F413195

General Info

Members Datasets Scaffolds Average Seq Length
337 215 308 278

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0002963|Ga0466959_0002963_3113_4105
Length 330
Sequence MLMGRVCAGIANRPAAWTIGHETAIPWHIASRPDPGDWTPRNPASPLEEIAMNASTSTTLVLGSSGKTGRRVAQRLHARGLPVRLGSRSGRPAFDWDDRATWAGALAGTSAAYVSYYPDLAMPGAPETIAAFAEQAVAAGTRRLVLLSGRGEAEAQRAERLLQASGADWTILRCSWFMQNFSEGQFLDGLRGGELALPAGDMPEPFVDADDIADVAAAALTDARHAGQLYELTGPRALSFADAVAEIARASGRPLRYAAVPMDAFAAGARAQGVPDEIVEFLGYLFGEVLDGRNRAPADGVQRALGRPPRDFAAYARGAAAAGTWSDAAG

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
3 2643221578 Streptomyces sp. Root63 Isolate Unclassified
4 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
5 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
6 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
7 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
8 2738543024 Aminobacter sp. AP02 Isolate Unclassified
9 2791355199
10 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
11 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
12 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
15 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
16 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
17 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
18 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
19 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
20 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
21 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
22 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
162 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
163 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
210 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
211 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
212 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
213 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
214 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
215 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 2.37
Rhizoplane 7.12
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10009888 3300003187 Bacteria 4480
2 rootL2_10097654 3300003322 Bacteria 3049
3 Ga0070676_10029665 3300005328 Bacteria 3113
4 Ga0070676_10313215 3300005328 Bacteria 1068
5 Ga0070670_100157327 3300005331 Bacteria 1969
6 Ga0068869_100038078 3300005334 Bacteria 3424
7 Ga0070666_10029965 3300005335 Bacteria 3582
8 Ga0068868_100016590 3300005338 Bacteria 5474
9 Ga0068868_100593069 3300005338 Bacteria 981
10 Ga0070660_100518145 3300005339 Bacteria 993
11 Ga0070689_100182911 3300005340 Bacteria 1703
12 Ga0070691_10207764 3300005341 Bacteria 1032
13 Ga0070661_100246703 3300005344 Bacteria 1377
14 Ga0070668_100064207 3300005347 Bacteria 2846
15 Ga0070675_100122183 3300005354 Bacteria 2213
16 Ga0070671_100000958 3300005355 Bacteria 21138
17 Ga0070674_100084202 3300005356 Bacteria 2280
18 Ga0070674_100309587 3300005356 Bacteria 1262
19 Ga0070688_100466912 3300005365 Bacteria 946
20 Ga0070659_100322064 3300005366 Bacteria 1292
21 Ga0070667_100001242 3300005367 Bacteria 23152
22 Ga0070709_10066302 3300005434 Bacteria 2315
23 Ga0070714_100085843 3300005435 Bacteria 2750
24 Ga0070714_100246174 3300005435 Bacteria 1652
25 Ga0070694_100369477 3300005444 Bacteria 1116
26 Ga0070678_100017722 3300005456 Bacteria 4594
27 Ga0070678_100098903 3300005456 Bacteria 2256
28 Ga0070678_100254868 3300005456 Bacteria 1473
29 Ga0068867_100021412 3300005459 Bacteria 4614
30 Ga0068867_100222819 3300005459 Bacteria 1521
31 Ga0070698_100267141 3300005471 Bacteria 1643
32 Ga0070699_100059845 3300005518 Bacteria 3299
33 Ga0068853_100009794 3300005539 Bacteria 7735
34 Ga0068853_100117436 3300005539 Bacteria 2369
35 Ga0070672_100063267 3300005543 Bacteria 2922
36 Ga0070686_100007793 3300005544 Bacteria 5985
37 Ga0070686_100078330 3300005544 Bacteria 2182
38 Ga0070686_100488856 3300005544 Bacteria 953
39 Ga0070695_100295484 3300005545 Bacteria 1196
40 Ga0070665_100059150 3300005548 Bacteria 3841
41 Ga0070665_100390406 3300005548 Bacteria 1399
42 Ga0068855_100083013 3300005563 Bacteria 3712
43 Ga0070664_100216144 3300005564 Bacteria 1714
44 Ga0070664_100411800 3300005564 Bacteria 1237
45 Ga0068857_100097086 3300005577 Bacteria 2641
46 Ga0068857_100297587 3300005577 Bacteria 1487
47 Ga0068856_100022537 3300005614 Bacteria 6123
48 Ga0070702_100047786 3300005615 Bacteria 2432
49 Ga0068859_100000896 3300005617 Bacteria 30335
50 Ga0068859_100039154 3300005617 Bacteria 4755
51 Ga0068864_100041682 3300005618 Bacteria 3926
52 Ga0068861_100033132 3300005719 Bacteria 3809
53 Ga0068861_100118529 3300005719 Bacteria 2132
54 Ga0068861_100175312 3300005719 Bacteria 1780
55 Ga0068870_10205092 3300005840 Bacteria 1198
56 Ga0068863_100001326 3300005841 Bacteria 24643
