F413195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 215 | 308 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0002963|Ga0466959_0002963_3113_4105 |
| Length | 330 |
| Sequence | MLMGRVCAGIANRPAAWTIGHETAIPWHIASRPDPGDWTPRNPASPLEEIAMNASTSTTLVLGSSGKTGRRVAQRLHARGLPVRLGSRSGRPAFDWDDRATWAGALAGTSAAYVSYYPDLAMPGAPETIAAFAEQAVAAGTRRLVLLSGRGEAEAQRAERLLQASGADWTILRCSWFMQNFSEGQFLDGLRGGELALPAGDMPEPFVDADDIADVAAAALTDARHAGQLYELTGPRALSFADAVAEIARASGRPLRYAAVPMDAFAAGARAQGVPDEIVEFLGYLFGEVLDGRNRAPADGVQRALGRPPRDFAAYARGAAAAGTWSDAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 3 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 4 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 5 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 6 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 7 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 8 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 9 | 2791355199 | |||
| 10 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 11 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 12 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 13 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 14 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 15 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 16 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 17 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 18 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 19 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 20 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 21 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 22 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 162 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 163 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 189 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 200 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 210 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 211 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 212 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 213 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 214 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 215 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.67 |
| Metatranscriptomes | 0 |
| Isolates | 8.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.82 |
| Nodule | 2.37 |
| Rhizoplane | 7.12 |
| Rhizosphere | 76.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10009888 | 3300003187 | Bacteria | 4480 |
| 2 | rootL2_10097654 | 3300003322 | Bacteria | 3049 |
| 3 | Ga0070676_10029665 | 3300005328 | Bacteria | 3113 |
| 4 | Ga0070676_10313215 | 3300005328 | Bacteria | 1068 |
| 5 | Ga0070670_100157327 | 3300005331 | Bacteria | 1969 |
| 6 | Ga0068869_100038078 | 3300005334 | Bacteria | 3424 |
| 7 | Ga0070666_10029965 | 3300005335 | Bacteria | 3582 |
| 8 | Ga0068868_100016590 | 3300005338 | Bacteria | 5474 |
| 9 | Ga0068868_100593069 | 3300005338 | Bacteria | 981 |
| 10 | Ga0070660_100518145 | 3300005339 | Bacteria | 993 |
| 11 | Ga0070689_100182911 | 3300005340 | Bacteria | 1703 |
| 12 | Ga0070691_10207764 | 3300005341 | Bacteria | 1032 |
| 13 | Ga0070661_100246703 | 3300005344 | Bacteria | 1377 |
| 14 | Ga0070668_100064207 | 3300005347 | Bacteria | 2846 |
| 15 | Ga0070675_100122183 | 3300005354 | Bacteria | 2213 |
| 16 | Ga0070671_100000958 | 3300005355 | Bacteria | 21138 |
| 17 | Ga0070674_100084202 | 3300005356 | Bacteria | 2280 |
| 18 | Ga0070674_100309587 | 3300005356 | Bacteria | 1262 |
| 19 | Ga0070688_100466912 | 3300005365 | Bacteria | 946 |
| 20 | Ga0070659_100322064 | 3300005366 | Bacteria | 1292 |
| 21 | Ga0070667_100001242 | 3300005367 | Bacteria | 23152 |
| 22 | Ga0070709_10066302 | 3300005434 | Bacteria | 2315 |
| 23 | Ga0070714_100085843 | 3300005435 | Bacteria | 2750 |
| 24 | Ga0070714_100246174 | 3300005435 | Bacteria | 1652 |
| 25 | Ga0070694_100369477 | 3300005444 | Bacteria | 1116 |
| 26 | Ga0070678_100017722 | 3300005456 | Bacteria | 4594 |
