F413242

General Info

Members Datasets Scaffolds Average Seq Length
337 222 304 238

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0044754|Ga0496122_0044754_1821_2675
Length 284
Sequence LRCNIGRRPAEERCANGEVLFCFAGGGVRDVLRAVSLQTPRRDDETMPTELLFRQDAYLRETAATVEEVNERGGIVLDRTVFYATGGGQPGDAGLLLRADGGTIAIGTAIYDPEDKSRILHVPLEGQPVPQPGETVTAVLDWERRLKRMRIHTALHLLSVVLPYPVTGGSIGDGDGRLDFDIPEGGLDKAELTEKLKALVARNAEVSYRWISDAELDANPGLVKTMSVKPPRGSGRVRLVAIGDIDLQPCGGTHVANTSEIGLVAVTDIEKKGKQNRRVRIALA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2643221580 Devosia sp. Root635 Isolate Unclassified
5 2643221629 Devosia sp. Root105 Isolate Unclassified
6 2643221662 Devosia sp. Root413D1 Isolate Unclassified
7 2643221674 Devosia sp. Root436 Isolate Unclassified
8 2643221733 Bosea sp. Root381 Isolate Unclassified
9 2643221734 Bosea sp. Root670 Isolate Unclassified
10 2643221736 Bosea sp. Root483D1 Isolate Unclassified
11 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
12 2773857925 Microvirga vignae BR3299 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2818991467 Bosea vestrisii 3192 Isolate Unclassified
15 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
16 2841760612 Bosea sp. Tri-49 Isolate Nodule
17 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
18 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
19 2844104063 Bosea sp. Tri-39 Isolate Nodule
20 2851182111 Bosea sp. Tri-44 Isolate Nodule
21 2851246043 Bosea sp. Tri-54 Isolate Nodule
22 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
23 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
24 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
25 2909042592 Labrys sp. LIt4 Isolate Nodule
26 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
27 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
28 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
29 2932401849 Devosia sp. 2618 Isolate Rhizosphere
30 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
31 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
222 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.21
Metatranscriptomes 0
Isolates 9.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.87
Nodule 3.56
Rhizoplane 1.19
Rhizosphere 70.92
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1005862 3300002987 Bacteria 3787
2 JGI25151J46595_10000063 3300003187 Bacteria 146046
3 rootH2_10032659 3300003320 Bacteria 1870
4 rootH2_10130842 3300003320 Unclassified 4108
5 rootH1_10011432 3300003323 Bacteria 2664
6 Ga0055526_1000091 3300003771 Bacteria 82891
7 Ga0055526_1000202 3300003771 Bacteria 51431
8 Ga0055524_1000144 3300003775 Bacteria 84213
9 Ga0055524_1025202 3300003775 Bacteria 1868
10 Ga0065165_1000393 3300005262 Bacteria 71081
11 Ga0070689_100299890 3300005340 Bacteria 1337
12 Ga0070661_100006085 3300005344 Bacteria 8303
13 Ga0070667_100167070 3300005367 Bacteria 1941
14 Ga0070713_100544000 3300005436 Bacteria 1099
15 Ga0070710_10261454 3300005437 Bacteria 1116
16 Ga0070700_100555056 3300005441 Bacteria 893
17 Ga0070662_100315367 3300005457 Bacteria 1274
18 Ga0070707_100028623 3300005468 Bacteria 5304
19 Ga0068853_100003971 3300005539 Bacteria 11368
20 Ga0068853_100067298 3300005539 Bacteria 3112
21 Ga0068853_100453899 3300005539 Bacteria 1206
22 Ga0070696_100030634 3300005546 Bacteria 3685
23 Ga0070665_100023259 3300005548 Bacteria 6241
24 Ga0068855_100059971 3300005563 Bacteria 4451
25 Ga0068855_100834512 3300005563 Bacteria 977
26 Ga0068857_100370293 3300005577 Bacteria 1329
27 Ga0068854_100076816 3300005578 Bacteria 2456
28 Ga0068854_100096019 3300005578 Bacteria 2214
29 Ga0068852_100043509 3300005616 Bacteria 3809
30 Ga0068852_100084201 3300005616 Bacteria 2829
31 Ga0068851_10005303 3300005834 Bacteria 5852
32 Ga0068863_100190843 3300005841 Bacteria 1969
33 Ga0068858_100250493 3300005842 Bacteria 1682
34 Ga0081455_10021555 3300005937 Bacteria 6040
35 Ga0081539_10052959 3300005985 Bacteria 2275
36 Ga0075365_10145628 3300006038 Bacteria 1646
37 Ga0075368_10022514 3300006042 Bacteria 2400
38 Ga0075363_100004062 3300006048 Bacteria 6335
39 Ga0075364_10169692 3300006051 Bacteria 1475
40 Ga0075362_10085084 3300006177 Bacteria 1462
41 Ga0075367_10084619 3300006178 Bacteria 1923
42 Ga0075369_10015872 3300006186 Bacteria 3030
43 Ga0075369_10086171 3300006186 Bacteria 1398
44 Ga0075366_10020715 3300006195 Bacteria 3818
45 Ga0075370_10098302 3300006353 Bacteria 1692
46 Ga0075428_100399177 3300006844 Bacteria 1474
47 Ga0075430_100033493 3300006846 Bacteria 4361
48 Ga0075431_100028094 3300006847 Bacteria 5776
49 Ga0075431_100090195 3300006847 Bacteria 3163
50 Ga0075429_100183252 3300006880 Bacteria 1835
51 Ga0075429_100427801 3300006880 Bacteria 1160
52 Ga0068865_100250854 3300006881 Bacteria 1397
53 Ga0105240_10118905 3300009093 Bacteria 3184
54 Ga0111539_10151449 3300009094 Bacteria 2715
55 Ga0105245_10444480 3300009098 Bacteria 1304