57 Ga0068863_100092105 3300005841 Bacteria 2875
58 Ga0068863_100658609 3300005841 Bacteria 1039
59 Ga0068863_100675731 3300005841 Bacteria 1025
60 Ga0068858_100000111 3300005842 Bacteria 86228
61 Ga0068860_100000296 3300005843 Bacteria 69084
62 Ga0068860_100113000 3300005843 Bacteria 2597
63 Ga0068860_100172283 3300005843 Bacteria 2091
64 Ga0068860_100336985 3300005843 Bacteria 1482
65 Ga0068860_100557004 3300005843 Bacteria 1149
66 Ga0068862_100057402 3300005844 Bacteria 3338
67 Ga0068862_100105340 3300005844 Bacteria 2472
68 Ga0068862_100285934 3300005844 Bacteria 1513
69 Ga0081455_10002600 3300005937 Bacteria 21413
70 Ga0081455_10005681 3300005937 Bacteria 13613
71 Ga0081455_10012544 3300005937 Bacteria 8455
72 Ga0081455_10048642 3300005937 Bacteria 3662
73 Ga0081538_10000065 3300005981 Bacteria 98948
74 Ga0081538_10000173 3300005981 Bacteria 69480
75 Ga0081538_10001042 3300005981 Bacteria 29561
76 Ga0081538_10002259 3300005981 Bacteria 19075
77 Ga0081538_10025650 3300005981 Bacteria 4148
78 Ga0081538_10027159 3300005981 Bacteria 3977
79 Ga0081540_1016755 3300005983 Bacteria 4569
80 Ga0081539_10005587 3300005985 Bacteria 12693
81 Ga0081539_10028836 3300005985 Bacteria 3484
82 Ga0075365_10002257 3300006038 Bacteria 9339
83 Ga0075365_10003395 3300006038 Bacteria 8189
84 Ga0075365_10012915 3300006038 Bacteria 4978
85 Ga0075365_10109241 3300006038 Bacteria 1900
86 Ga0075365_10275991 3300006038 Bacteria 1182
87 Ga0075363_100002562 3300006048 Bacteria 7472
88 Ga0075364_10000398 3300006051 Bacteria 21738
89 Ga0075364_10032821 3300006051 Bacteria 3338
90 Ga0075362_10005795 3300006177 Bacteria 4553
91 Ga0075367_10027388 3300006178 Bacteria 3242
92 Ga0075367_10150227 3300006178 Bacteria 1445
93 Ga0075369_10002925 3300006186 Bacteria 6166
94 Ga0075369_10020606 3300006186 Bacteria 2700
95 Ga0075366_10128422 3300006195 Bacteria 1529
96 Ga0068871_100099033 3300006358 Bacteria 2440
97 Ga0075428_100045649 3300006844 Bacteria 4814
98 Ga0075428_100046992 3300006844 Bacteria 4742
99 Ga0075428_100213728 3300006844 Bacteria 2084
100 Ga0075428_100563062 3300006844 Bacteria 1218
101 Ga0075428_100578619 3300006844 Bacteria 1200
102 Ga0075430_100006226 3300006846 Bacteria 10066
103 Ga0075430_100044932 3300006846 Bacteria 3734
104 Ga0075430_100121603 3300006846 Bacteria 2177
105 Ga0075431_100031179 3300006847 Bacteria 5491
106 Ga0075431_100034006 3300006847 Bacteria 5253
107 Ga0075431_100088579 3300006847 Bacteria 3195
108 Ga0075431_100817477 3300006847 Bacteria 904
109 Ga0075434_100133110 3300006871 Bacteria 2506
110 Ga0075429_100155849 3300006880 Bacteria 2000
111 Ga0097620_100000896 3300006931 Bacteria 30335
112 Ga0097620_100039156 3300006931 Bacteria 4755
113 Ga0075435_100348331 3300007076 Bacteria 1269
114 Ga0105250_10025906 3300009092 Bacteria 2363
115 Ga0105240_10084100 3300009093 Bacteria 3902
116 Ga0111539_10912249 3300009094 Bacteria 1022
117 Ga0105245_10036518 3300009098 Bacteria 4365
118 Ga0105245_10115973 3300009098 Bacteria 2497
119 Ga0105247_10001088 3300009101 Bacteria 20266
120 Ga0114129_10036402 3300009147 Bacteria 6950
121 Ga0105242_10661823 3300009176 Bacteria 1017
122 Ga0105248_10017849 3300009177 Bacteria 7831
123 Ga0105248_10021386 3300009177 Bacteria 7168
124 Ga0105248_10544332 3300009177 Bacteria 1309
125 Ga0105237_10074857 3300009545 Bacteria 3378
126 Ga0105237_10225255 3300009545 Bacteria 1875
127 Ga0105237_10494382 3300009545 Bacteria 1230
128 Ga0105238_10092565 3300009551 Bacteria 3011
129 Ga0105238_10305492 3300009551 Bacteria 1575
130 Ga0105249_10015929 3300009553 Bacteria 6663
131 Ga0105249_10378565 3300009553 Bacteria 1441
132 Ga0105249_10461001 3300009553 Bacteria 1311
133 Ga0105239_10046080 3300010375 Bacteria 4778
134 Ga0105239_10099429 3300010375 Bacteria 3216
135 Ga0105239_10105754 3300010375 Bacteria 3117
136 Ga0105246_10044280 3300011119 Bacteria 3024
137 Ga0105246_10075774 3300011119 Bacteria 2382
138 Ga0157371_10317161 3300013102 Bacteria 1131
139 Ga0157378_10104678 3300013297 Bacteria 2587
140 Ga0163162_10061356 3300013306 Bacteria 3797
141 Ga0163162_10153100 3300013306 Bacteria 2424
142 Ga0157372_10072676 3300013307 Unclassified 3876
143 Ga0157375_10069191 3300013308 Bacteria 3535
144 Ga0157375_10201189 3300013308 Bacteria 2148
145 Ga0163163_10027603 3300014325 Bacteria 5440
146 Ga0163163_10068802 3300014325 Bacteria 3524
147 Ga0157380_10102849 3300014326 Bacteria 2383
148 Ga0157377_10071181 3300014745 Bacteria 2010
149 Ga0157379_10016289 3300014968 Bacteria 6540
150 Ga0157379_10031892 3300014968 Bacteria 4696
151 Ga0157379_10116722 3300014968 Bacteria 2400
152 Ga0157376_10237943 3300014969 Bacteria 1695
153 Ga0209025_1000088 3300025294 Bacteria 255087
154 Ga0207710_10000159 3300025900 Bacteria 71625
155 Ga0207688_10008323 3300025901 Bacteria 5640
156 Ga0207688_10166453 3300025901 Bacteria 1309