| 27 | Ga0070678_100098903 | 3300005456 | Bacteria | 2256 |
| 28 | Ga0070678_100254868 | 3300005456 | Bacteria | 1473 |
| 29 | Ga0068867_100021412 | 3300005459 | Bacteria | 4614 |
| 30 | Ga0068867_100222819 | 3300005459 | Bacteria | 1521 |
| 31 | Ga0070698_100267141 | 3300005471 | Bacteria | 1643 |
| 32 | Ga0070699_100059845 | 3300005518 | Bacteria | 3299 |
| 33 | Ga0068853_100009794 | 3300005539 | Bacteria | 7735 |
| 34 | Ga0068853_100117436 | 3300005539 | Bacteria | 2369 |
| 35 | Ga0070672_100063267 | 3300005543 | Bacteria | 2922 |
| 36 | Ga0070686_100007793 | 3300005544 | Bacteria | 5985 |
| 37 | Ga0070686_100078330 | 3300005544 | Bacteria | 2182 |
| 38 | Ga0070686_100488856 | 3300005544 | Bacteria | 953 |
| 39 | Ga0070695_100295484 | 3300005545 | Bacteria | 1196 |
| 40 | Ga0070665_100059150 | 3300005548 | Bacteria | 3841 |
| 41 | Ga0070665_100390406 | 3300005548 | Bacteria | 1399 |
| 42 | Ga0068855_100083013 | 3300005563 | Bacteria | 3712 |
| 43 | Ga0070664_100216144 | 3300005564 | Bacteria | 1714 |
| 44 | Ga0070664_100411800 | 3300005564 | Bacteria | 1237 |
| 45 | Ga0068857_100097086 | 3300005577 | Bacteria | 2641 |
| 46 | Ga0068857_100297587 | 3300005577 | Bacteria | 1487 |
| 47 | Ga0068856_100022537 | 3300005614 | Bacteria | 6123 |
| 48 | Ga0070702_100047786 | 3300005615 | Bacteria | 2432 |
| 49 | Ga0068859_100000896 | 3300005617 | Bacteria | 30335 |
| 50 | Ga0068859_100039154 | 3300005617 | Bacteria | 4755 |
| 51 | Ga0068864_100041682 | 3300005618 | Bacteria | 3926 |
| 52 | Ga0068861_100033132 | 3300005719 | Bacteria | 3809 |
| 53 | Ga0068861_100118529 | 3300005719 | Bacteria | 2132 |
| 54 | Ga0068861_100175312 | 3300005719 | Bacteria | 1780 |
| 55 | Ga0068870_10205092 | 3300005840 | Bacteria | 1198 |
| 56 | Ga0068863_100001326 | 3300005841 | Bacteria | 24643 |
| 57 | Ga0068863_100092105 | 3300005841 | Bacteria | 2875 |
| 58 | Ga0068863_100658609 | 3300005841 | Bacteria | 1039 |
| 59 | Ga0068863_100675731 | 3300005841 | Bacteria | 1025 |
| 60 | Ga0068858_100000111 | 3300005842 | Bacteria | 86228 |
| 61 | Ga0068860_100000296 | 3300005843 | Bacteria | 69084 |
| 62 | Ga0068860_100113000 | 3300005843 | Bacteria | 2597 |
| 63 | Ga0068860_100172283 | 3300005843 | Bacteria | 2091 |
| 64 | Ga0068860_100336985 | 3300005843 | Bacteria | 1482 |
| 65 | Ga0068860_100557004 | 3300005843 | Bacteria | 1149 |
| 66 | Ga0068862_100057402 | 3300005844 | Bacteria | 3338 |
| 67 | Ga0068862_100105340 | 3300005844 | Bacteria | 2472 |
| 68 | Ga0068862_100285934 | 3300005844 | Bacteria | 1513 |
| 69 | Ga0081455_10002600 | 3300005937 | Bacteria | 21413 |
| 70 | Ga0081455_10005681 | 3300005937 | Bacteria | 13613 |
| 71 | Ga0081455_10012544 | 3300005937 | Bacteria | 8455 |
| 72 | Ga0081455_10048642 | 3300005937 | Bacteria | 3662 |
| 73 | Ga0081538_10000065 | 3300005981 | Bacteria | 98948 |
| 74 | Ga0081538_10000173 | 3300005981 | Bacteria | 69480 |
| 75 | Ga0081538_10001042 | 3300005981 | Bacteria | 29561 |
| 76 | Ga0081538_10002259 | 3300005981 | Bacteria | 19075 |
| 77 | Ga0081538_10025650 | 3300005981 | Bacteria | 4148 |
| 78 | Ga0081538_10027159 | 3300005981 | Bacteria | 3977 |
| 79 | Ga0081540_1016755 | 3300005983 | Bacteria | 4569 |
| 80 | Ga0081539_10005587 | 3300005985 | Bacteria | 12693 |
| 81 | Ga0081539_10028836 | 3300005985 | Bacteria | 3484 |
| 82 | Ga0075365_10002257 | 3300006038 | Bacteria | 9339 |
| 83 | Ga0075365_10003395 | 3300006038 | Bacteria | 8189 |
| 84 | Ga0075365_10012915 | 3300006038 | Bacteria | 4978 |
| 85 | Ga0075365_10109241 | 3300006038 | Bacteria | 1900 |
| 86 | Ga0075365_10275991 | 3300006038 | Bacteria | 1182 |
| 87 | Ga0075363_100002562 | 3300006048 | Bacteria | 7472 |
| 88 | Ga0075364_10000398 | 3300006051 | Bacteria | 21738 |
| 89 | Ga0075364_10032821 | 3300006051 | Bacteria | 3338 |
| 90 | Ga0075362_10005795 | 3300006177 | Bacteria | 4553 |
| 91 | Ga0075367_10027388 | 3300006178 | Bacteria | 3242 |
| 92 | Ga0075367_10150227 | 3300006178 | Bacteria | 1445 |
| 93 | Ga0075369_10002925 | 3300006186 | Bacteria | 6166 |