56 Ga0105245_11089499 3300009098 Bacteria 845
57 Ga0114129_10085365 3300009147 Bacteria 4379
58 Ga0114129_10159863 3300009147 Bacteria 3079
59 Ga0114129_10332175 3300009147 Bacteria 2018
60 Ga0105243_10170931 3300009148 Bacteria 1882
61 Ga0105242_10282413 3300009176 Bacteria 1508
62 Ga0105237_10397741 3300009545 Bacteria 1382
63 Ga0105238_10057954 3300009551 Bacteria 3883
64 Ga0105238_10382075 3300009551 Bacteria 1400
65 Ga0105249_10399307 3300009553 Bacteria 1405
66 Ga0105239_10340099 3300010375 Bacteria 1693
67 Ga0105239_10674724 3300010375 Bacteria 1181
68 Ga0105246_10120720 3300011119 Bacteria 1942
69 Ga0105246_10335481 3300011119 Bacteria 1234
70 Ga0157370_10038157 3300013104 Bacteria 4648
71 Ga0171462_1017 3300013250 Bacteria 162931
72 Ga0182005_1018791 3300015265 Bacteria 1909
73 Ga0213874_10003365 3300021377 Bacteria 3540
74 Ga0213874_10004225 3300021377 Bacteria 3252
75 Ga0213876_10003713 3300021384 Bacteria 8657
76 Ga0213876_10019955 3300021384 Bacteria 3540
77 Ga0213875_10000546 3300021388 Bacteria 30849
78 Ga0213875_10070347 3300021388 Bacteria 1633
79 Ga0209130_1000061 3300025284 Bacteria 200990
80 Ga0209676_1021520 3300025292 Bacteria 2163
81 Ga0209025_1000014 3300025294 Bacteria 865448
82 Ga0209025_1001725 3300025294 Bacteria 26430
83 Ga0209025_1054433 3300025294 Bacteria 1558
84 Ga0209564_1000017 3300025295 Bacteria 594063
85 Ga0209564_1000187 3300025295 Bacteria 146950
86 Ga0209256_1000055 3300025299 Bacteria 295530
87 Ga0209256_1000146 3300025299 Bacteria 149440
88 Ga0207656_10056304 3300025321 Bacteria 1714
89 Ga0207688_10048687 3300025901 Bacteria 2368
90 Ga0207695_10094327 3300025913 Bacteria 3000
91 Ga0207671_10534098 3300025914 Bacteria 935
92 Ga0207649_10034802 3300025920 Bacteria 3021
93 Ga0207646_10030637 3300025922 Bacteria 4874
94 Ga0207694_10213504 3300025924 Bacteria 1572
95 Ga0207650_10321339 3300025925 Bacteria 1268
96 Ga0207669_10409705 3300025937 Bacteria 1064
97 Ga0207661_10338773 3300025944 Bacteria 1355
98 Ga0207667_10028609 3300025949 Bacteria 6051
99 Ga0207712_10377703 3300025961 Bacteria 1185
100 Ga0207640_10007141 3300025981 Bacteria 6155
101 Ga0207658_10111008 3300025986 Bacteria 2168
102 Ga0207658_10279860 3300025986 Bacteria 1430
103 Ga0207703_10423004 3300026035 Bacteria 1240
104 Ga0207639_10001485 3300026041 Bacteria 15773
105 Ga0207678_10570127 3300026067 Bacteria 991
106 Ga0207678_10805913 3300026067 Bacteria 829
107 Ga0207708_10304740 3300026075 Bacteria 1296
108 Ga0207674_10216947 3300026116 Bacteria 1861
109 Ga0207698_10014174 3300026142 Bacteria 5289
110 Ga0207698_10397090 3300026142 Bacteria 1317
111 Ga0209813_10055113 3300027866 Bacteria 1255
112 Ga0207428_10313577 3300027907 Bacteria 1159
113 Ga0268266_10150375 3300028379 Bacteria 2098
114 Ga0268265_10596444 3300028380 Bacteria 1055
115 Ga0265318_10006591 3300028577 Bacteria 5329
116 Ga0307515_10289037 3300028794 Bacteria 1337
117 Ga0265338_10052801 3300028800 Bacteria 3643
118 Ga0265330_10032046 3300031235 Bacteria 2356
119 Ga0265330_10105397 3300031235 Bacteria 1206
120 Ga0265332_10080740 3300031238 Bacteria 1380
121 Ga0265328_10045931 3300031239 Bacteria 1606
122 Ga0265325_10014901 3300031241 Bacteria 4383
123 Ga0265325_10044117 3300031241 Bacteria 2324
124 Ga0265325_10058139 3300031241 Bacteria 1970
125 Ga0265329_10064757 3300031242 Bacteria 1157
126 Ga0265340_10000659 3300031247 Bacteria 19392
127 Ga0265340_10013408 3300031247 Bacteria 4303
128 Ga0265340_10039508 3300031247 Bacteria 2328
129 Ga0265340_10079151 3300031247 Bacteria 1549
130 Ga0265340_10102431 3300031247 Bacteria 1329
131 Ga0265339_10001609 3300031249 Bacteria 16693
132 Ga0265339_10003971 3300031249 Bacteria 10214
133 Ga0265339_10020124 3300031249 Bacteria 3903
134 Ga0265339_10047833 3300031249 Bacteria 2348
135 Ga0265331_10142590 3300031250 Bacteria 1089
136 Ga0265327_10028728 3300031251 Bacteria 3173
137 Ga0265316_10009504 3300031344 Bacteria 8952
138 Ga0265316_10149070 3300031344 Bacteria 1753
139 Ga0265316_10153121 3300031344 Bacteria 1727
140 Ga0265316_10531454 3300031344 Bacteria 838
141 Ga0307408_100013896 3300031548 Bacteria 5346
142 Ga0265313_10000044 3300031595 Bacteria 117063
143 Ga0265313_10002138 3300031595 Bacteria 17573
144 Ga0265313_10008366 3300031595 Bacteria 6882
145 Ga0265314_10053156 3300031711 Bacteria 2811
146 Ga0265314_10070137 3300031711 Bacteria 2349
147 Ga0265314_10087676 3300031711 Bacteria 2034
148 Ga0265314_10188349 3300031711 Bacteria 1230
149 Ga0265342_10001734 3300031712 Bacteria 19908
150 Ga0265342_10006874 3300031712 Bacteria 8408
151 Ga0316576_10051635 3300031727 Bacteria 2993
152 Ga0307405_10238630 3300031731 Bacteria 1345
153 Ga0307406_10067079 3300031901 Bacteria 2338
154 Ga0307406_10658420 3300031901 Bacteria 870
155 Ga0307407_10188600 3300031903 Bacteria 1372
156 Ga0307416_100753663 3300032002 Bacteria 1066
157 Ga0307414_10107154 3300032004 Bacteria 2117