157 Ga0207680_10035844 3300025903 Bacteria 2853
158 Ga0207699_10222782 3300025906 Bacteria 1288
159 Ga0207645_10076045 3300025907 Bacteria 2150
160 Ga0207695_10008820 3300025913 Bacteria 12557
161 Ga0207649_10211883 3300025920 Bacteria 1375
162 Ga0207681_10088728 3300025923 Bacteria 2203
163 Ga0207681_10271611 3300025923 Bacteria 1331
164 Ga0207694_10005781 3300025924 Bacteria 9472
165 Ga0207694_10246254 3300025924 Bacteria 1462
166 Ga0207659_10117900 3300025926 Bacteria 2029
167 Ga0207664_10021989 3300025929 Bacteria 4753
168 Ga0207644_10002989 3300025931 Bacteria 10873
169 Ga0207690_10047725 3300025932 Bacteria 2843
170 Ga0207706_10293836 3300025933 Bacteria 1416
171 Ga0207706_10390881 3300025933 Bacteria 1206
172 Ga0207686_10108362 3300025934 Bacteria 1869
173 Ga0207686_10379483 3300025934 Bacteria 1071
174 Ga0207670_10092771 3300025936 Bacteria 2138
175 Ga0207669_10154086 3300025937 Bacteria 1614
176 Ga0207669_10183716 3300025937 Bacteria 1502
177 Ga0207704_10033932 3300025938 Bacteria 2907
178 Ga0207704_10322831 3300025938 Bacteria 1192
179 Ga0207691_10066946 3300025940 Bacteria 3249
180 Ga0207691_10286551 3300025940 Bacteria 1417
181 Ga0207711_10099237 3300025941 Bacteria 2574
182 Ga0207689_10035667 3300025942 Bacteria 4131
183 Ga0207661_10213180 3300025944 Bacteria 1703
184 Ga0207679_10120728 3300025945 Bacteria 2086
185 Ga0207667_10005671 3300025949 Bacteria 15220
186 Ga0207651_10068114 3300025960 Bacteria 2508
187 Ga0207712_10021136 3300025961 Bacteria 4270
188 Ga0207712_10120916 3300025961 Unclassified 1981
189 Ga0207668_10015986 3300025972 Bacteria 4674
190 Ga0207668_10156909 3300025972 Bacteria 1769
191 Ga0207703_10010088 3300026035 Bacteria 7403
192 Ga0207703_10174597 3300026035 Bacteria 1893
193 Ga0207639_10018158 3300026041 Bacteria 4995
194 Ga0207678_10018217 3300026067 Bacteria 6167
195 Ga0207641_10007413 3300026088 Bacteria 9124
196 Ga0207641_10075118 3300026088 Bacteria 2918
197 Ga0207641_10530381 3300026088 Bacteria 1146
198 Ga0207648_10026877 3300026089 Bacteria 5110
199 Ga0207648_10165208 3300026089 Bacteria 1956
200 Ga0207648_10271587 3300026089 Bacteria 1515
201 Ga0207674_10060893 3300026116 Bacteria 3816
202 Ga0207675_100019500 3300026118 Bacteria 6329
203 Ga0207675_100020502 3300026118 Bacteria 6162
204 Ga0207675_100209719 3300026118 Bacteria 1873
205 Ga0207683_10023505 3300026121 Bacteria 5302
206 Ga0207683_10086370 3300026121 Bacteria 2789
207 Ga0207683_10225040 3300026121 Bacteria 1710
208 Ga0207698_10149617 3300026142 Bacteria 2024
209 Ga0207698_10177646 3300026142 Bacteria 1882
210 Ga0268266_10490049 3300028379 Bacteria 1172
211 Ga0268265_10010708 3300028380 Bacteria 6191
212 Ga0268265_10024629 3300028380 Bacteria 4260
213 Ga0268265_10396055 3300028380 Bacteria 1275
214 Ga0268265_10435155 3300028380 Bacteria 1221
215 Ga0268264_10000088 3300028381 Bacteria 235344
216 Ga0268264_10077753 3300028381 Bacteria 2827
217 Ga0307513_10032762 3300031456 Bacteria 5854
218 Ga0307513_10058872 3300031456 Bacteria 4080
219 Ga0307509_10000028 3300031507 Bacteria 223572
220 Ga0307405_10000766 3300031731 Bacteria 12559
221 Ga0307412_10075091 3300031911 Bacteria 2318
222 Ga0307409_100044844 3300031995 Bacteria 3333
223 Ga0307409_100178988 3300031995 Bacteria 1875
224 Ga0307416_100579895 3300032002 Bacteria 1199
225 Ga0307414_10246346 3300032004 Bacteria 1483
226 Ga0307411_10003330 3300032005 Bacteria 7435
227 Ga0307415_100316662 3300032126 Bacteria 1299
228 Ga0307510_10015408 3300033180 Bacteria 9039
229 Ga0373933_0340896 3300035724 Bacteria 973
230 Ga0395898_0128633 3300037466 Bacteria 2426
231 Ga0395898_0454312 3300037466 Bacteria 1220
232 Ga0395901_0166090 3300038443 Bacteria 2318
233 Ga0400490_37622 3300038726 Bacteria 23446
234 Ga0400491_17412 3300038727 Unclassified 3912
235 Ga0450916_007468 3300042530 Bacteria 1313
236 Ga0466972_0068550 3300044658 Bacteria 1695
237 Ga0466960_0187277 3300044901 Bacteria 1125
238 Ga0466960_0209533 3300044901 Bacteria 1068
239 Ga0466959_0002963 3300045049 Bacteria 10959
240 Ga0495584_0108776 3300046491 Bacteria 1402
241 Ga0495632_0031795 3300046519 Unclassified 2725
242 Ga0495632_0071119 3300046519 Bacteria 1672
243 Ga0495666_0134369 3300046526 Bacteria 1155
244 Ga0495645_0028162 3300046543 Bacteria 4082
245 Ga0495668_0000002 3300046616 Bacteria 763179
246 Ga0495668_0059194 3300046616 Bacteria 2114
247 Ga0495625_0167185 3300046660 Bacteria 1470
248 Ga0495661_0096471 3300046665 Bacteria 1672
249 Ga0495588_0001286 3300046674 Bacteria 10740
250 Ga0495589_0167551 3300046794 Bacteria 1045
251 Ga0495636_0055140 3300047318 Bacteria 1671
252 Ga0496100_0274378 3300048903 Bacteria 1255
253 Ga0496101_0105756 3300048904 Bacteria 2112
254 Ga0496102_0078662 3300048905 Bacteria 3036
255 Ga0496102_0137645 3300048905 Bacteria 2288