| 94 | Ga0075369_10020606 | 3300006186 | Bacteria | 2700 |
| 95 | Ga0075366_10128422 | 3300006195 | Bacteria | 1529 |
| 96 | Ga0068871_100099033 | 3300006358 | Bacteria | 2440 |
| 97 | Ga0075428_100045649 | 3300006844 | Bacteria | 4814 |
| 98 | Ga0075428_100046992 | 3300006844 | Bacteria | 4742 |
| 99 | Ga0075428_100213728 | 3300006844 | Bacteria | 2084 |
| 100 | Ga0075428_100563062 | 3300006844 | Bacteria | 1218 |
| 101 | Ga0075428_100578619 | 3300006844 | Bacteria | 1200 |
| 102 | Ga0075430_100006226 | 3300006846 | Bacteria | 10066 |
| 103 | Ga0075430_100044932 | 3300006846 | Bacteria | 3734 |
| 104 | Ga0075430_100121603 | 3300006846 | Bacteria | 2177 |
| 105 | Ga0075431_100031179 | 3300006847 | Bacteria | 5491 |
| 106 | Ga0075431_100034006 | 3300006847 | Bacteria | 5253 |
| 107 | Ga0075431_100088579 | 3300006847 | Bacteria | 3195 |
| 108 | Ga0075431_100817477 | 3300006847 | Bacteria | 904 |
| 109 | Ga0075434_100133110 | 3300006871 | Bacteria | 2506 |
| 110 | Ga0075429_100155849 | 3300006880 | Bacteria | 2000 |
| 111 | Ga0097620_100000896 | 3300006931 | Bacteria | 30335 |
| 112 | Ga0097620_100039156 | 3300006931 | Bacteria | 4755 |
| 113 | Ga0075435_100348331 | 3300007076 | Bacteria | 1269 |
| 114 | Ga0105250_10025906 | 3300009092 | Bacteria | 2363 |
| 115 | Ga0105240_10084100 | 3300009093 | Bacteria | 3902 |
| 116 | Ga0111539_10912249 | 3300009094 | Bacteria | 1022 |
| 117 | Ga0105245_10036518 | 3300009098 | Bacteria | 4365 |
| 118 | Ga0105245_10115973 | 3300009098 | Bacteria | 2497 |
| 119 | Ga0105247_10001088 | 3300009101 | Bacteria | 20266 |
| 120 | Ga0114129_10036402 | 3300009147 | Bacteria | 6950 |
| 121 | Ga0105242_10661823 | 3300009176 | Bacteria | 1017 |
| 122 | Ga0105248_10017849 | 3300009177 | Bacteria | 7831 |
| 123 | Ga0105248_10021386 | 3300009177 | Bacteria | 7168 |
| 124 | Ga0105248_10544332 | 3300009177 | Bacteria | 1309 |
| 125 | Ga0105237_10074857 | 3300009545 | Bacteria | 3378 |
| 126 | Ga0105237_10225255 | 3300009545 | Bacteria | 1875 |
| 127 | Ga0105237_10494382 | 3300009545 | Bacteria | 1230 |
| 128 | Ga0105238_10092565 | 3300009551 | Bacteria | 3011 |
| 129 | Ga0105238_10305492 | 3300009551 | Bacteria | 1575 |
| 130 | Ga0105249_10015929 | 3300009553 | Bacteria | 6663 |
| 131 | Ga0105249_10378565 | 3300009553 | Bacteria | 1441 |
| 132 | Ga0105249_10461001 | 3300009553 | Bacteria | 1311 |
| 133 | Ga0105239_10046080 | 3300010375 | Bacteria | 4778 |
| 134 | Ga0105239_10099429 | 3300010375 | Bacteria | 3216 |
| 135 | Ga0105239_10105754 | 3300010375 | Bacteria | 3117 |
| 136 | Ga0105246_10044280 | 3300011119 | Bacteria | 3024 |
| 137 | Ga0105246_10075774 | 3300011119 | Bacteria | 2382 |
| 138 | Ga0157371_10317161 | 3300013102 | Bacteria | 1131 |
| 139 | Ga0157378_10104678 | 3300013297 | Bacteria | 2587 |
| 140 | Ga0163162_10061356 | 3300013306 | Bacteria | 3797 |
| 141 | Ga0163162_10153100 | 3300013306 | Bacteria | 2424 |
| 142 | Ga0157372_10072676 | 3300013307 | Unclassified | 3876 |
| 143 | Ga0157375_10069191 | 3300013308 | Bacteria | 3535 |
| 144 | Ga0157375_10201189 | 3300013308 | Bacteria | 2148 |
| 145 | Ga0163163_10027603 | 3300014325 | Bacteria | 5440 |
| 146 | Ga0163163_10068802 | 3300014325 | Bacteria | 3524 |
| 147 | Ga0157380_10102849 | 3300014326 | Bacteria | 2383 |
| 148 | Ga0157377_10071181 | 3300014745 | Bacteria | 2010 |
| 149 | Ga0157379_10016289 | 3300014968 | Bacteria | 6540 |
| 150 | Ga0157379_10031892 | 3300014968 | Bacteria | 4696 |
| 151 | Ga0157379_10116722 | 3300014968 | Bacteria | 2400 |
| 152 | Ga0157376_10237943 | 3300014969 | Bacteria | 1695 |
| 153 | Ga0209025_1000088 | 3300025294 | Bacteria | 255087 |
| 154 | Ga0207710_10000159 | 3300025900 | Bacteria | 71625 |
| 155 | Ga0207688_10008323 | 3300025901 | Bacteria | 5640 |
| 156 | Ga0207688_10166453 | 3300025901 | Bacteria | 1309 |
| 157 | Ga0207680_10035844 | 3300025903 | Bacteria | 2853 |
| 158 | Ga0207699_10222782 | 3300025906 | Bacteria | 1288 |
| 159 | Ga0207645_10076045 | 3300025907 | Bacteria | 2150 |
| 160 | Ga0207695_10008820 | 3300025913 | Bacteria | 12557 |