158 Ga0307414_10772463 3300032004 Bacteria 875
159 Ga0373944_0053891 3300035089 Bacteria 1274
160 Ga0316584_0004750 3300036712 Bacteria 9009
161 Ga0373925_0165779 3300037068 Bacteria 1742
162 Ga0395898_0523978 3300037466 Bacteria 1126
163 Ga0395905_0077325 3300037471 Bacteria 3118
164 Ga0436364_0050253 3300037853 Bacteria 9814
165 Ga0436364_1087216 3300037853 Bacteria 3284
166 Ga0400483_012342 3300039062 Bacteria 2396
167 Ga0436365_0153260 3300039437 Bacteria 71630
168 Ga0436365_0443992 3300039437 Bacteria 12487
169 Ga0436361_0267469 3300039447 Bacteria 5289
170 Ga0436361_1142413 3300039447 Bacteria 3302
171 Ga0436363_0631607 3300039450 Bacteria 7298
172 Ga0436363_0671430 3300039450 Bacteria 8281
173 Ga0436363_1147967 3300039450 Bacteria 4524
174 Ga0436362_1211152 3300039453 Bacteria 13135
175 Ga0466972_0169551 3300044658 Bacteria 1025
176 Ga0466968_0092582 3300044735 Bacteria 1341
177 Ga0466957_0231765 3300044842 Bacteria 1223
178 Ga0466960_0082420 3300044901 Bacteria 1624
179 Ga0451576_0005315 3300045051 Bacteria 16187
180 Ga0495643_0149868 3300046522 Bacteria 1156
181 Ga0495647_0005048 3300046681 Bacteria 4320
182 Ga0495660_0156029 3300046810 Bacteria 1123
183 Ga0496106_0052733 3300048909 Bacteria 3070
184 Ga0496110_0220267 3300048913 Bacteria 1726
185 Ga0496110_0646912 3300048913 Bacteria 957
186 Ga0496113_0609577 3300048916 Bacteria 874
187 Ga0496117_0010206 3300048920 Bacteria 8607
188 Ga0496117_0012345 3300048920 Bacteria 7539
189 Ga0496121_0285084 3300048924 Bacteria 1128
190 Ga0496122_0044754 3300048925 Bacteria 3450
191 Ga0496122_0093650 3300048925 Bacteria 2037
192 Ga0496123_0077015 3300048926 Bacteria 2050
193 Ga0496124_0509507 3300048927 Bacteria 805
194 Ga0496125_0044340 3300048928 Bacteria 3763
195 Ga0496126_0042917 3300048929 Bacteria 4175
196 Ga0501031_0022263 3300049568 Bacteria 4130
197 Ga0501031_0042130 3300049568 Bacteria 2981
198 Ga0501032_0015271 3300049569 Bacteria 5422
199 Ga0501033_0017860 3300049570 Bacteria 5355
200 Ga0501033_0228738 3300049570 Bacteria 1322
201 Ga0501033_0558365 3300049570 Bacteria 788
202 Ga0501034_0014615 3300049571 Bacteria 8083
203 Ga0501034_0130159 3300049571 Bacteria 2500
204 Ga0501034_0131393 3300049571 Bacteria 2487
205 Ga0501034_0157981 3300049571 Bacteria 2240
206 Ga0501034_0207748 3300049571 Bacteria 1914
207 Ga0501034_0217412 3300049571 Bacteria 1864
208 Ga0501034_0239837 3300049571 Bacteria 1759
209 Ga0501034_0310946 3300049571 Bacteria 1510
210 Ga0501034_0631443 3300049571 Bacteria 974
211 Ga0501036_0024298 3300049572 Bacteria 5108
212 Ga0501037_0050647 3300049573 Bacteria 3038
213 Ga0501037_0305395 3300049573 Bacteria 1104
214 Ga0501038_0038955 3300049574 Bacteria 4160
215 Ga0501038_0044624 3300049574 Bacteria 3850
216 Ga0501038_0074603 3300049574 Bacteria 2869
217 Ga0501039_0040128 3300049575 Bacteria 3615
218 Ga0501039_0271025 3300049575 Bacteria 1334
219 Ga0501040_0006381 3300049576 Bacteria 7655
220 Ga0501041_0006371 3300049577 Bacteria 6908
221 Ga0501042_0653673 3300049578 Bacteria 764
222 Ga0501043_0096566 3300049579 Bacteria 2323
223 Ga0501043_0163259 3300049579 Bacteria 1740
224 Ga0501046_0017085 3300049580 Bacteria 6064
225 Ga0501046_0080931 3300049580 Bacteria 2509
226 Ga0501047_0021533 3300049581 Bacteria 6191
227 Ga0501047_0031861 3300049581 Bacteria 5087
228 Ga0501047_0132567 3300049581 Bacteria 2372
229 Ga0501047_0151362 3300049581 Bacteria 2196
230 Ga0501047_0162913 3300049581 Bacteria 2102
231 Ga0501048_0044347 3300049582 Bacteria 3180
232 Ga0501067_0005232 3300049583 Bacteria 7212
233 Ga0501067_0022441 3300049583 Bacteria 3493
234 Ga0501067_0092987 3300049583 Bacteria 1674
235 Ga0501068_0129628 3300049584 Bacteria 1577
236 Ga0501069_0059922 3300049585 Bacteria 2125
237 Ga0501070_0020034 3300049586 Bacteria 5608
238 Ga0501070_0103803 3300049586 Bacteria 2351
239 Ga0501070_0151928 3300049586 Bacteria 1910
240 Ga0501071_0093896 3300049587 Bacteria 2206
241 Ga0501072_0111163 3300049588 Bacteria 2181
242 Ga0501073_0006551 3300049589 Bacteria 8666
243 Ga0501073_0014278 3300049589 Bacteria 5768
244 Ga0501073_0044656 3300049589 Bacteria 3123
245 Ga0501073_0379670 3300049589 Bacteria 976
246 Ga0501074_0067527 3300049590 Bacteria 2571
247 Ga0501074_0200999 3300049590 Bacteria 1420
248 Ga0501075_0006277 3300049591 Bacteria 8172
249 Ga0501076_0030587 3300049592 Bacteria 4194
250 Ga0501076_0085170 3300049592 Bacteria 2539
251 Ga0501077_0030036 3300049593 Bacteria 3457
252 Ga0501077_0073588 3300049593 Bacteria 2165
253 Ga0501077_0280304 3300049593 Bacteria 1061
254 Ga0501079_0035848 3300049741 Bacteria 3819
255 Ga0501080_0063759 3300049742 Bacteria 3429
256 Ga0501080_0089851 3300049742 Bacteria 2853
257 Ga0501080_0284026 3300049742 Bacteria 1504
258 Ga0501080_0427989 3300049742 Bacteria 1188
259 Ga0501080_0733994 3300049742 Bacteria 869
260 Ga0501083_0015403 3300049744 Bacteria 5354