256 Ga0496102_0251380 3300048905 Bacteria 1667
257 Ga0496102_0474177 3300048905 Bacteria 1173
258 Ga0496104_0041004 3300048907 Bacteria 4340
259 Ga0496104_0045546 3300048907 Bacteria 4126
260 Ga0496104_0108885 3300048907 Bacteria 2656
261 Ga0496105_0225311 3300048908 Bacteria 1525
262 Ga0496105_0386859 3300048908 Bacteria 1112
263 Ga0496107_0211152 3300048910 Bacteria 1443
264 Ga0496107_0222229 3300048910 Bacteria 1405
265 Ga0496108_0104699 3300048911 Bacteria 2415
266 Ga0496108_0159220 3300048911 Bacteria 1951
267 Ga0496109_0156857 3300048912 Bacteria 2132
268 Ga0496110_0311580 3300048913 Bacteria 1433
269 Ga0496110_0322681 3300048913 Bacteria 1407
270 Ga0496110_0606535 3300048913 Bacteria 993
271 Ga0496112_0014768 3300048915 Bacteria 7262
272 Ga0496112_0038527 3300048915 Bacteria 4668
273 Ga0496112_0153277 3300048915 Bacteria 2272
274 Ga0496112_0282145 3300048915 Bacteria 1608
275 Ga0496113_0149529 3300048916 Bacteria 1842
276 Ga0496117_0017367 3300048920 Bacteria 6009
277 Ga0496118_0007929 3300048921 Bacteria 11109
278 Ga0496118_0081647 3300048921 Bacteria 2269
279 Ga0496121_0001213 3300048924 Bacteria 44955
280 Ga0496121_0352809 3300048924 Bacteria 979
281 Ga0496124_0261930 3300048927 Bacteria 1272
282 Ga0496125_0092216 3300048928 Bacteria 2266
283 Ga0496125_0195902 3300048928 Bacteria 1329
284 Ga0501036_0175260 3300049572 Bacteria 1806
285 Ga0501039_0015920 3300049575 Bacteria 5758
286 Ga0501048_0300792 3300049582 Bacteria 1141
287 Ga0501072_0009270 3300049588 Bacteria 7479
288 Ga0501076_0036445 3300049592 Bacteria 3854
289 nmdc:mga03n38_16009_c1 3300050490 Bacteria 2909
290 nmdc:mga00v17_1652_c1 3300050491 Bacteria 11632
291 nmdc:mga00v17_233820_c1 3300050491 Bacteria 1191
292 nmdc:mga00v17_47010_c1 3300050491 Bacteria 2613
293 nmdc:mga0yw44_178529_c1 3300050492 Bacteria 1397
294 nmdc:mga0yw44_234535_c1 3300050492 Bacteria 1218
295 nmdc:mga05p37_152228_c1 3300050507 Bacteria 2828
296 nmdc:mga05p37_259253_c1 3300050507 Bacteria 2082
297 nmdc:mga09592_277848_c1 3300050508 Bacteria 1452
298 nmdc:mga09592_356616_c1 3300050508 Bacteria 1265
299 nmdc:mga0qj67_37481_c1 3300050509 Bacteria 3798
300 nmdc:mga0qj67_6464_c1 3300050509 Bacteria 8613
301 nmdc:mga06r32_164147_c1 3300050510 Bacteria 2204
302 nmdc:mga06r32_178234_c1 3300050510 Bacteria 2110
303 nmdc:mga06r32_41210_c1 3300050510 Bacteria 4386
304 nmdc:mga06r32_47549_c1 3300050510 Bacteria 4098
305 nmdc:mga08y16_367722_c1 3300050511 Bacteria 1475
306 nmdc:mga0n895_173702_c1 3300050512 Bacteria 2186
307 Ga0500616_0000064 3300053153 Bacteria 243072
308 Ga0501082_0487860 3300060353 Bacteria 1077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8056667051 8056671895 262
2 3300028380 Ga0268265_10435155 Ga0268265_104351552 263
3 3300006844 Ga0075428_100578619 Ga0075428_1005786192 264
4 iso_pu_bacteria 2895427314 2895433021 265
5 3300009553 Ga0105249_10461001 Ga0105249_104610012 266
6 3300005843 Ga0068860_100557004 Ga0068860_1005570042 267
7 3300025938 Ga0207704_10322831 Ga0207704_103228312 267
8 3300026142 Ga0207698_10149617 Ga0207698_101496172 267
9 iso_pu_bacteria 2643221578 2643902734 267
10 iso_pu_bacteria 2643221673 2644404757 267
11 iso_pu_bacteria 2946045630 2946048762 267
12 3300005985 Ga0081539_10005587 Ga0081539_100055872 268
13 3300005985 Ga0081539_10028836 Ga0081539_100288363 268
14 3300005937 Ga0081455_10048642 Ga0081455_100486424 269
15 iso_pu_bacteria 2513237101 2513692255 269
16 iso_pu_bacteria 2721755755 2723845370 269
17 iso_pu_bacteria 2791355199 2793083425 269
18 iso_pu_bacteria 2874604998 2874608724 269
19 iso_pu_bacteria 2876808645 2876815243 269
20 iso_pu_bacteria 2879110137 2879111418 269
21 iso_pu_bacteria 2889033259 2889040126 269
22 iso_pu_bacteria 2922386360 2922390721 269
23 iso_pu_bacteria 8006964411 8006973062 269
24 iso_pu_bacteria 8006994254 8007000514 269
25 3300025940 Ga0207691_10286551 Ga0207691_102865512 270
26 iso_pu_bacteria 3005416602 3005422988 270
27 iso_pu_bacteria 8005314921 8005315315 270
28 3300005843 Ga0068860_100113000 Ga0068860_1001130003 271
29 iso_pu_bacteria 2675903059 2676479622 271
30 3300003322 rootL2_10097654 rootL2_100976543 272
31 3300031456 Ga0307513_10058872 Ga0307513_100588722 272
32 3300031995 Ga0307409_100178988 Ga0307409_1001789882 272
33 iso_pu_bacteria 8056447290 8056448536 272
34 3300005328 Ga0070676_10029665 Ga0070676_100296651 273
35 3300005328 Ga0070676_10313215 Ga0070676_103132152 273
36 3300005331 Ga0070670_100157327 Ga0070670_1001573271 273
37 3300005334 Ga0068869_100038078 Ga0068869_1000380784 273
38 3300005338 Ga0068868_100016590 Ga0068868_1000165907 273
39 3300005338 Ga0068868_100593069 Ga0068868_1005930691 273
40 3300005341 Ga0070691_10207764 Ga0070691_102077641 273
41 3300005344 Ga0070661_100246703 Ga0070661_1002467032 273
42 3300005347 Ga0070668_100064207 Ga0070668_1000642072 273
