Ga0105247_100077174 266
76 3300009545 Ga0105237_10172043 Ga0105237_101720432 266
77 3300010375 Ga0105239_10177208 Ga0105239_101772082 266
78 3300036401 Ga0373937_0009243 Ga0373937_0009243_6794_7708 266
79 3300046533 Ga0495640_0148779 Ga0495640_0148779_189_1103 266
80 3300048922 Ga0496119_0088606 Ga0496119_0088606_821_1729 266
81 3300050513 nmdc:mga0rr50_8040_c1 nmdc:mga0rr50_8040_c1_1178_2122 266
82 3300053086 Ga0500578_0131572 Ga0500578_0131572_361_1341 266
83 iso_pu_bacteria 2858950400 2858955667 266
84 3300005616 Ga0068852_100356680 Ga0068852_1003566801 267
85 3300005841 Ga0068863_100069765 Ga0068863_1000697652 267
86 3300005843 Ga0068860_100078625 Ga0068860_1000786252 267
87 3300026088 Ga0207641_10052507 Ga0207641_100525072 267
88 3300028381 Ga0268264_10060037 Ga0268264_100600372 267
89 3300035172 Ga0373955_0016821 Ga0373955_0016821_650_1594 267
90 3300042115 Ga0450911_000104 Ga0450911_000104_29458_30363 267
91 3300044842 Ga0466957_0143501 Ga0466957_0143501_383_1312 267
92 3300053086 Ga0500578_0116947 Ga0500578_0116947_413_1342 267
93 3300039437 Ga0436365_0898899 Ga0436365_0898899_672_1604 268
94 3300048927 Ga0496124_0112742 Ga0496124_0112742_774_1679 268
95 3300048929 Ga0496126_0067897 Ga0496126_0067897_1888_2793 268
96 3300005345 Ga0070692_10000276 Ga0070692_1000027611 269
97 3300005455 Ga0070663_100004564 Ga0070663_1000045646 269
98 3300005459 Ga0068867_100001106 Ga0068867_10000110613 269
99 3300005578 Ga0068854_100046952 Ga0068854_1000469522 269
100 3300009093 Ga0105240_10028529 Ga0105240_100285298 269
101 3300009148 Ga0105243_10007836 Ga0105243_100078369 269
102 3300009545 Ga0105237_10000862 Ga0105237_100008624 269
103 3300010375 Ga0105239_10000075 Ga0105239_10000075112 269
104 3300014745 Ga0157377_10000091 Ga0157377_1000009136 269
105 3300025935 Ga0207709_10173853 Ga0207709_101738531 269
106 3300025981 Ga0207640_10180880 Ga0207640_101808802 269
107 3300026067 Ga0207678_10003138 Ga0207678_100031383 269
108 3300026089 Ga0207648_10002366 Ga0207648_1000236615 269
109 3300046692 Ga0495671_0007932 Ga0495671_0007932_1797_2711 269
110 3300048924 Ga0496121_0000247 Ga0496121_0000247_5747_6661 269
111 3300048929 Ga0496126_0012491 Ga0496126_0012491_3046_3960 269
112 3300048929 Ga0496126_0200602 Ga0496126_0200602_427_1356 269
113 3300053153 Ga0500616_0000002 Ga0500616_0000002_1487937_1488872 269
114 iso_pu_bacteria 8019565922 8019568768 269
115 3300005543 Ga0070672_100032353 Ga0070672_1000323531 270
116 3300025940 Ga0207691_10005526 Ga0207691_100055262 270
117 3300026041 Ga0207639_10211212 Ga0207639_102112122 270
118 3300037471 Ga0395905_0214280 Ga0395905_0214280_496_1419 270
119 3300049679 Ga0501249_000370 Ga0501249_000370_7934_8983 270
120 3300003215 JGI25153J46596_10014208 JGI25153J46596_100142084 271
121 3300003659 JGI25404J52841_10025189 JGI25404J52841_100251891 271
122 3300005334 Ga0068869_100065640 Ga0068869_1000656402 271