| 161 | Ga0207649_10211883 | 3300025920 | Bacteria | 1375 |
| 162 | Ga0207681_10088728 | 3300025923 | Bacteria | 2203 |
| 163 | Ga0207681_10271611 | 3300025923 | Bacteria | 1331 |
| 164 | Ga0207694_10005781 | 3300025924 | Bacteria | 9472 |
| 165 | Ga0207694_10246254 | 3300025924 | Bacteria | 1462 |
| 166 | Ga0207659_10117900 | 3300025926 | Bacteria | 2029 |
| 167 | Ga0207664_10021989 | 3300025929 | Bacteria | 4753 |
| 168 | Ga0207644_10002989 | 3300025931 | Bacteria | 10873 |
| 169 | Ga0207690_10047725 | 3300025932 | Bacteria | 2843 |
| 170 | Ga0207706_10293836 | 3300025933 | Bacteria | 1416 |
| 171 | Ga0207706_10390881 | 3300025933 | Bacteria | 1206 |
| 172 | Ga0207686_10108362 | 3300025934 | Bacteria | 1869 |
| 173 | Ga0207686_10379483 | 3300025934 | Bacteria | 1071 |
| 174 | Ga0207670_10092771 | 3300025936 | Bacteria | 2138 |
| 175 | Ga0207669_10154086 | 3300025937 | Bacteria | 1614 |
| 176 | Ga0207669_10183716 | 3300025937 | Bacteria | 1502 |
| 177 | Ga0207704_10033932 | 3300025938 | Bacteria | 2907 |
| 178 | Ga0207704_10322831 | 3300025938 | Bacteria | 1192 |
| 179 | Ga0207691_10066946 | 3300025940 | Bacteria | 3249 |
| 180 | Ga0207691_10286551 | 3300025940 | Bacteria | 1417 |
| 181 | Ga0207711_10099237 | 3300025941 | Bacteria | 2574 |
| 182 | Ga0207689_10035667 | 3300025942 | Bacteria | 4131 |
| 183 | Ga0207661_10213180 | 3300025944 | Bacteria | 1703 |
| 184 | Ga0207679_10120728 | 3300025945 | Bacteria | 2086 |
| 185 | Ga0207667_10005671 | 3300025949 | Bacteria | 15220 |
| 186 | Ga0207651_10068114 | 3300025960 | Bacteria | 2508 |
| 187 | Ga0207712_10021136 | 3300025961 | Bacteria | 4270 |
| 188 | Ga0207712_10120916 | 3300025961 | Unclassified | 1981 |
| 189 | Ga0207668_10015986 | 3300025972 | Bacteria | 4674 |
| 190 | Ga0207668_10156909 | 3300025972 | Bacteria | 1769 |
| 191 | Ga0207703_10010088 | 3300026035 | Bacteria | 7403 |
| 192 | Ga0207703_10174597 | 3300026035 | Bacteria | 1893 |
| 193 | Ga0207639_10018158 | 3300026041 | Bacteria | 4995 |
| 194 | Ga0207678_10018217 | 3300026067 | Bacteria | 6167 |
| 195 | Ga0207641_10007413 | 3300026088 | Bacteria | 9124 |
| 196 | Ga0207641_10075118 | 3300026088 | Bacteria | 2918 |
| 197 | Ga0207641_10530381 | 3300026088 | Bacteria | 1146 |
| 198 | Ga0207648_10026877 | 3300026089 | Bacteria | 5110 |
| 199 | Ga0207648_10165208 | 3300026089 | Bacteria | 1956 |
| 200 | Ga0207648_10271587 | 3300026089 | Bacteria | 1515 |
| 201 | Ga0207674_10060893 | 3300026116 | Bacteria | 3816 |
| 202 | Ga0207675_100019500 | 3300026118 | Bacteria | 6329 |
| 203 | Ga0207675_100020502 | 3300026118 | Bacteria | 6162 |
| 204 | Ga0207675_100209719 | 3300026118 | Bacteria | 1873 |
| 205 | Ga0207683_10023505 | 3300026121 | Bacteria | 5302 |
| 206 | Ga0207683_10086370 | 3300026121 | Bacteria | 2789 |
| 207 | Ga0207683_10225040 | 3300026121 | Bacteria | 1710 |
| 208 | Ga0207698_10149617 | 3300026142 | Bacteria | 2024 |
| 209 | Ga0207698_10177646 | 3300026142 | Bacteria | 1882 |
| 210 | Ga0268266_10490049 | 3300028379 | Bacteria | 1172 |
| 211 | Ga0268265_10010708 | 3300028380 | Bacteria | 6191 |
| 212 | Ga0268265_10024629 | 3300028380 | Bacteria | 4260 |
| 213 | Ga0268265_10396055 | 3300028380 | Bacteria | 1275 |
| 214 | Ga0268265_10435155 | 3300028380 | Bacteria | 1221 |
| 215 | Ga0268264_10000088 | 3300028381 | Bacteria | 235344 |
| 216 | Ga0268264_10077753 | 3300028381 | Bacteria | 2827 |
| 217 | Ga0307513_10032762 | 3300031456 | Bacteria | 5854 |
| 218 | Ga0307513_10058872 | 3300031456 | Bacteria | 4080 |
| 219 | Ga0307509_10000028 | 3300031507 | Bacteria | 223572 |
| 220 | Ga0307405_10000766 | 3300031731 | Bacteria | 12559 |
| 221 | Ga0307412_10075091 | 3300031911 | Bacteria | 2318 |
| 222 | Ga0307409_100044844 | 3300031995 | Bacteria | 3333 |
| 223 | Ga0307409_100178988 | 3300031995 | Bacteria | 1875 |
| 224 | Ga0307416_100579895 | 3300032002 | Bacteria | 1199 |
| 225 | Ga0307414_10246346 | 3300032004 | Bacteria | 1483 |
| 226 | Ga0307411_10003330 | 3300032005 | Bacteria | 7435 |
| 227 | Ga0307415_100316662 | 3300032126 | Bacteria | 1299 |