43 3300005354 Ga0070675_100122183 Ga0070675_1001221832 273
44 3300005356 Ga0070674_100084202 Ga0070674_1000842022 273
45 3300005356 Ga0070674_100309587 Ga0070674_1003095872 273
46 3300005444 Ga0070694_100369477 Ga0070694_1003694771 273
47 3300005456 Ga0070678_100017722 Ga0070678_1000177226 273
48 3300005456 Ga0070678_100098903 Ga0070678_1000989033 273
49 3300005459 Ga0068867_100222819 Ga0068867_1002228192 273
50 3300005471 Ga0070698_100267141 Ga0070698_1002671412 273
51 3300005518 Ga0070699_100059845 Ga0070699_1000598453 273
52 3300005539 Ga0068853_100117436 Ga0068853_1001174362 273
53 3300005543 Ga0070672_100063267 Ga0070672_1000632676 273
54 3300005544 Ga0070686_100078330 Ga0070686_1000783304 273
55 3300005545 Ga0070695_100295484 Ga0070695_1002954841 273
56 3300005563 Ga0068855_100083013 Ga0068855_1000830133 273
57 3300005577 Ga0068857_100097086 Ga0068857_1000970864 273
58 3300005614 Ga0068856_100022537 Ga0068856_1000225376 273
59 3300005615 Ga0070702_100047786 Ga0070702_1000477863 273
60 3300005617 Ga0068859_100039154 Ga0068859_1000391546 273
61 3300005618 Ga0068864_100041682 Ga0068864_1000416822 273
62 3300005719 Ga0068861_100175312 Ga0068861_1001753122 273
63 3300005840 Ga0068870_10205092 Ga0068870_102050922 273
64 3300005841 Ga0068863_100092105 Ga0068863_1000921054 273
65 3300005841 Ga0068863_100658609 Ga0068863_1006586092 273
66 3300005843 Ga0068860_100172283 Ga0068860_1001722832 273
67 3300005843 Ga0068860_100336985 Ga0068860_1003369852 273
68 3300005844 Ga0068862_100057402 Ga0068862_1000574026 273
69 3300005937 Ga0081455_10002600 Ga0081455_1000260017 273
70 3300005983 Ga0081540_1016755 Ga0081540_10167553 273
71 3300006051 Ga0075364_10032821 Ga0075364_100328212 273
72 3300006178 Ga0075367_10027388 Ga0075367_100273888 273
73 3300006186 Ga0075369_10002925 Ga0075369_100029252 273
74 3300006195 Ga0075366_10128422 Ga0075366_101284222 273
75 3300006358 Ga0068871_100099033 Ga0068871_1000990332 273
76 3300006871 Ga0075434_100133110 Ga0075434_1001331102 273
77 3300006931 Ga0097620_100039156 Ga0097620_1000391566 273
78 3300007076 Ga0075435_100348331 Ga0075435_1003483311 273
79 3300009177 Ga0105248_10017849 Ga0105248_100178498 273
80 3300009551 Ga0105238_10305492 Ga0105238_103054922 273
81 3300009553 Ga0105249_10378565 Ga0105249_103785652 273
82 3300010375 Ga0105239_10105754 Ga0105239_101057544 273
83 3300011119 Ga0105246_10075774 Ga0105246_100757743 273
84 3300013297 Ga0157378_10104678 Ga0157378_101046782 273
85 3300013308 Ga0157375_10069191 Ga0157375_100691916 273
86 3300014325 Ga0163163_10027603 Ga0163163_100276032 273
87 3300014326 Ga0157380_10102849 Ga0157380_101028494 273
88 3300014745 Ga0157377_10071181 Ga0157377_100711812 273
89 3300014968 Ga0157379_10031892 Ga0157379_100318925 273
90 3300014969 Ga0157376_10237943 Ga0157376_102379432 273
91 3300025901 Ga0207688_10008323 Ga0207688_100083238 273
92 3300025901 Ga0207688_10166453 Ga0207688_101664531 273
93 3300025907 Ga0207645_10076045 Ga0207645_100760451 273
94 3300025920 Ga0207649_10211883 Ga0207649_102118832 273
95 3300025923 Ga0207681_10088728 Ga0207681_100887283 273
96 3300025923 Ga0207681_10271611 Ga0207681_102716112 273
97 3300025924 Ga0207694_10246254 Ga0207694_102462542 273
98 3300025926 Ga0207659_10117900 Ga0207659_101179002 273
99 3300025932 Ga0207690_10047725 Ga0207690_100477252 273
100 3300025933 Ga0207706_10293836 Ga0207706_102938362 273
101 3300025933 Ga0207706_10390881 Ga0207706_103908812 273
102 3300025934 Ga0207686_10108362 Ga0207686_101083621 273
103 3300025937 Ga0207669_10154086 Ga0207669_101540862 273
104 3300025938 Ga0207704_10033932 Ga0207704_100339322 273
105 3300025940 Ga0207691_10066946 Ga0207691_100669465 273
106 3300025941 Ga0207711_10099237 Ga0207711_100992373 273
107 3300025942 Ga0207689_10035667 Ga0207689_100356675 273
108 3300025972 Ga0207668_10015986 Ga0207668_100159861 273
109 3300026035 Ga0207703_10174597 Ga0207703_101745971 273
110 3300026041 Ga0207639_10018158 Ga0207639_100181588 273
111 3300026067 Ga0207678_10018217 Ga0207678_100182175 273
112 3300026088 Ga0207641_10075118 Ga0207641_100751183 273
113 3300026089 Ga0207648_10271587 Ga0207648_102715872 273
114 3300026116 Ga0207674_10060893 Ga0207674_100608934 273
115 3300026118 Ga0207675_100019500 Ga0207675_1000195008 273
116 3300026118 Ga0207675_100020502 Ga0207675_1000205026 273
117 3300026121 Ga0207683_10023505 Ga0207683_100235055 273
118 3300026121 Ga0207683_10225040 Ga0207683_102250403 273
119 3300028380 Ga0268265_10010708 Ga0268265_100107089 273
120 3300028380 Ga0268265_10024629 Ga0268265_100246298 273
121 3300028381 Ga0268264_10077753 Ga0268264_100777535 273
122 3300032002 Ga0307416_100579895 Ga0307416_1005798952 273
123 3300032126 Ga0307415_100316662 Ga0307415_1003166621 273
124 3300046491 Ga0495584_0108776 Ga0495584_0108776_529_1350 273