261 Ga0501083_0043181 3300049744 Bacteria 3054
262 Ga0501083_0063780 3300049744 Bacteria 2457
263 Ga0501083_0211330 3300049744 Bacteria 1265
264 Ga0501035_0023558 3300049822 Bacteria 5648
265 Ga0501035_0179454 3300049822 Bacteria 1825
266 Ga0501035_0381243 3300049822 Bacteria 1176
267 Ga0501035_0442562 3300049822 Unclassified 1076
268 Ga0501035_0494989 3300049822 Bacteria 1007
269 Ga0501044_0318500 3300049823 Bacteria 1480
270 Ga0501044_0405758 3300049823 Bacteria 1275
271 Ga0501044_0624422 3300049823 Bacteria 969
272 Ga0501045_0001697 3300049824 Bacteria 14839
273 nmdc:mga00v17_484857_c1 3300050491 Bacteria 802
274 nmdc:mga04h51_15391_c1 3300050495 Bacteria 2203
275 nmdc:mga07m45_99677_c1 3300050496 Bacteria 1668
276 nmdc:mga05p37_16255_c1 3300050507 Bacteria 8959
277 nmdc:mga05p37_39491_c1 3300050507 Bacteria 5795
278 nmdc:mga09592_142496_c1 3300050508 Bacteria 2066
279 nmdc:mga09592_571262_c1 3300050508 Bacteria 970
280 nmdc:mga06r32_353341_c1 3300050510 Bacteria 1454
281 nmdc:mga06r32_7910_c1 3300050510 Bacteria 9558
282 nmdc:mga0n895_213740_c1 3300050512 Bacteria 1958
283 Ga0500562_010718 3300053108 Bacteria 2324
284 Ga0500559_0007063 3300053136 Bacteria 5008
285 Ga0500577_0006923 3300053142 Bacteria 3152
286 Ga0500604_0000059 3300053151 Bacteria 39804
287 Ga0500616_0025364 3300053153 Bacteria 3289
288 Ga0500616_0102400 3300053153 Bacteria 1397
289 Ga0500616_0113984 3300053153 Bacteria 1301
290 Ga0500622_0020473 3300053156 Bacteria 3512
291 Ga0500627_0064460 3300053158 Bacteria 1616
292 Ga0500636_0003354 3300053177 Bacteria 9008
293 Ga0501084_0000538 3300054114 Bacteria 28891
294 Ga0501084_0047613 3300054114 Bacteria 3591
295 Ga0501084_0227364 3300054114 Bacteria 1574
296 Ga0501084_0564452 3300054114 Bacteria 962
297 Ga0501082_0001138 3300060353 Bacteria 23485
298 Ga0501082_0017083 3300060353 Bacteria 6251
299 Ga0501082_0085368 3300060353 Bacteria 2722
300 Ga0501082_0197545 3300060353 Bacteria 1750
301 Ga0501082_0218508 3300060353 Bacteria 1658
302 Ga0501082_0228953 3300060353 Bacteria 1618
303 Ga0530510_0118253 3300061734 Bacteria 1944
304 Ga0530510_0423983 3300061734 Bacteria 1004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10021555 Ga0081455_100215552 194
2 3300005539 Ga0068853_100067298 Ga0068853_1000672983 217
3 3300053153 Ga0500616_0102400 Ga0500616_0102400_132_851 224
4 3300049589 Ga0501073_0044656 Ga0501073_0044656_1747_2472 225
5 3300003323 rootH1_10011432 rootH1_100114321 228
6 3300025913 Ga0207695_10094327 Ga0207695_100943272 230
7 3300049573 Ga0501037_0305395 Ga0501037_0305395_61_765 230
8 3300053108 Ga0500562_010718 Ga0500562_010718_1526_2245 230
9 iso_pu_bacteria 2884298095 2884300315 231
10 iso_pu_bacteria 2917554339 2917557065 231
11 3300005367 Ga0070667_100167070 Ga0070667_1001670702 232
12 3300005468 Ga0070707_100028623 Ga0070707_1000286235 232
13 3300009147 Ga0114129_10332175 Ga0114129_103321752 232
14 3300009176 Ga0105242_10282413 Ga0105242_102824132 232
15 3300025922 Ga0207646_10030637 Ga0207646_100306373 232
16 3300025986 Ga0207658_10111008 Ga0207658_101110082 232
17 3300025986 Ga0207658_10279860 Ga0207658_102798602 232
18 3300026067 Ga0207678_10570127 Ga0207678_105701272 232
19 3300045051 Ga0451576_0005315 Ga0451576_0005315_7128_7856 232
20 iso_pu_bacteria 2523231067 2523467104 232
21 iso_pu_bacteria 2643221629 2644166321 232
22 iso_pu_bacteria 2643221662 2644346674 232
23 iso_pu_bacteria 2738543031 2739347533 232
24 iso_pu_bacteria 2909042592 2909045975 232
25 iso_pu_bacteria 3003665799 3003667335 232
26 iso_pu_bacteria 2643221580 2643910308 233
27 iso_pu_bacteria 2643221674 2644410776 233
28 iso_pu_bacteria 2919450847 2919455899 233
29 iso_pu_bacteria 2932401849 2932403583 233
30 iso_pu_bacteria 2939669807 2939670768 233
31 iso_pu_bacteria 8001845381 8001849480 233
32 3300005841 Ga0068863_100190843 Ga0068863_1001908432 234
33 3300009098 Ga0105245_11089499 Ga0105245_110894991 234
34 3300035089 Ga0373944_0053891 Ga0373944_0053891_333_1052 234
35 3300037068 Ga0373925_0165779 Ga0373925_0165779_300_1019 234
36 3300046681 Ga0495647_0005048 Ga0495647_0005048_3490_4209 234
37 3300049744 Ga0501083_0211330 Ga0501083_0211330_498_1211 234
38 3300054114 Ga0501084_0564452 Ga0501084_0564452_55_765 234
39 iso_pu_bacteria 2508501050 2508733014 234
40 iso_pu_bacteria 2508501114 2509078802 234
41 iso_pu_bacteria 2643221733 2644729866 234
42 iso_pu_bacteria 2643221734 2644735812 234
43 iso_pu_bacteria 2643221736 2644746917 234
44 iso_pu_bacteria 2773857925 2774869937 234
45 iso_pu_bacteria 2775506901 2776260069 234
46 iso_pu_bacteria 2818991467 2819718252 234
47 iso_pu_bacteria 2835312727 2835317296 234
48 iso_pu_bacteria 2841760612 2841762347 234
49 iso_pu_bacteria 2841911363 2841911992 234
50 iso_pu_bacteria 2841917233 2841922886 234
51 iso_pu_bacteria 2844104063 2844109885 234
52 iso_pu_bacteria 2851182111 2851186914 234