123 3300005334 Ga0068869_100077412 Ga0068869_1000774122 271
124 3300005338 Ga0068868_100036714 Ga0068868_1000367142 271
125 3300005339 Ga0070660_100236141 Ga0070660_1002361412 271
126 3300005345 Ga0070692_10216796 Ga0070692_102167961 271
127 3300005455 Ga0070663_100014875 Ga0070663_1000148753 271
128 3300005539 Ga0068853_100433754 Ga0068853_1004337541 271
129 3300005548 Ga0070665_100024005 Ga0070665_1000240052 271
130 3300005563 Ga0068855_100046398 Ga0068855_1000463984 271
131 3300005564 Ga0070664_100122906 Ga0070664_1001229062 271
132 3300005614 Ga0068856_100029657 Ga0068856_1000296575 271
133 3300005615 Ga0070702_100182405 Ga0070702_1001824052 271
134 3300005616 Ga0068852_100345134 Ga0068852_1003451342 271
135 3300005617 Ga0068859_100049893 Ga0068859_1000498934 271
136 3300005617 Ga0068859_100304008 Ga0068859_1003040081 271
137 3300005617 Ga0068859_100325254 Ga0068859_1003252541 271
138 3300005618 Ga0068864_100040427 Ga0068864_1000404273 271
139 3300005719 Ga0068861_100026757 Ga0068861_1000267573 271
140 3300005719 Ga0068861_100191761 Ga0068861_1001917613 271
141 3300005841 Ga0068863_100045198 Ga0068863_1000451984 271
142 3300005842 Ga0068858_100063209 Ga0068858_1000632092 271
143 3300005843 Ga0068860_100000323 Ga0068860_10000032318 271
144 3300005844 Ga0068862_100315492 Ga0068862_1003154922 271
145 3300005937 Ga0081455_10017797 Ga0081455_100177977 271
146 3300005937 Ga0081455_10032598 Ga0081455_100325985 271
147 3300005983 Ga0081540_1000430 Ga0081540_100043024 271
148 3300005983 Ga0081540_1000979 Ga0081540_100097914 271
149 3300005983 Ga0081540_1058747 Ga0081540_10587473 271
150 3300006038 Ga0075365_10059669 Ga0075365_100596693 271
151 3300006042 Ga0075368_10032834 Ga0075368_100328341 271
152 3300006048 Ga0075363_100109188 Ga0075363_1001091882 271
153 3300006051 Ga0075364_10010761 Ga0075364_100107612 271
154 3300006178 Ga0075367_10049903 Ga0075367_100499033 271
155 3300006178 Ga0075367_10122589 Ga0075367_101225892 271
156 3300006195 Ga0075366_10011727 Ga0075366_100117276 271
157 3300006237 Ga0097621_100051751 Ga0097621_1000517514 271
158 3300006844 Ga0075428_100566937 Ga0075428_1005669371 271
159 3300006871 Ga0075434_100292186 Ga0075434_1002921862 271
160 3300006881 Ga0068865_100211395 Ga0068865_1002113952 271
161 3300006931 Ga0097620_100049893 Ga0097620_1000498934 271
162 3300006931 Ga0097620_100303992 Ga0097620_1003039921 271
163 3300006931 Ga0097620_100325246 Ga0097620_1003252462 271
164 3300009093 Ga0105240_10262998 Ga0105240_102629982 271
165 3300009098 Ga0105245_10071250 Ga0105245_100712503 271
166 3300009101 Ga0105247_10101747 Ga0105247_101017472 271
167 3300009174 Ga0105241_10030194 Ga0105241_100301944 271
168 3300009177 Ga0105248_10048415 Ga0105248_100484154 271
169 3300009177 Ga0105248_10225539 Ga0105248_102255392 271
170 3300009545 Ga0105237_10060299 Ga0105237_100602993 271