125 3300046519 Ga0495632_0071119 Ga0495632_0071119_326_1225 273
126 3300046526 Ga0495666_0134369 Ga0495666_0134369_134_955 273
127 3300046616 Ga0495668_0059194 Ga0495668_0059194_375_1196 273
128 3300046660 Ga0495625_0167185 Ga0495625_0167185_104_1003 273
129 3300046665 Ga0495661_0096471 Ga0495661_0096471_293_1114 273
130 3300046674 Ga0495588_0001286 Ga0495588_0001286_7920_8819 273
131 3300046794 Ga0495589_0167551 Ga0495589_0167551_25_846 273
132 3300047318 Ga0495636_0055140 Ga0495636_0055140_172_993 273
133 3300048905 Ga0496102_0078662 Ga0496102_0078662_537_1364 273
134 3300048905 Ga0496102_0474177 Ga0496102_0474177_107_928 273
135 3300048907 Ga0496104_0108885 Ga0496104_0108885_1453_2280 273
136 3300048910 Ga0496107_0211152 Ga0496107_0211152_519_1346 273
137 3300048911 Ga0496108_0104699 Ga0496108_0104699_416_1243 273
138 3300048913 Ga0496110_0311580 Ga0496110_0311580_94_921 273
139 3300048915 Ga0496112_0038527 Ga0496112_0038527_2581_3408 273
140 3300048921 Ga0496118_0081647 Ga0496118_0081647_483_1310 273
141 3300048928 Ga0496125_0195902 Ga0496125_0195902_280_1107 273
142 3300050507 nmdc:mga05p37_152228_c1 nmdc:mga05p37_152228_c1_488_1309 273
143 3300050512 nmdc:mga0n895_173702_c1 nmdc:mga0n895_173702_c1_561_1388 273
144 3300005937 Ga0081455_10005681 Ga0081455_100056814 274
145 3300005981 Ga0081538_10002259 Ga0081538_100022594 274
146 3300006844 Ga0075428_100213728 Ga0075428_1002137282 274
147 3300006844 Ga0075428_100563062 Ga0075428_1005630622 274
148 3300006847 Ga0075431_100817477 Ga0075431_1008174771 274
149 3300033180 Ga0307510_10015408 Ga0307510_100154083 274
150 3300048913 Ga0496110_0606535 Ga0496110_0606535_65_889 274
151 3300048915 Ga0496112_0282145 Ga0496112_0282145_122_946 274
152 3300048924 Ga0496121_0352809 Ga0496121_0352809_49_873 274
153 3300050508 nmdc:mga09592_356616_c1 nmdc:mga09592_356616_c1_102_932 274
154 3300050510 nmdc:mga06r32_47549_c1 nmdc:mga06r32_47549_c1_3233_4063 274
155 3300053153 Ga0500616_0000064 Ga0500616_0000064_10772_11596 274
156 3300005335 Ga0070666_10029965 Ga0070666_100299652 275
157 3300005340 Ga0070689_100182911 Ga0070689_1001829113 275
158 3300005355 Ga0070671_100000958 Ga0070671_1000009589 275
159 3300005365 Ga0070688_100466912 Ga0070688_1004669121 275
160 3300005367 Ga0070667_100001242 Ga0070667_1000012426 275
161 3300005544 Ga0070686_100007793 Ga0070686_1000077934 275
162 3300005548 Ga0070665_100059150 Ga0070665_1000591502 275
163 3300005564 Ga0070664_100411800 Ga0070664_1004118002 275
164 3300005617 Ga0068859_100000896 Ga0068859_10000089625 275
165 3300005719 Ga0068861_100118529 Ga0068861_1001185293 275
166 3300005841 Ga0068863_100001326 Ga0068863_10000132617 275
167 3300005842 Ga0068858_100000111 Ga0068858_10000011112 275
168 3300006931 Ga0097620_100000896 Ga0097620_10000089625 275
169 3300009092 Ga0105250_10025906 Ga0105250_100259062 275
170 3300009101 Ga0105247_10001088 Ga0105247_100010888 275
171 3300009177 Ga0105248_10021386 Ga0105248_100213864 275
172 3300009553 Ga0105249_10015929 Ga0105249_100159292 275
173 3300013306 Ga0163162_10153100 Ga0163162_101531002 275
174 3300014325 Ga0163163_10068802 Ga0163163_100688022 275
175 3300014968 Ga0157379_10016289 Ga0157379_100162892 275
176 3300025900 Ga0207710_10000159 Ga0207710_1000015953 275
177 3300025903 Ga0207680_10035844 Ga0207680_100358444 275
178 3300025931 Ga0207644_10002989 Ga0207644_100029896 275
179 3300025936 Ga0207670_10092771 Ga0207670_100927712 275
180 3300025960 Ga0207651_10068114 Ga0207651_100681143 275
181 3300025961 Ga0207712_10021136 Ga0207712_100211363 275
182 3300026035 Ga0207703_10010088 Ga0207703_100100888 275
183 3300026088 Ga0207641_10007413 Ga0207641_100074136 275
184 3300037466 Ga0395898_0454312 Ga0395898_0454312_255_1085 275
185 3300042530 Ga0450916_007468 Ga0450916_007468_414_1241 275
186 3300048903 Ga0496100_0274378 Ga0496100_0274378_363_1190 275
187 3300048905 Ga0496102_0137645 Ga0496102_0137645_1006_1833 275
188 3300048908 Ga0496105_0225311 Ga0496105_0225311_283_1122 275
189 3300048910 Ga0496107_0222229 Ga0496107_0222229_190_1017 275
190 3300048915 Ga0496112_0014768 Ga0496112_0014768_1162_1989 275
191 3300048924 Ga0496121_0001213 Ga0496121_0001213_6260_7087 275
192 3300048927 Ga0496124_0261930 Ga0496124_0261930_114_941 275
193 3300048928 Ga0496125_0092216 Ga0496125_0092216_1164_1991 275
194 iso_pu_bacteria 2515154137 2515754682 275
195 iso_pu_bacteria 2862290372 2862297076 275
196 3300005577 Ga0068857_100297587 Ga0068857_1002975872 276
197 3300005719 Ga0068861_100033132 Ga0068861_1000331323 276
198 3300005843 Ga0068860_100000296 Ga0068860_10000029635 276
199 3300005844 Ga0068862_100105340 Ga0068862_1001053403 276
200 3300005844 Ga0068862_100285934 Ga0068862_1002859342 276
201 3300009098 Ga0105245_10115973 Ga0105245_101159732 276