53 iso_pu_bacteria 2851246043 2851248360 234
54 iso_pu_bacteria 2882456835 2882461430 234
55 iso_pu_bacteria 2894232714 2894234058 234
56 iso_pu_bacteria 2917699015 2917699777 234
57 iso_pu_bacteria 8057529695 8057535500 234
58 3300003320 rootH2_10130842 rootH2_101308424 235
59 3300005546 Ga0070696_100030634 Ga0070696_1000306343 235
60 3300006844 Ga0075428_100399177 Ga0075428_1003991772 235
61 3300006846 Ga0075430_100033493 Ga0075430_1000334933 235
62 3300006847 Ga0075431_100028094 Ga0075431_1000280944 235
63 3300006847 Ga0075431_100090195 Ga0075431_1000901951 235
64 3300006880 Ga0075429_100183252 Ga0075429_1001832521 235
65 3300009093 Ga0105240_10118905 Ga0105240_101189052 235
66 3300009098 Ga0105245_10444480 Ga0105245_104444802 235
67 3300009147 Ga0114129_10085365 Ga0114129_100853655 235
68 3300009147 Ga0114129_10159863 Ga0114129_101598634 235
69 3300010375 Ga0105239_10340099 Ga0105239_103400992 235
70 3300027907 Ga0207428_10313577 Ga0207428_103135772 235
71 3300031235 Ga0265330_10032046 Ga0265330_100320463 235
72 3300031235 Ga0265330_10105397 Ga0265330_101053972 235
73 3300031239 Ga0265328_10045931 Ga0265328_100459312 235
74 3300031241 Ga0265325_10044117 Ga0265325_100441173 235
75 3300031241 Ga0265325_10058139 Ga0265325_100581392 235
76 3300031242 Ga0265329_10064757 Ga0265329_100647572 235
77 3300031247 Ga0265340_10000659 Ga0265340_1000065913 235
78 3300031247 Ga0265340_10013408 Ga0265340_100134082 235
79 3300031247 Ga0265340_10102431 Ga0265340_101024312 235
80 3300031249 Ga0265339_10001609 Ga0265339_1000160920 235
81 3300031250 Ga0265331_10142590 Ga0265331_101425902 235
82 3300031344 Ga0265316_10009504 Ga0265316_100095046 235
83 3300031595 Ga0265313_10002138 Ga0265313_1000213816 235
84 3300031595 Ga0265313_10008366 Ga0265313_100083666 235
85 3300031711 Ga0265314_10087676 Ga0265314_100876761 235
86 3300031711 Ga0265314_10188349 Ga0265314_101883492 235
87 3300031712 Ga0265342_10001734 Ga0265342_1000173410 235
88 3300031712 Ga0265342_10006874 Ga0265342_100068744 235
89 3300031727 Ga0316576_10051635 Ga0316576_100516353 235
90 3300036712 Ga0316584_0004750 Ga0316584_0004750_4392_5111 235
91 3300039062 Ga0400483_012342 Ga0400483_012342_659_1378 235
92 3300044658 Ga0466972_0169551 Ga0466972_0169551_287_1000 235
93 3300048909 Ga0496106_0052733 Ga0496106_0052733_303_1028 235
94 3300048913 Ga0496110_0220267 Ga0496110_0220267_418_1143 235
95 3300049568 Ga0501031_0022263 Ga0501031_0022263_1371_2087 235
96 3300049569 Ga0501032_0015271 Ga0501032_0015271_1782_2498 235
97 3300049570 Ga0501033_0017860 Ga0501033_0017860_1492_2208 235
98 3300049571 Ga0501034_0157981 Ga0501034_0157981_273_995 235
99 3300049571 Ga0501034_0631443 Ga0501034_0631443_109_819 235
100 3300049572 Ga0501036_0024298 Ga0501036_0024298_314_1030 235
101 3300049573 Ga0501037_0050647 Ga0501037_0050647_1136_1852 235
102 3300049574 Ga0501038_0038955 Ga0501038_0038955_1982_2701 235
103 3300049574 Ga0501038_0044624 Ga0501038_0044624_2595_3311 235
104 3300049575 Ga0501039_0271025 Ga0501039_0271025_159_875 235
105 3300049576 Ga0501040_0006381 Ga0501040_0006381_1989_2708 235
106 3300049577 Ga0501041_0006371 Ga0501041_0006371_3826_4545 235
107 3300049579 Ga0501043_0096566 Ga0501043_0096566_563_1285 235
108 3300049579 Ga0501043_0163259 Ga0501043_0163259_334_1050 235
109 3300049580 Ga0501046_0017085 Ga0501046_0017085_1286_2005 235
110 3300049581 Ga0501047_0021533 Ga0501047_0021533_3068_3784 235
111 3300049581 Ga0501047_0162913 Ga0501047_0162913_246_965 235
112 3300049582 Ga0501048_0044347 Ga0501048_0044347_1456_2175 235
113 3300049583 Ga0501067_0005232 Ga0501067_0005232_3388_4101 235
114 3300049583 Ga0501067_0022441 Ga0501067_0022441_87_800 235
115 3300049583 Ga0501067_0092987 Ga0501067_0092987_866_1585 235
116 3300049584 Ga0501068_0129628 Ga0501068_0129628_375_1097 235
117 3300049586 Ga0501070_0020034 Ga0501070_0020034_1756_2472 235
118 3300049586 Ga0501070_0103803 Ga0501070_0103803_306_1016 235
119 3300049586 Ga0501070_0151928 Ga0501070_0151928_382_1104 235
120 3300049587 Ga0501071_0093896 Ga0501071_0093896_547_1266 235
121 3300049589 Ga0501073_0014278 Ga0501073_0014278_2184_2897 235
122 3300049589 Ga0501073_0379670 Ga0501073_0379670_75_788 235
123 3300049590 Ga0501074_0067527 Ga0501074_0067527_1702_2424 235
124 3300049591 Ga0501075_0006277 Ga0501075_0006277_2986_3705 235
125 3300049592 Ga0501076_0030587 Ga0501076_0030587_83_802 235
126 3300049592 Ga0501076_0085170 Ga0501076_0085170_493_1206 235
127 3300049593 Ga0501077_0030036 Ga0501077_0030036_1394_2113 235
128 3300049593 Ga0501077_0073588 Ga0501077_0073588_538_1260 235
129 3300049593 Ga0501077_0280304 Ga0501077_0280304_188_901 235
130 3300049741 Ga0501079_0035848 Ga0501079_0035848_2842_3561 235
131 3300049742 Ga0501080_0284026 Ga0501080_0284026_592_1302 235
132 3300049742 Ga0501080_0427989 Ga0501080_0427989_179_895 235
133 3300049742 Ga0501080_0733994 Ga0501080_0733994_132_842 235