171 3300009551 Ga0105238_10048100 Ga0105238_100481002 271
172 3300009553 Ga0105249_10219525 Ga0105249_102195251 271
173 3300010375 Ga0105239_10024398 Ga0105239_100243987 271
174 3300011119 Ga0105246_10008855 Ga0105246_100088555 271
175 3300013296 Ga0157374_10194819 Ga0157374_101948192 271
176 3300013297 Ga0157378_10063384 Ga0157378_100633844 271
177 3300013308 Ga0157375_10124042 Ga0157375_101240423 271
178 3300014325 Ga0163163_10066269 Ga0163163_100662693 271
179 3300014968 Ga0157379_10054486 Ga0157379_100544863 271
180 3300014968 Ga0157379_10112793 Ga0157379_101127933 271
181 3300014969 Ga0157376_10009148 Ga0157376_100091488 271
182 3300025297 Ga0209758_1014223 Ga0209758_10142232 271
183 3300025297 Ga0209758_1047694 Ga0209758_10476942 271
184 3300025899 Ga0207642_10023052 Ga0207642_100230523 271
185 3300025901 Ga0207688_10009910 Ga0207688_100099104 271
186 3300025904 Ga0207647_10052164 Ga0207647_100521642 271
187 3300025908 Ga0207643_10170801 Ga0207643_101708011 271
188 3300025911 Ga0207654_10108697 Ga0207654_101086972 271
189 3300025913 Ga0207695_10212345 Ga0207695_102123452 271
190 3300025919 Ga0207657_10206817 Ga0207657_102068173 271
191 3300025926 Ga0207659_10178256 Ga0207659_101782562 271
192 3300025927 Ga0207687_10017629 Ga0207687_100176294 271
193 3300025933 Ga0207706_10047133 Ga0207706_100471333 271
194 3300025938 Ga0207704_10186803 Ga0207704_101868032 271
195 3300025940 Ga0207691_10330047 Ga0207691_103300472 271
196 3300025941 Ga0207711_10034475 Ga0207711_100344754 271
197 3300025941 Ga0207711_10113128 Ga0207711_101131284 271
198 3300025942 Ga0207689_10048875 Ga0207689_100488753 271
199 3300025942 Ga0207689_10106963 Ga0207689_101069633 271
200 3300025961 Ga0207712_10222639 Ga0207712_102226392 271
201 3300025981 Ga0207640_10265845 Ga0207640_102658452 271
202 3300026023 Ga0207677_10065941 Ga0207677_100659411 271
203 3300026041 Ga0207639_10382950 Ga0207639_103829502 271
204 3300026067 Ga0207678_10043997 Ga0207678_100439974 271
205 3300026088 Ga0207641_10087726 Ga0207641_100877261 271
206 3300026088 Ga0207641_10334521 Ga0207641_103345211 271
207 3300026095 Ga0207676_10121183 Ga0207676_101211832 271
208 3300026095 Ga0207676_10330452 Ga0207676_103304521 271
209 3300026118 Ga0207675_100037577 Ga0207675_1000375774 271
210 3300026118 Ga0207675_100233848 Ga0207675_1002338482 271
211 3300026142 Ga0207698_10213443 Ga0207698_102134432 271
212 3300028379 Ga0268266_10060423 Ga0268266_100604233 271
213 3300028380 Ga0268265_10158283 Ga0268265_101582831 271
214 3300028381 Ga0268264_10000149 Ga0268264_1000014987 271
215 3300028381 Ga0268264_10196128 Ga0268264_101961282 271
216 3300030521 Ga0307511_10110202 Ga0307511_101102021 271
217 3300031456 Ga0307513_10211562 Ga0307513_102115621 271
218 3300031616 Ga0307508_10000009 Ga0307508_1000000952 271
219 3300031731 Ga0307405_10036597 Ga0307405_100365974 271
220 3300033180 Ga0307510_10002529 Ga0307510_1000252916 271