202 3300009177 Ga0105248_10544332 Ga0105248_105443322 276
203 3300009545 Ga0105237_10225255 Ga0105237_102252551 276
204 3300009545 Ga0105237_10494382 Ga0105237_104943822 276
205 3300010375 Ga0105239_10046080 Ga0105239_100460803 276
206 3300013102 Ga0157371_10317161 Ga0157371_103171611 276
207 3300013306 Ga0163162_10061356 Ga0163162_100613563 276
208 3300013307 Ga0157372_10072676 Ga0157372_100726762 276
209 3300013308 Ga0157375_10201189 Ga0157375_102011892 276
210 3300025961 Ga0207712_10120916 Ga0207712_101209162 276
211 3300026118 Ga0207675_100209719 Ga0207675_1002097192 276
212 3300028380 Ga0268265_10396055 Ga0268265_103960552 276
213 3300028381 Ga0268264_10000088 Ga0268264_1000008879 276
214 3300031456 Ga0307513_10032762 Ga0307513_100327625 276
215 3300044658 Ga0466972_0068550 Ga0466972_0068550_632_1462 276
216 3300044901 Ga0466960_0209533 Ga0466960_0209533_120_950 276
217 3300048912 Ga0496109_0156857 Ga0496109_0156857_1257_2087 276
218 3300048916 Ga0496113_0149529 Ga0496113_0149529_406_1236 276
219 3300005339 Ga0070660_100518145 Ga0070660_1005181451 277
220 3300005456 Ga0070678_100254868 Ga0070678_1002548682 277
221 3300005459 Ga0068867_100021412 Ga0068867_1000214123 277
222 3300005544 Ga0070686_100488856 Ga0070686_1004888561 277
223 3300005564 Ga0070664_100216144 Ga0070664_1002161442 277
224 3300005841 Ga0068863_100675731 Ga0068863_1006757311 277
225 3300006038 Ga0075365_10012915 Ga0075365_100129154 277
226 3300006038 Ga0075365_10109241 Ga0075365_101092413 277
227 3300006038 Ga0075365_10275991 Ga0075365_102759912 277
228 3300006844 Ga0075428_100046992 Ga0075428_1000469923 277
229 3300006846 Ga0075430_100044932 Ga0075430_1000449323 277
230 3300006847 Ga0075431_100031179 Ga0075431_1000311793 277
231 3300006880 Ga0075429_100155849 Ga0075429_1001558492 277
232 3300009098 Ga0105245_10036518 Ga0105245_100365184 277
233 3300014968 Ga0157379_10116722 Ga0157379_101167222 277
234 3300025945 Ga0207679_10120728 Ga0207679_101207281 277
235 3300025972 Ga0207668_10156909 Ga0207668_101569093 277
236 3300026088 Ga0207641_10530381 Ga0207641_105303811 277
237 3300026089 Ga0207648_10026877 Ga0207648_100268773 277
238 3300026089 Ga0207648_10165208 Ga0207648_101652082 277
239 3300026121 Ga0207683_10086370 Ga0207683_100863703 277
240 3300026142 Ga0207698_10177646 Ga0207698_101776462 277
241 3300048911 Ga0496108_0159220 Ga0496108_0159220_232_1098 277
242 3300050491 nmdc:mga00v17_233820_c1 nmdc:mga00v17_233820_c1_236_1069 277
243 3300050492 nmdc:mga0yw44_234535_c1 nmdc:mga0yw44_234535_c1_74_952 277
244 iso_pu_bacteria 2738543024 2739310207 277
245 iso_pu_bacteria 2919119836 2919121087 277
246 iso_pu_bacteria 8002285264 8002290464 277
247 3300005366 Ga0070659_100322064 Ga0070659_1003220642 278
248 3300005981 Ga0081538_10000173 Ga0081538_1000017315 278
249 3300009176 Ga0105242_10661823 Ga0105242_106618231 278
250 3300025913 Ga0207695_10008820 Ga0207695_100088206 278
251 3300025934 Ga0207686_10379483 Ga0207686_103794831 278
252 3300025937 Ga0207669_10183716 Ga0207669_101837162 278
253 3300025944 Ga0207661_10213180 Ga0207661_102131801 278
254 3300025949 Ga0207667_10005671 Ga0207667_1000567111 278
255 3300035724 Ga0373933_0340896 Ga0373933_0340896_23_910 278
256 3300044901 Ga0466960_0187277 Ga0466960_0187277_130_966 278
257 3300046519 Ga0495632_0031795 Ga0495632_0031795_1134_1985 278
258 3300048907 Ga0496104_0041004 Ga0496104_0041004_2883_3731 278
259 3300048915 Ga0496112_0153277 Ga0496112_0153277_471_1319 278
260 3300050510 nmdc:mga06r32_164147_c1 nmdc:mga06r32_164147_c1_918_1772 278
261 3300005434 Ga0070709_10066302 Ga0070709_100663023 279
262 3300005435 Ga0070714_100085843 Ga0070714_1000858434 279
263 3300005435 Ga0070714_100246174 Ga0070714_1002461742 279
264 3300005981 Ga0081538_10001042 Ga0081538_1000104231 279
265 3300006038 Ga0075365_10002257 Ga0075365_100022579 279
266 3300006051 Ga0075364_10000398 Ga0075364_100003989 279
267 3300006177 Ga0075362_10005795 Ga0075362_100057954 279
268 3300006178 Ga0075367_10150227 Ga0075367_101502272 279
269 3300006186 Ga0075369_10020606 Ga0075369_100206062 279
270 3300006844 Ga0075428_100045649 Ga0075428_1000456492 279
271 3300006846 Ga0075430_100006226 Ga0075430_10000622611 279
272 3300006847 Ga0075431_100034006 Ga0075431_1000340064 279
273 3300009147 Ga0114129_10036402 Ga0114129_100364028 279
274 3300025906 Ga0207699_10222782 Ga0207699_102227822 279
275 3300025929 Ga0207664_10021989 Ga0207664_100219891 279
276 3300031911 Ga0307412_10075091 Ga0307412_100750911 279
277 3300037466 Ga0395898_0128633 Ga0395898_0128633_313_1170 279
278 3300046543 Ga0495645_0028162 Ga0495645_0028162_2185_3024 279
279 3300048904 Ga0496101_0105756 Ga0496101_0105756_262_1101 279
280 3300048907 Ga0496104_0045546 Ga0496104_0045546_1133_1972 279
281 3300048908 Ga0496105_0386859 Ga0496105_0386859_131_970 279