| 228 | Ga0307510_10015408 | 3300033180 | Bacteria | 9039 |
| 229 | Ga0373933_0340896 | 3300035724 | Bacteria | 973 |
| 230 | Ga0395898_0128633 | 3300037466 | Bacteria | 2426 |
| 231 | Ga0395898_0454312 | 3300037466 | Bacteria | 1220 |
| 232 | Ga0395901_0166090 | 3300038443 | Bacteria | 2318 |
| 233 | Ga0400490_37622 | 3300038726 | Bacteria | 23446 |
| 234 | Ga0400491_17412 | 3300038727 | Unclassified | 3912 |
| 235 | Ga0450916_007468 | 3300042530 | Bacteria | 1313 |
| 236 | Ga0466972_0068550 | 3300044658 | Bacteria | 1695 |
| 237 | Ga0466960_0187277 | 3300044901 | Bacteria | 1125 |
| 238 | Ga0466960_0209533 | 3300044901 | Bacteria | 1068 |
| 239 | Ga0466959_0002963 | 3300045049 | Bacteria | 10959 |
| 240 | Ga0495584_0108776 | 3300046491 | Bacteria | 1402 |
| 241 | Ga0495632_0031795 | 3300046519 | Unclassified | 2725 |
| 242 | Ga0495632_0071119 | 3300046519 | Bacteria | 1672 |
| 243 | Ga0495666_0134369 | 3300046526 | Bacteria | 1155 |
| 244 | Ga0495645_0028162 | 3300046543 | Bacteria | 4082 |
| 245 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 246 | Ga0495668_0059194 | 3300046616 | Bacteria | 2114 |
| 247 | Ga0495625_0167185 | 3300046660 | Bacteria | 1470 |
| 248 | Ga0495661_0096471 | 3300046665 | Bacteria | 1672 |
| 249 | Ga0495588_0001286 | 3300046674 | Bacteria | 10740 |
| 250 | Ga0495589_0167551 | 3300046794 | Bacteria | 1045 |
| 251 | Ga0495636_0055140 | 3300047318 | Bacteria | 1671 |
| 252 | Ga0496100_0274378 | 3300048903 | Bacteria | 1255 |
| 253 | Ga0496101_0105756 | 3300048904 | Bacteria | 2112 |
| 254 | Ga0496102_0078662 | 3300048905 | Bacteria | 3036 |
| 255 | Ga0496102_0137645 | 3300048905 | Bacteria | 2288 |
| 256 | Ga0496102_0251380 | 3300048905 | Bacteria | 1667 |
| 257 | Ga0496102_0474177 | 3300048905 | Bacteria | 1173 |
| 258 | Ga0496104_0041004 | 3300048907 | Bacteria | 4340 |
| 259 | Ga0496104_0045546 | 3300048907 | Bacteria | 4126 |
| 260 | Ga0496104_0108885 | 3300048907 | Bacteria | 2656 |
| 261 | Ga0496105_0225311 | 3300048908 | Bacteria | 1525 |
| 262 | Ga0496105_0386859 | 3300048908 | Bacteria | 1112 |
| 263 | Ga0496107_0211152 | 3300048910 | Bacteria | 1443 |
| 264 | Ga0496107_0222229 | 3300048910 | Bacteria | 1405 |
| 265 | Ga0496108_0104699 | 3300048911 | Bacteria | 2415 |
| 266 | Ga0496108_0159220 | 3300048911 | Bacteria | 1951 |
| 267 | Ga0496109_0156857 | 3300048912 | Bacteria | 2132 |
| 268 | Ga0496110_0311580 | 3300048913 | Bacteria | 1433 |
| 269 | Ga0496110_0322681 | 3300048913 | Bacteria | 1407 |
| 270 | Ga0496110_0606535 | 3300048913 | Bacteria | 993 |
| 271 | Ga0496112_0014768 | 3300048915 | Bacteria | 7262 |
| 272 | Ga0496112_0038527 | 3300048915 | Bacteria | 4668 |
| 273 | Ga0496112_0153277 | 3300048915 | Bacteria | 2272 |
| 274 | Ga0496112_0282145 | 3300048915 | Bacteria | 1608 |
| 275 | Ga0496113_0149529 | 3300048916 | Bacteria | 1842 |
| 276 | Ga0496117_0017367 | 3300048920 | Bacteria | 6009 |
| 277 | Ga0496118_0007929 | 3300048921 | Bacteria | 11109 |
| 278 | Ga0496118_0081647 | 3300048921 | Bacteria | 2269 |
| 279 | Ga0496121_0001213 | 3300048924 | Bacteria | 44955 |
| 280 | Ga0496121_0352809 | 3300048924 | Bacteria | 979 |
| 281 | Ga0496124_0261930 | 3300048927 | Bacteria | 1272 |
| 282 | Ga0496125_0092216 | 3300048928 | Bacteria | 2266 |
| 283 | Ga0496125_0195902 | 3300048928 | Bacteria | 1329 |
| 284 | Ga0501036_0175260 | 3300049572 | Bacteria | 1806 |
| 285 | Ga0501039_0015920 | 3300049575 | Bacteria | 5758 |
| 286 | Ga0501048_0300792 | 3300049582 | Bacteria | 1141 |
| 287 | Ga0501072_0009270 | 3300049588 | Bacteria | 7479 |
| 288 | Ga0501076_0036445 | 3300049592 | Bacteria | 3854 |
| 289 | nmdc:mga03n38_16009_c1 | 3300050490 | Bacteria | 2909 |
| 290 | nmdc:mga00v17_1652_c1 | 3300050491 | Bacteria | 11632 |
| 291 | nmdc:mga00v17_233820_c1 | 3300050491 | Bacteria | 1191 |
| 292 | nmdc:mga00v17_47010_c1 | 3300050491 | Bacteria | 2613 |
| 293 | nmdc:mga0yw44_178529_c1 | 3300050492 | Bacteria | 1397 |
| 294 | nmdc:mga0yw44_234535_c1 | 3300050492 | Bacteria | 1218 |