134 3300049744 Ga0501083_0015403 Ga0501083_0015403_2822_3535 235
135 3300049744 Ga0501083_0043181 Ga0501083_0043181_1598_2311 235
136 3300049744 Ga0501083_0063780 Ga0501083_0063780_472_1191 235
137 3300049822 Ga0501035_0023558 Ga0501035_0023558_3163_3879 235
138 3300049822 Ga0501035_0381243 Ga0501035_0381243_87_797 235
139 3300049822 Ga0501035_0442562 Ga0501035_0442562_224_943 235
140 3300049823 Ga0501044_0318500 Ga0501044_0318500_66_776 235
141 3300049824 Ga0501045_0001697 Ga0501045_0001697_859_1578 235
142 3300050507 nmdc:mga05p37_16255_c1 nmdc:mga05p37_16255_c1_6213_6938 235
143 3300050507 nmdc:mga05p37_39491_c1 nmdc:mga05p37_39491_c1_4202_4921 235
144 3300050508 nmdc:mga09592_142496_c1 nmdc:mga09592_142496_c1_1098_1817 235
145 3300050510 nmdc:mga06r32_353341_c1 nmdc:mga06r32_353341_c1_405_1130 235
146 3300050510 nmdc:mga06r32_7910_c1 nmdc:mga06r32_7910_c1_781_1506 235
147 3300050512 nmdc:mga0n895_213740_c1 nmdc:mga0n895_213740_c1_1223_1948 235
148 3300054114 Ga0501084_0000538 Ga0501084_0000538_16418_17137 235
149 3300054114 Ga0501084_0047613 Ga0501084_0047613_1029_1742 235
150 3300054114 Ga0501084_0227364 Ga0501084_0227364_574_1296 235
151 3300060353 Ga0501082_0001138 Ga0501082_0001138_18367_19086 235
152 3300060353 Ga0501082_0017083 Ga0501082_0017083_3443_4156 235
153 3300060353 Ga0501082_0085368 Ga0501082_0085368_959_1681 235
154 3300060353 Ga0501082_0197545 Ga0501082_0197545_481_1194 235
155 3300060353 Ga0501082_0218508 Ga0501082_0218508_650_1363 235
156 3300060353 Ga0501082_0228953 Ga0501082_0228953_875_1588 235
157 3300061734 Ga0530510_0118253 Ga0530510_0118253_301_1020 235
158 3300061734 Ga0530510_0423983 Ga0530510_0423983_58_771 235
159 3300005842 Ga0068858_100250493 Ga0068858_1002504932 236
160 3300006186 Ga0075369_10015872 Ga0075369_100158723 236
161 3300006880 Ga0075429_100427801 Ga0075429_1004278011 236
162 3300009545 Ga0105237_10397741 Ga0105237_103977412 236
163 3300015265 Ga0182005_1018791 Ga0182005_10187912 236
164 3300021377 Ga0213874_10003365 Ga0213874_100033654 236
165 3300025914 Ga0207671_10534098 Ga0207671_105340982 236
166 3300026035 Ga0207703_10423004 Ga0207703_104230042 236
167 3300028577 Ga0265318_10006591 Ga0265318_100065913 236
168 3300031247 Ga0265340_10039508 Ga0265340_100395082 236
169 3300031247 Ga0265340_10079151 Ga0265340_100791512 236
170 3300031249 Ga0265339_10020124 Ga0265339_100201243 236
171 3300031249 Ga0265339_10047833 Ga0265339_100478333 236
172 3300031251 Ga0265327_10028728 Ga0265327_100287282 236
173 3300031344 Ga0265316_10149070 Ga0265316_101490702 236
174 3300031344 Ga0265316_10153121 Ga0265316_101531211 236
175 3300031711 Ga0265314_10053156 Ga0265314_100531564 236
176 3300031711 Ga0265314_10070137 Ga0265314_100701371 236
177 3300032004 Ga0307414_10772463 Ga0307414_107724631 236
178 3300039447 Ga0436361_0267469 Ga0436361_0267469_320_1039 236
179 3300039447 Ga0436361_1142413 Ga0436361_1142413_354_1073 236
180 3300039450 Ga0436363_0671430 Ga0436363_0671430_6137_6847 236
181 3300044842 Ga0466957_0231765 Ga0466957_0231765_353_1072 236
182 3300048924 Ga0496121_0285084 Ga0496121_0285084_308_1021 236
183 3300049568 Ga0501031_0042130 Ga0501031_0042130_1470_2183 236
184 3300049571 Ga0501034_0014615 Ga0501034_0014615_206_916 236
185 3300049571 Ga0501034_0130159 Ga0501034_0130159_1119_1844 236
186 3300049571 Ga0501034_0217412 Ga0501034_0217412_677_1399 236
187 3300049574 Ga0501038_0074603 Ga0501038_0074603_1204_1926 236
188 3300049575 Ga0501039_0040128 Ga0501039_0040128_2063_2776 236
189 3300049578 Ga0501042_0653673 Ga0501042_0653673_37_750 236
190 3300049580 Ga0501046_0080931 Ga0501046_0080931_1673_2386 236
191 3300049581 Ga0501047_0132567 Ga0501047_0132567_635_1357 236
192 3300049581 Ga0501047_0151362 Ga0501047_0151362_520_1242 236
193 3300049585 Ga0501069_0059922 Ga0501069_0059922_105_827 236
194 3300049588 Ga0501072_0111163 Ga0501072_0111163_702_1415 236
195 3300049589 Ga0501073_0006551 Ga0501073_0006551_3215_3946 236
196 3300049590 Ga0501074_0200999 Ga0501074_0200999_687_1409 236
197 3300049742 Ga0501080_0063759 Ga0501080_0063759_1028_1753 236
198 3300049742 Ga0501080_0089851 Ga0501080_0089851_1159_1881 236
199 3300049822 Ga0501035_0179454 Ga0501035_0179454_899_1621 236
200 3300050508 nmdc:mga09592_571262_c1 nmdc:mga09592_571262_c1_217_951 236
201 3300053136 Ga0500559_0007063 Ga0500559_0007063_1628_2344 236
202 3300053153 Ga0500616_0025364 Ga0500616_0025364_1211_1921 236
203 3300053158 Ga0500627_0064460 Ga0500627_0064460_201_911 236
204 3300003320 rootH2_10032659 rootH2_100326592 237
205 3300005340 Ga0070689_100299890 Ga0070689_1002998901 237
206 3300005344 Ga0070661_100006085 Ga0070661_1000060855 237
207 3300005436 Ga0070713_100544000 Ga0070713_1005440002 237
208 3300005437 Ga0070710_10261454 Ga0070710_102614541 237
209 3300005441 Ga0070700_100555056 Ga0070700_1005550561 237
210 3300005457 Ga0070662_100315367 Ga0070662_1003153672 237