282 3300048913 Ga0496110_0322681 Ga0496110_0322681_528_1367 279
283 3300049572 Ga0501036_0175260 Ga0501036_0175260_12_851 279
284 3300049575 Ga0501039_0015920 Ga0501039_0015920_4887_5726 279
285 3300049582 Ga0501048_0300792 Ga0501048_0300792_184_1023 279
286 3300049588 Ga0501072_0009270 Ga0501072_0009270_333_1172 279
287 3300049592 Ga0501076_0036445 Ga0501076_0036445_1407_2246 279
288 3300050490 nmdc:mga03n38_16009_c1 nmdc:mga03n38_16009_c1_908_1747 279
289 3300050491 nmdc:mga00v17_1652_c1 nmdc:mga00v17_1652_c1_3052_3891 279
290 3300050507 nmdc:mga05p37_259253_c1 nmdc:mga05p37_259253_c1_646_1500 279
291 3300050508 nmdc:mga09592_277848_c1 nmdc:mga09592_277848_c1_482_1336 279
292 3300050509 nmdc:mga0qj67_37481_c1 nmdc:mga0qj67_37481_c1_2065_2919 279
293 3300050509 nmdc:mga0qj67_6464_c1 nmdc:mga0qj67_6464_c1_4527_5366 279
294 3300050510 nmdc:mga06r32_41210_c1 nmdc:mga06r32_41210_c1_778_1632 279
295 iso_pu_bacteria 8025478263 8025478577 279
296 3300005548 Ga0070665_100390406 Ga0070665_1003904062 280
297 3300005937 Ga0081455_10012544 Ga0081455_100125448 280
298 3300005981 Ga0081538_10025650 Ga0081538_100256502 280
299 3300005981 Ga0081538_10027159 Ga0081538_100271592 280
300 3300009094 Ga0111539_10912249 Ga0111539_109122491 280
301 3300028379 Ga0268266_10490049 Ga0268266_104900491 280
302 3300031507 Ga0307509_10000028 Ga0307509_10000028145 280
303 3300038443 Ga0395901_0166090 Ga0395901_0166090_1140_1994 280
304 3300046616 Ga0495668_0000002 Ga0495668_0000002_297718_298566 280
305 3300050511 nmdc:mga08y16_367722_c1 nmdc:mga08y16_367722_c1_540_1403 280
306 3300005539 Ga0068853_100009794 Ga0068853_1000097942 281
307 3300009093 Ga0105240_10084100 Ga0105240_100841004 281
308 3300009545 Ga0105237_10074857 Ga0105237_100748574 281
309 3300009551 Ga0105238_10092565 Ga0105238_100925654 281
310 3300010375 Ga0105239_10099429 Ga0105239_100994292 281
311 3300025924 Ga0207694_10005781 Ga0207694_100057813 281
312 3300048905 Ga0496102_0251380 Ga0496102_0251380_549_1403 281
313 3300050491 nmdc:mga00v17_47010_c1 nmdc:mga00v17_47010_c1_810_1715 281
314 3300005981 Ga0081538_10000065 Ga0081538_1000006575 282
315 3300006038 Ga0075365_10003395 Ga0075365_100033959 282
316 3300006048 Ga0075363_100002562 Ga0075363_1000025625 282
317 3300031731 Ga0307405_10000766 Ga0307405_100007666 282
318 3300031995 Ga0307409_100044844 Ga0307409_1000448444 282
319 3300032004 Ga0307414_10246346 Ga0307414_102463462 282
320 3300032005 Ga0307411_10003330 Ga0307411_100033302 282
321 3300050492 nmdc:mga0yw44_178529_c1 nmdc:mga0yw44_178529_c1_250_1098 282
322 iso_pu_bacteria 2643221623 2644131283 282
323 3300006846 Ga0075430_100121603 Ga0075430_1001216032 283
324 3300006847 Ga0075431_100088579 Ga0075431_1000885795 283
325 3300011119 Ga0105246_10044280 Ga0105246_100442802 283
326 3300038726 Ga0400490_37622 Ga0400490_37622_14614_15477 283
327 3300038727 Ga0400491_17412 Ga0400491_17412_2786_3649 283
328 3300045049 Ga0466959_0002963 Ga0466959_0002963_3113_4105 283
329 3300048920 Ga0496117_0017367 Ga0496117_0017367_161_1042 283
330 3300048921 Ga0496118_0007929 Ga0496118_0007929_157_1038 283
331 3300050510 nmdc:mga06r32_178234_c1 nmdc:mga06r32_178234_c1_1114_1992 283
332 3300060353 Ga0501082_0487860 Ga0501082_0487860_109_1023 283
333 iso_pu_bacteria 2883821847 2883823619 283
334 iso_pu_bacteria 2904541872 2904544834 286
335 iso_pu_bacteria 2929160207 2929163494 286
336 3300003187 JGI25151J46595_10009888 JGI25151J46595_100098882 290
337 3300025294 Ga0209025_1000088 Ga0209025_1000088222 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

63

223

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.808 13 283
6yj4-assembly1.cif.gz_P structure of yarrowia lipolytica complex i at 2.7 a 0.8019 15 283
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.798 16 277
5l4l-assembly1.cif.gz_A polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 0.7902 17 287
2vrc-assembly1.cif.gz_D crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.7867 16 280
ID Description Score Start End Superfamily
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8737 17 280 3.40.50.720
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8622 17 70 3.40.50.720
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8298 17 280 3.40.50.720
af_Q55F90_2_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8247 17 194 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8247 16 133 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352H7G5-F1-model_v4 deleted 0.9828 15 112
AF-A0A7Y7LG42-F1-model_v4 deleted 0.9812 8 289
AF-A0A1I9ZHF8-F1-model_v4 deleted 0.9766 13 290
AF-A0A0Q6WER0-F1-model_v4 NmrA family transcriptional regulator 0.9755 15 286
AF-A0A8A3NT30-F1-model_v4 deleted 0.9748 17 288

Feature Viewer

pLDDT pTM Quality
92.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map