| 295 | nmdc:mga05p37_152228_c1 | 3300050507 | Bacteria | 2828 |
| 296 | nmdc:mga05p37_259253_c1 | 3300050507 | Bacteria | 2082 |
| 297 | nmdc:mga09592_277848_c1 | 3300050508 | Bacteria | 1452 |
| 298 | nmdc:mga09592_356616_c1 | 3300050508 | Bacteria | 1265 |
| 299 | nmdc:mga0qj67_37481_c1 | 3300050509 | Bacteria | 3798 |
| 300 | nmdc:mga0qj67_6464_c1 | 3300050509 | Bacteria | 8613 |
| 301 | nmdc:mga06r32_164147_c1 | 3300050510 | Bacteria | 2204 |
| 302 | nmdc:mga06r32_178234_c1 | 3300050510 | Bacteria | 2110 |
| 303 | nmdc:mga06r32_41210_c1 | 3300050510 | Bacteria | 4386 |
| 304 | nmdc:mga06r32_47549_c1 | 3300050510 | Bacteria | 4098 |
| 305 | nmdc:mga08y16_367722_c1 | 3300050511 | Bacteria | 1475 |
| 306 | nmdc:mga0n895_173702_c1 | 3300050512 | Bacteria | 2186 |
| 307 | Ga0500616_0000064 | 3300053153 | Bacteria | 243072 |
| 308 | Ga0501082_0487860 | 3300060353 | Bacteria | 1077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8056667051 | 8056671895 | 262 |
| 2 | 3300028380 | Ga0268265_10435155 | Ga0268265_104351552 | 263 |
| 3 | 3300006844 | Ga0075428_100578619 | Ga0075428_1005786192 | 264 |
| 4 | iso_pu_bacteria | 2895427314 | 2895433021 | 265 |
| 5 | 3300009553 | Ga0105249_10461001 | Ga0105249_104610012 | 266 |
| 6 | 3300005843 | Ga0068860_100557004 | Ga0068860_1005570042 | 267 |
| 7 | 3300025938 | Ga0207704_10322831 | Ga0207704_103228312 | 267 |
| 8 | 3300026142 | Ga0207698_10149617 | Ga0207698_101496172 | 267 |
| 9 | iso_pu_bacteria | 2643221578 | 2643902734 | 267 |
| 10 | iso_pu_bacteria | 2643221673 | 2644404757 | 267 |
| 11 | iso_pu_bacteria | 2946045630 | 2946048762 | 267 |
| 12 | 3300005985 | Ga0081539_10005587 | Ga0081539_100055872 | 268 |
| 13 | 3300005985 | Ga0081539_10028836 | Ga0081539_100288363 | 268 |
| 14 | 3300005937 | Ga0081455_10048642 | Ga0081455_100486424 | 269 |
| 15 | iso_pu_bacteria | 2513237101 | 2513692255 | 269 |
| 16 | iso_pu_bacteria | 2721755755 | 2723845370 | 269 |
| 17 | iso_pu_bacteria | 2791355199 | 2793083425 | 269 |
| 18 | iso_pu_bacteria | 2874604998 | 2874608724 | 269 |
| 19 | iso_pu_bacteria | 2876808645 | 2876815243 | 269 |
| 20 | iso_pu_bacteria | 2879110137 | 2879111418 | 269 |
| 21 | iso_pu_bacteria | 2889033259 | 2889040126 | 269 |
| 22 | iso_pu_bacteria | 2922386360 | 2922390721 | 269 |
| 23 | iso_pu_bacteria | 8006964411 | 8006973062 | 269 |
| 24 | iso_pu_bacteria | 8006994254 | 8007000514 | 269 |
| 25 | 3300025940 | Ga0207691_10286551 | Ga0207691_102865512 | 270 |
| 26 | iso_pu_bacteria | 3005416602 | 3005422988 | 270 |
| 27 | iso_pu_bacteria | 8005314921 | 8005315315 | 270 |
| 28 | 3300005843 | Ga0068860_100113000 | Ga0068860_1001130003 | 271 |
| 29 | iso_pu_bacteria | 2675903059 | 2676479622 | 271 |
| 30 | 3300003322 | rootL2_10097654 | rootL2_100976543 | 272 |
| 31 | 3300031456 | Ga0307513_10058872 | Ga0307513_100588722 | 272 |
| 32 | 3300031995 | Ga0307409_100178988 | Ga0307409_1001789882 | 272 |
| 33 | iso_pu_bacteria | 8056447290 | 8056448536 | 272 |
| 34 | 3300005328 | Ga0070676_10029665 | Ga0070676_100296651 | 273 |
| 35 | 3300005328 | Ga0070676_10313215 | Ga0070676_103132152 | 273 |
| 36 | 3300005331 | Ga0070670_100157327 | Ga0070670_1001573271 | 273 |
| 37 | 3300005334 | Ga0068869_100038078 | Ga0068869_1000380784 | 273 |
| 38 | 3300005338 | Ga0068868_100016590 | Ga0068868_1000165907 | 273 |
| 39 | 3300005338 | Ga0068868_100593069 | Ga0068868_1005930691 | 273 |
| 40 | 3300005341 | Ga0070691_10207764 | Ga0070691_102077641 | 273 |
| 41 | 3300005344 | Ga0070661_100246703 | Ga0070661_1002467032 | 273 |
| 42 | 3300005347 | Ga0070668_100064207 | Ga0070668_1000642072 | 273 |
| 43 | 3300005354 | Ga0070675_100122183 | Ga0070675_1001221832 | 273 |
| 44 | 3300005356 | Ga0070674_100084202 | Ga0070674_1000842022 | 273 |
| 45 | 3300005356 | Ga0070674_100309587 | Ga0070674_1003095872 | 273 |
| 46 | 3300005444 | Ga0070694_100369477 | Ga0070694_1003694771 | 273 |
| 47 | 3300005456 | Ga0070678_100017722 | Ga0070678_1000177226 | 273 |
| 48 | 3300005456 | Ga0070678_100098903 | Ga0070678_1000989033 | 273 |