211 3300005539 Ga0068853_100003971 Ga0068853_1000039715 237
212 3300005539 Ga0068853_100453899 Ga0068853_1004538992 237
213 3300005548 Ga0070665_100023259 Ga0070665_1000232592 237
214 3300005563 Ga0068855_100059971 Ga0068855_1000599714 237
215 3300005563 Ga0068855_100834512 Ga0068855_1008345121 237
216 3300005577 Ga0068857_100370293 Ga0068857_1003702931 237
217 3300005578 Ga0068854_100076816 Ga0068854_1000768163 237
218 3300005578 Ga0068854_100096019 Ga0068854_1000960191 237
219 3300005616 Ga0068852_100043509 Ga0068852_1000435092 237
220 3300005616 Ga0068852_100084201 Ga0068852_1000842011 237
221 3300005834 Ga0068851_10005303 Ga0068851_100053032 237
222 3300005985 Ga0081539_10052959 Ga0081539_100529593 237
223 3300006177 Ga0075362_10085084 Ga0075362_100850842 237
224 3300006881 Ga0068865_100250854 Ga0068865_1002508541 237
225 3300009094 Ga0111539_10151449 Ga0111539_101514494 237
226 3300009148 Ga0105243_10170931 Ga0105243_101709314 237
227 3300009551 Ga0105238_10057954 Ga0105238_100579543 237
228 3300009551 Ga0105238_10382075 Ga0105238_103820752 237
229 3300009553 Ga0105249_10399307 Ga0105249_103993072 237
230 3300010375 Ga0105239_10674724 Ga0105239_106747241 237
231 3300011119 Ga0105246_10120720 Ga0105246_101207202 237
232 3300011119 Ga0105246_10335481 Ga0105246_103354812 237
233 3300021377 Ga0213874_10004225 Ga0213874_100042254 237
234 3300021384 Ga0213876_10003713 Ga0213876_100037132 237
235 3300021384 Ga0213876_10019955 Ga0213876_100199553 237
236 3300021388 Ga0213875_10000546 Ga0213875_100005465 237
237 3300021388 Ga0213875_10070347 Ga0213875_100703472 237
238 3300025321 Ga0207656_10056304 Ga0207656_100563042 237
239 3300025901 Ga0207688_10048687 Ga0207688_100486874 237
240 3300025920 Ga0207649_10034802 Ga0207649_100348022 237
241 3300025924 Ga0207694_10213504 Ga0207694_102135042 237
242 3300025925 Ga0207650_10321339 Ga0207650_103213391 237
243 3300025937 Ga0207669_10409705 Ga0207669_104097052 237
244 3300025944 Ga0207661_10338773 Ga0207661_103387732 237
245 3300025949 Ga0207667_10028609 Ga0207667_100286098 237
246 3300025961 Ga0207712_10377703 Ga0207712_103777031 237
247 3300025981 Ga0207640_10007141 Ga0207640_100071414 237
248 3300026041 Ga0207639_10001485 Ga0207639_1000148517 237
249 3300026067 Ga0207678_10805913 Ga0207678_108059131 237
250 3300026075 Ga0207708_10304740 Ga0207708_103047402 237
251 3300026116 Ga0207674_10216947 Ga0207674_102169472 237
252 3300026142 Ga0207698_10014174 Ga0207698_100141744 237
253 3300026142 Ga0207698_10397090 Ga0207698_103970901 237
254 3300028379 Ga0268266_10150375 Ga0268266_101503752 237
255 3300028380 Ga0268265_10596444 Ga0268265_105964441 237
256 3300028800 Ga0265338_10052801 Ga0265338_100528013 237
257 3300031238 Ga0265332_10080740 Ga0265332_100807402 237
258 3300031241 Ga0265325_10014901 Ga0265325_100149012 237
259 3300031249 Ga0265339_10003971 Ga0265339_100039713 237
260 3300031344 Ga0265316_10531454 Ga0265316_105314542 237
261 3300031548 Ga0307408_100013896 Ga0307408_1000138966 237
262 3300031595 Ga0265313_10000044 Ga0265313_1000004469 237
263 3300031731 Ga0307405_10238630 Ga0307405_102386302 237
264 3300031901 Ga0307406_10067079 Ga0307406_100670792 237
265 3300031903 Ga0307407_10188600 Ga0307407_101886002 237
266 3300032002 Ga0307416_100753663 Ga0307416_1007536631 237
267 3300032004 Ga0307414_10107154 Ga0307414_101071542 237
268 3300037471 Ga0395905_0077325 Ga0395905_0077325_1965_2693 237
269 3300037853 Ga0436364_0050253 Ga0436364_0050253_3733_4446 237
270 3300037853 Ga0436364_1087216 Ga0436364_1087216_607_1326 237
271 3300039437 Ga0436365_0153260 Ga0436365_0153260_60986_61699 237
272 3300039437 Ga0436365_0443992 Ga0436365_0443992_1997_2710 237
273 3300039450 Ga0436363_0631607 Ga0436363_0631607_4904_5617 237
274 3300039450 Ga0436363_1147967 Ga0436363_1147967_2482_3201 237
275 3300039453 Ga0436362_1211152 Ga0436362_1211152_6489_7202 237
276 3300044735 Ga0466968_0092582 Ga0466968_0092582_63_776 237
277 3300044901 Ga0466960_0082420 Ga0466960_0082420_274_1002 237
278 3300048916 Ga0496113_0609577 Ga0496113_0609577_29_742 237
279 3300048927 Ga0496124_0509507 Ga0496124_0509507_26_739 237
280 3300048929 Ga0496126_0042917 Ga0496126_0042917_1732_2448 237
281 3300049570 Ga0501033_0228738 Ga0501033_0228738_257_970 237
282 3300049571 Ga0501034_0131393 Ga0501034_0131393_1723_2436 237
283 3300049571 Ga0501034_0207748 Ga0501034_0207748_951_1664 237
284 3300049571 Ga0501034_0310946 Ga0501034_0310946_106_819 237
285 3300049581 Ga0501047_0031861 Ga0501047_0031861_2907_3620 237
286 3300049823 Ga0501044_0624422 Ga0501044_0624422_205_930 237
287 3300053151 Ga0500604_0000059 Ga0500604_0000059_28086_28802 237
288 3300002987 JGI25159J45721_1005862 JGI25159J45721_10058625 238
289 3300003187 JGI25151J46595_10000063 JGI25151J46595_1000006335 238
290 3300003771 Ga0055526_1000091 Ga0055526_100009144 238