221 3300046455 Ga0495603_0002761 Ga0495603_0002761_3038_3964 271
222 3300046500 Ga0495596_0049333 Ga0495596_0049333_49_1029 271
223 3300046513 Ga0495616_0043645 Ga0495616_0043645_1106_2023 271
224 3300046530 Ga0495654_0042485 Ga0495654_0042485_1135_2061 271
225 3300046616 Ga0495668_0049743 Ga0495668_0049743_163_1080 271
226 3300046648 Ga0495611_0094231 Ga0495611_0094231_349_1275 271
227 3300046691 Ga0495670_0051011 Ga0495670_0051011_903_1820 271
228 3300048904 Ga0496101_0091922 Ga0496101_0091922_292_1209 271
229 3300048905 Ga0496102_0179557 Ga0496102_0179557_95_1012 271
230 3300048909 Ga0496106_0110275 Ga0496106_0110275_559_1476 271
231 3300048910 Ga0496107_0078223 Ga0496107_0078223_963_1880 271
232 3300048924 Ga0496121_0010446 Ga0496121_0010446_7407_8312 271
233 3300048924 Ga0496121_0034530 Ga0496121_0034530_648_1628 271
234 3300048924 Ga0496121_0045202 Ga0496121_0045202_1633_2559 271
235 3300048929 Ga0496126_0168375 Ga0496126_0168375_558_1538 271
236 3300050492 nmdc:mga0yw44_41853_c1 nmdc:mga0yw44_41853_c1_1519_2436 271
237 3300050493 nmdc:mga0k408_16850_c1 nmdc:mga0k408_16850_c1_275_1192 271
238 3300050494 nmdc:mga06z11_82532_c1 nmdc:mga06z11_82532_c1_509_1426 271
239 3300050496 nmdc:mga07m45_59504_c1 nmdc:mga07m45_59504_c1_908_1888 271
240 3300050512 nmdc:mga0n895_277271_c1 nmdc:mga0n895_277271_c1_79_996 271
241 3300050516 nmdc:mga0sz30_53935_c1 nmdc:mga0sz30_53935_c1_601_1518 271
242 3300053087 Ga0500643_026314 Ga0500643_026314_246_1172 271
243 3300053103 Ga0500555_024307 Ga0500555_024307_410_1390 271
244 3300053156 Ga0500622_0069500 Ga0500622_0069500_485_1465 271
245 3300053158 Ga0500627_0053887 Ga0500627_0053887_505_1575 271
246 iso_pu_bacteria 2876808645 2876809938 271
247 iso_pu_bacteria 2879110137 2879110231 271
248 iso_pu_bacteria 8006984368 8006986604 271
249 3300003323 rootH1_10010499 rootH1_100104992 272
250 3300005262 Ga0065165_1002068 Ga0065165_100206816 272
251 3300005985 Ga0081539_10016359 Ga0081539_100163597 272
252 3300028786 Ga0307517_10000249 Ga0307517_1000024985 272
253 3300033180 Ga0307510_10023638 Ga0307510_100236382 272
254 3300046507 Ga0495606_0085677 Ga0495606_0085677_846_1799 272
255 3300047443 Ga0495687_030603 Ga0495687_030603_411_1340 272
256 3300047472 Ga0495686_0032801 Ga0495686_0032801_359_1288 272
257 3300048910 Ga0496107_0213019 Ga0496107_0213019_206_1135 272
258 3300048924 Ga0496121_0029113 Ga0496121_0029113_3005_3934 272
259 3300049460 Ga0495682_0056413 Ga0495682_0056413_379_1332 272
260 3300053091 Ga0500647_0069392 Ga0500647_0069392_620_1549 272
261 3300053095 Ga0500640_011050 Ga0500640_011050_2640_3569 272
262 3300053109 Ga0500569_002669 Ga0500569_002669_1403_2332 272
263 3300053111 Ga0500572_037149 Ga0500572_037149_425_1354 272
264 3300053119 Ga0500595_008325 Ga0500595_008325_3038_3967 272
265 3300053122 Ga0500608_016820 Ga0500608_016820_1029_1958 272