| 49 | 3300005459 | Ga0068867_100222819 | Ga0068867_1002228192 | 273 |
| 50 | 3300005471 | Ga0070698_100267141 | Ga0070698_1002671412 | 273 |
| 51 | 3300005518 | Ga0070699_100059845 | Ga0070699_1000598453 | 273 |
| 52 | 3300005539 | Ga0068853_100117436 | Ga0068853_1001174362 | 273 |
| 53 | 3300005543 | Ga0070672_100063267 | Ga0070672_1000632676 | 273 |
| 54 | 3300005544 | Ga0070686_100078330 | Ga0070686_1000783304 | 273 |
| 55 | 3300005545 | Ga0070695_100295484 | Ga0070695_1002954841 | 273 |
| 56 | 3300005563 | Ga0068855_100083013 | Ga0068855_1000830133 | 273 |
| 57 | 3300005577 | Ga0068857_100097086 | Ga0068857_1000970864 | 273 |
| 58 | 3300005614 | Ga0068856_100022537 | Ga0068856_1000225376 | 273 |
| 59 | 3300005615 | Ga0070702_100047786 | Ga0070702_1000477863 | 273 |
| 60 | 3300005617 | Ga0068859_100039154 | Ga0068859_1000391546 | 273 |
| 61 | 3300005618 | Ga0068864_100041682 | Ga0068864_1000416822 | 273 |
| 62 | 3300005719 | Ga0068861_100175312 | Ga0068861_1001753122 | 273 |
| 63 | 3300005840 | Ga0068870_10205092 | Ga0068870_102050922 | 273 |
| 64 | 3300005841 | Ga0068863_100092105 | Ga0068863_1000921054 | 273 |
| 65 | 3300005841 | Ga0068863_100658609 | Ga0068863_1006586092 | 273 |
| 66 | 3300005843 | Ga0068860_100172283 | Ga0068860_1001722832 | 273 |
| 67 | 3300005843 | Ga0068860_100336985 | Ga0068860_1003369852 | 273 |
| 68 | 3300005844 | Ga0068862_100057402 | Ga0068862_1000574026 | 273 |
| 69 | 3300005937 | Ga0081455_10002600 | Ga0081455_1000260017 | 273 |
| 70 | 3300005983 | Ga0081540_1016755 | Ga0081540_10167553 | 273 |
| 71 | 3300006051 | Ga0075364_10032821 | Ga0075364_100328212 | 273 |
| 72 | 3300006178 | Ga0075367_10027388 | Ga0075367_100273888 | 273 |
| 73 | 3300006186 | Ga0075369_10002925 | Ga0075369_100029252 | 273 |
| 74 | 3300006195 | Ga0075366_10128422 | Ga0075366_101284222 | 273 |
| 75 | 3300006358 | Ga0068871_100099033 | Ga0068871_1000990332 | 273 |
| 76 | 3300006871 | Ga0075434_100133110 | Ga0075434_1001331102 | 273 |
| 77 | 3300006931 | Ga0097620_100039156 | Ga0097620_1000391566 | 273 |
| 78 | 3300007076 | Ga0075435_100348331 | Ga0075435_1003483311 | 273 |
| 79 | 3300009177 | Ga0105248_10017849 | Ga0105248_100178498 | 273 |
| 80 | 3300009551 | Ga0105238_10305492 | Ga0105238_103054922 | 273 |
| 81 | 3300009553 | Ga0105249_10378565 | Ga0105249_103785652 | 273 |
| 82 | 3300010375 | Ga0105239_10105754 | Ga0105239_101057544 | 273 |
| 83 | 3300011119 | Ga0105246_10075774 | Ga0105246_100757743 | 273 |
| 84 | 3300013297 | Ga0157378_10104678 | Ga0157378_101046782 | 273 |
| 85 | 3300013308 | Ga0157375_10069191 | Ga0157375_100691916 | 273 |
| 86 | 3300014325 | Ga0163163_10027603 | Ga0163163_100276032 | 273 |
| 87 | 3300014326 | Ga0157380_10102849 | Ga0157380_101028494 | 273 |
| 88 | 3300014745 | Ga0157377_10071181 | Ga0157377_100711812 | 273 |
| 89 | 3300014968 | Ga0157379_10031892 | Ga0157379_100318925 | 273 |
| 90 | 3300014969 | Ga0157376_10237943 | Ga0157376_102379432 | 273 |
| 91 | 3300025901 | Ga0207688_10008323 | Ga0207688_100083238 | 273 |
| 92 | 3300025901 | Ga0207688_10166453 | Ga0207688_101664531 | 273 |
| 93 | 3300025907 | Ga0207645_10076045 | Ga0207645_100760451 | 273 |
| 94 | 3300025920 | Ga0207649_10211883 | Ga0207649_102118832 | 273 |
| 95 | 3300025923 | Ga0207681_10088728 | Ga0207681_100887283 | 273 |
| 96 | 3300025923 | Ga0207681_10271611 | Ga0207681_102716112 | 273 |
| 97 | 3300025924 | Ga0207694_10246254 | Ga0207694_102462542 | 273 |
| 98 | 3300025926 | Ga0207659_10117900 | Ga0207659_101179002 | 273 |
| 99 | 3300025932 | Ga0207690_10047725 | Ga0207690_100477252 | 273 |
| 100 | 3300025933 | Ga0207706_10293836 | Ga0207706_102938362 | 273 |
| 101 | 3300025933 | Ga0207706_10390881 | Ga0207706_103908812 | 273 |
| 102 | 3300025934 | Ga0207686_10108362 | Ga0207686_101083621 | 273 |
| 103 | 3300025937 | Ga0207669_10154086 | Ga0207669_101540862 | 273 |
| 104 | 3300025938 | Ga0207704_10033932 | Ga0207704_100339322 | 273 |
| 105 | 3300025940 | Ga0207691_10066946 | Ga0207691_100669465 | 273 |