291 3300003771 Ga0055526_1000202 Ga0055526_100020217 238
292 3300003775 Ga0055524_1000144 Ga0055524_100014443 238
293 3300003775 Ga0055524_1025202 Ga0055524_10252021 238
294 3300005262 Ga0065165_1000393 Ga0065165_100039345 238
295 3300006038 Ga0075365_10145628 Ga0075365_101456282 238
296 3300006042 Ga0075368_10022514 Ga0075368_100225142 238
297 3300006048 Ga0075363_100004062 Ga0075363_1000040623 238
298 3300006051 Ga0075364_10169692 Ga0075364_101696922 238
299 3300006178 Ga0075367_10084619 Ga0075367_100846193 238
300 3300006186 Ga0075369_10086171 Ga0075369_100861712 238
301 3300006195 Ga0075366_10020715 Ga0075366_100207154 238
302 3300006353 Ga0075370_10098302 Ga0075370_100983022 238
303 3300013104 Ga0157370_10038157 Ga0157370_100381574 238
304 3300013250 Ga0171462_1017 Ga0171462_1017140 238
305 3300025284 Ga0209130_1000061 Ga0209130_100006147 238
306 3300025292 Ga0209676_1021520 Ga0209676_10215202 238
307 3300025294 Ga0209025_1000014 Ga0209025_1000014538 238
308 3300025294 Ga0209025_1001725 Ga0209025_10017252 238
309 3300025294 Ga0209025_1054433 Ga0209025_10544332 238
310 3300025295 Ga0209564_1000017 Ga0209564_100001788 238
311 3300025295 Ga0209564_1000187 Ga0209564_100018745 238
312 3300025299 Ga0209256_1000055 Ga0209256_1000055246 238
313 3300025299 Ga0209256_1000146 Ga0209256_100014612 238
314 3300027866 Ga0209813_10055113 Ga0209813_100551132 238
315 3300028794 Ga0307515_10289037 Ga0307515_102890371 238
316 3300031901 Ga0307406_10658420 Ga0307406_106584201 238
317 3300037466 Ga0395898_0523978 Ga0395898_0523978_284_1009 238
318 3300046522 Ga0495643_0149868 Ga0495643_0149868_355_1071 238
319 3300046810 Ga0495660_0156029 Ga0495660_0156029_298_1014 238
320 3300048913 Ga0496110_0646912 Ga0496110_0646912_40_756 238
321 3300048920 Ga0496117_0010206 Ga0496117_0010206_2087_2803 238
322 3300048920 Ga0496117_0012345 Ga0496117_0012345_1059_1775 238
323 3300048925 Ga0496122_0044754 Ga0496122_0044754_1821_2675 238
324 3300048925 Ga0496122_0093650 Ga0496122_0093650_1191_1982 238
325 3300048926 Ga0496123_0077015 Ga0496123_0077015_19_735 238
326 3300048928 Ga0496125_0044340 Ga0496125_0044340_1300_2016 238
327 3300049570 Ga0501033_0558365 Ga0501033_0558365_12_728 238
328 3300049571 Ga0501034_0239837 Ga0501034_0239837_282_998 238
329 3300049822 Ga0501035_0494989 Ga0501035_0494989_134_850 238
330 3300049823 Ga0501044_0405758 Ga0501044_0405758_349_1065 238
331 3300050491 nmdc:mga00v17_484857_c1 nmdc:mga00v17_484857_c1_70_786 238
332 3300050495 nmdc:mga04h51_15391_c1 nmdc:mga04h51_15391_c1_402_1118 238
333 3300050496 nmdc:mga07m45_99677_c1 nmdc:mga07m45_99677_c1_576_1292 238
334 3300053142 Ga0500577_0006923 Ga0500577_0006923_652_1368 238
335 3300053153 Ga0500616_0113984 Ga0500616_0113984_397_1113 238
336 3300053156 Ga0500622_0020473 Ga0500622_0020473_2430_3146 238
337 3300053177 Ga0500636_0003354 Ga0500636_0003354_5982_6710 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

237

280

0.98

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

44

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.899 1 238
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.8954 1 238
2e1b-assembly1.cif.gz_A crystal structure of the alax-m trans-editing enzyme from pyrococcus horikoshii 0.8915 2 238
2zzg-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase in complex with 5''-o-(n-(l-alanyl)-sulfamyoxyl) adenine without oligomerization domain 0.8885 1 238
2zze-assembly2.cif.gz_B crystal structure of alanyl-trna synthetase without oligomerization domain in lysine-methylated form 0.8862 1 238
ID Description Score Start End Superfamily
af_Q57984_485_578_2.40.30.130 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9299 1 93 2.40.30.130
2ztgA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9114 1 93 2.40.30.130
2zzeB03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.8974 1 92 2.40.30.130
af_P40825_614_789_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8965 95 238 3.30.980.10
af_Q4DQ33_587_768_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8831 95 238 3.30.980.10
ID Description Score Start End GO Terms
AF-A0A2A5W6S6-F1-model_v4 Threonyl/alanyl tRNA synthetase SAD domain-containing protein 0.9881 103 238 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A0Q6BTX7-F1-model_v4 Ala-tRNA(Pro) hydrolase 0.9828 2 238 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A5Q8CLW3-F1-model_v4 Alanyl-tRNA editing protein 0.9827 2 238 GO:0002161
GO:0003676
GO:0004813
GO:0005524
GO:0005737
GO:0006419
GO:0046872
AF-A0A521LM24-F1-model_v4 Alanyl-tRNA editing protein 0.982 96 238 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872
AF-A0A2A5W6S6-F1-model_v4 Threonyl/alanyl tRNA synthetase SAD domain-containing protein 0.9809 103 238 GO:0002161
GO:0004812
GO:0005524
GO:0043039
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.1 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map