266 3300053138 Ga0500564_091024 Ga0500564_091024_325_1254 272
267 3300053154 Ga0500619_002762 Ga0500619_002762_1953_2882 272
268 3300053155 Ga0500620_054519 Ga0500620_054519_300_1229 272
269 3300053162 Ga0500638_037204 Ga0500638_037204_1265_2194 272
270 3300053177 Ga0500636_0001005 Ga0500636_0001005_7762_8691 272
271 3300053178 Ga0500637_0082296 Ga0500637_0082296_813_1742 272
272 3300053737 Ga0500601_000855 Ga0500601_000855_777_1706 272
273 iso_pu_bacteria 2511231028 2511400958 272
274 iso_pu_bacteria 2517093001 2517105658 272
275 iso_pu_bacteria 2824704595 2824709625 272
276 iso_pu_bacteria 2824753945 2824755358 272
277 iso_pu_bacteria 2824763712 2824771133 272
278 iso_pu_bacteria 2841957949 2841959192 272
279 iso_pu_bacteria 2876761206 2876769520 272
280 iso_pu_bacteria 2904690495 2904694657 272
281 iso_pu_bacteria 2904711408 2904718776 272
282 iso_pu_bacteria 2908756301 2908760207 272
283 iso_pu_bacteria 2935675223 2935683718 272
284 iso_pu_bacteria 2935684952 2935691983 272
285 iso_pu_bacteria 2935713505 2935721822 272
286 iso_pu_bacteria 2935722832 2935731180 272
287 iso_pu_bacteria 2935732158 2935738958 272
288 iso_pu_bacteria 2935741537 2935747857 272
289 iso_pu_bacteria 2935750917 2935756441 272
290 iso_pu_bacteria 2935760218 2935761577 272
291 iso_pu_bacteria 2935810662 2935812107 272
292 iso_pu_bacteria 2936037263 2936038701 272
293 iso_pu_bacteria 2940556831 2940562355 272
294 iso_pu_bacteria 8006933436 8006940469 272
295 iso_pu_bacteria 8006973647 8006980158 272
296 iso_pu_bacteria 8019555841 8019556541 272
297 3300048921 Ga0496118_0037519 Ga0496118_0037519_1227_2171 274
298 3300048928 Ga0496125_0041412 Ga0496125_0041412_2086_3030 274
299 iso_pu_bacteria 8057101203 8057104565 274
300 3300001989 JGI24739J22299_10036733 JGI24739J22299_100367332 278
301 3300002067 JGI24735J21928_10007772 JGI24735J21928_100077724 278
302 3300005327 Ga0070658_10093109 Ga0070658_100931092 278
303 3300005456 Ga0070678_100372494 Ga0070678_1003724941 278
304 3300005548 Ga0070665_100362663 Ga0070665_1003626631 278
305 3300009011 Ga0105251_10002058 Ga0105251_100020585 278
306 3300009101 Ga0105247_10131195 Ga0105247_101311951 278
307 3300009551 Ga0105238_10139965 Ga0105238_101399652 278
308 3300013296 Ga0157374_10020152 Ga0157374_100201526 278
309 3300013306 Ga0163162_10130547 Ga0163162_101305472 278
310 3300025302 Ga0207426_1005640 Ga0207426_10056403 278
311 3300025904 Ga0207647_10068775 Ga0207647_100687752 278
312 3300025909 Ga0207705_10139440 Ga0207705_101394401 278
313 3300025911 Ga0207654_10159954 Ga0207654_101599541 278
314 3300026067 Ga0207678_10077234 Ga0207678_100772342 278
315 3300026121 Ga0207683_10405927 Ga0207683_104059271 278
316 3300046457 Ga0495590_0001609 Ga0495590_0001609_2348_3283 278
317 3300046507 Ga0495606_0070452 Ga0495606_0070452_1143_2078 278
318 3300046542 Ga0495597_0006814 Ga0495597_0006814_4413_5348 278
319 3300047323 Ga0495683_0003748 Ga0495683_0003748_5713_6648 278
320 3300048903 Ga0496100_0037523 Ga0496100_0037523_250_1185 278
321 3300048904 Ga0496101_0000747 Ga0496101_0000747_4538_5473 278
322 3300048905 Ga0496102_0011573 Ga0496102_0011573_769_1704 278
323 3300048906 Ga0496103_0023786 Ga0496103_0023786_478_1413 278
324 3300048907 Ga0496104_0149253 Ga0496104_0149253_698_1633 278
325 3300048908 Ga0496105_0204888 Ga0496105_0204888_355_1290 278
326 3300048909 Ga0496106_0002372 Ga0496106_0002372_2307_3242 278
327 3300048910 Ga0496107_0030109 Ga0496107_0030109_2276_3211 278
328 3300048912 Ga0496109_0061405 Ga0496109_0061405_1256_2191 278
329 3300048913 Ga0496110_0030201 Ga0496110_0030201_1552_2487 278
330 3300048914 Ga0496111_0003505 Ga0496111_0003505_6537_7472 278
331 3300048916 Ga0496113_0050290 Ga0496113_0050290_1393_2328 278
332 3300048919 Ga0496116_0003366 Ga0496116_0003366_2197_3132 278
333 3300048921 Ga0496118_0112823 Ga0496118_0112823_24_959 278
334 3300048924 Ga0496121_0003540 Ga0496121_0003540_2290_3225 278
335 3300048925 Ga0496122_0014041 Ga0496122_0014041_4639_5574 278
336 3300048927 Ga0496124_0009536 Ga0496124_0009536_1646_2581 278
337 3300049459 Ga0495678_037999 Ga0495678_037999_563_1498 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09935

DUF2167

Protein of unknown function (DUF2167)

96

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7onx-assembly1.cif.gz_A crystal structure of pbp3 from p. aeruginosa 0.6398 152 197
7rcz-assembly1.cif.gz_A crystal structure of c. difficile spovd in complex with ampicillin 0.6264 150 196
5tsh-assembly1.cif.gz_E pilb from geobacter metallireducens bound to amp-pnp 0.6153 156 200
7kiv-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa pbp3 in complex with avibactam 0.6099 152 212
4n7s-assembly2.cif.gz_D crystal structure of tse3-tsi3 complex with zinc ion 0.6042 41 194
ID Description Score Start End Superfamily
af_A0A0R0I2J7_57_237_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6857 137 182 2.40.128.20
af_P32074_820_932_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6429 91 197 3.30.310.10
af_A0A0R0EKI7_78_225_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6352 76 204 3.40.1000.10
af_F4JED3_2_127_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6282 139 197 3.10.450.50
4n7sD00 Mainly Beta;Sandwich;Jelly Rolls; 0.6042 41 194 2.60.120.1690
ID Description Score Start End GO Terms
AF-B2UB77-F1-model_v4 Putative transmembrane protein 0.9643 12 198
AF-A0A660MD38-F1-model_v4 DUF2167 domain-containing protein 0.9571 25 205
AF-A0A659R7I8-F1-model_v4 DUF2167 domain-containing protein 0.9461 19 217
AF-A0A2V7VN44-F1-model_v4 DUF2167 domain-containing protein 0.9448 36 241
AF-A0A4Q2X1K4-F1-model_v4 DUF2167 domain-containing protein 0.916 41 198

Feature Viewer

pLDDT pTM Quality
80.42 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map