| 106 | 3300025941 | Ga0207711_10099237 | Ga0207711_100992373 | 273 |
| 107 | 3300025942 | Ga0207689_10035667 | Ga0207689_100356675 | 273 |
| 108 | 3300025972 | Ga0207668_10015986 | Ga0207668_100159861 | 273 |
| 109 | 3300026035 | Ga0207703_10174597 | Ga0207703_101745971 | 273 |
| 110 | 3300026041 | Ga0207639_10018158 | Ga0207639_100181588 | 273 |
| 111 | 3300026067 | Ga0207678_10018217 | Ga0207678_100182175 | 273 |
| 112 | 3300026088 | Ga0207641_10075118 | Ga0207641_100751183 | 273 |
| 113 | 3300026089 | Ga0207648_10271587 | Ga0207648_102715872 | 273 |
| 114 | 3300026116 | Ga0207674_10060893 | Ga0207674_100608934 | 273 |
| 115 | 3300026118 | Ga0207675_100019500 | Ga0207675_1000195008 | 273 |
| 116 | 3300026118 | Ga0207675_100020502 | Ga0207675_1000205026 | 273 |
| 117 | 3300026121 | Ga0207683_10023505 | Ga0207683_100235055 | 273 |
| 118 | 3300026121 | Ga0207683_10225040 | Ga0207683_102250403 | 273 |
| 119 | 3300028380 | Ga0268265_10010708 | Ga0268265_100107089 | 273 |
| 120 | 3300028380 | Ga0268265_10024629 | Ga0268265_100246298 | 273 |
| 121 | 3300028381 | Ga0268264_10077753 | Ga0268264_100777535 | 273 |
| 122 | 3300032002 | Ga0307416_100579895 | Ga0307416_1005798952 | 273 |
| 123 | 3300032126 | Ga0307415_100316662 | Ga0307415_1003166621 | 273 |
| 124 | 3300046491 | Ga0495584_0108776 | Ga0495584_0108776_529_1350 | 273 |
| 125 | 3300046519 | Ga0495632_0071119 | Ga0495632_0071119_326_1225 | 273 |
| 126 | 3300046526 | Ga0495666_0134369 | Ga0495666_0134369_134_955 | 273 |
| 127 | 3300046616 | Ga0495668_0059194 | Ga0495668_0059194_375_1196 | 273 |
| 128 | 3300046660 | Ga0495625_0167185 | Ga0495625_0167185_104_1003 | 273 |
| 129 | 3300046665 | Ga0495661_0096471 | Ga0495661_0096471_293_1114 | 273 |
| 130 | 3300046674 | Ga0495588_0001286 | Ga0495588_0001286_7920_8819 | 273 |
| 131 | 3300046794 | Ga0495589_0167551 | Ga0495589_0167551_25_846 | 273 |
| 132 | 3300047318 | Ga0495636_0055140 | Ga0495636_0055140_172_993 | 273 |
| 133 | 3300048905 | Ga0496102_0078662 | Ga0496102_0078662_537_1364 | 273 |
| 134 | 3300048905 | Ga0496102_0474177 | Ga0496102_0474177_107_928 | 273 |
| 135 | 3300048907 | Ga0496104_0108885 | Ga0496104_0108885_1453_2280 | 273 |
| 136 | 3300048910 | Ga0496107_0211152 | Ga0496107_0211152_519_1346 | 273 |
| 137 | 3300048911 | Ga0496108_0104699 | Ga0496108_0104699_416_1243 | 273 |
| 138 | 3300048913 | Ga0496110_0311580 | Ga0496110_0311580_94_921 | 273 |
| 139 | 3300048915 | Ga0496112_0038527 | Ga0496112_0038527_2581_3408 | 273 |
| 140 | 3300048921 | Ga0496118_0081647 | Ga0496118_0081647_483_1310 | 273 |
| 141 | 3300048928 | Ga0496125_0195902 | Ga0496125_0195902_280_1107 | 273 |
| 142 | 3300050507 | nmdc:mga05p37_152228_c1 | nmdc:mga05p37_152228_c1_488_1309 | 273 |
| 143 | 3300050512 | nmdc:mga0n895_173702_c1 | nmdc:mga0n895_173702_c1_561_1388 | 273 |
| 144 | 3300005937 | Ga0081455_10005681 | Ga0081455_100056814 | 274 |
| 145 | 3300005981 | Ga0081538_10002259 | Ga0081538_100022594 | 274 |
| 146 | 3300006844 | Ga0075428_100213728 | Ga0075428_1002137282 | 274 |
| 147 | 3300006844 | Ga0075428_100563062 | Ga0075428_1005630622 | 274 |
| 148 | 3300006847 | Ga0075431_100817477 | Ga0075431_1008174771 | 274 |
| 149 | 3300033180 | Ga0307510_10015408 | Ga0307510_100154083 | 274 |
| 150 | 3300048913 | Ga0496110_0606535 | Ga0496110_0606535_65_889 | 274 |
| 151 | 3300048915 | Ga0496112_0282145 | Ga0496112_0282145_122_946 | 274 |
| 152 | 3300048924 | Ga0496121_0352809 | Ga0496121_0352809_49_873 | 274 |
| 153 | 3300050508 | nmdc:mga09592_356616_c1 | nmdc:mga09592_356616_c1_102_932 | 274 |
| 154 | 3300050510 | nmdc:mga06r32_47549_c1 | nmdc:mga06r32_47549_c1_3233_4063 | 274 |
| 155 | 3300053153 | Ga0500616_0000064 | Ga0500616_0000064_10772_11596 | 274 |
| 156 | 3300005335 | Ga0070666_10029965 | Ga0070666_100299652 | 275 |
| 157 | 3300005340 | Ga0070689_100182911 | Ga0070689_1001829113 | 275 |
| 158 | 3300005355 | Ga0070671_100000958 | Ga0070671_1000009589 | 275 |
| 159 | 3300005365 | Ga0070688_100466912 | Ga0070688_1004669121 | 275 |
| 160 | 3300005367 | Ga0070667_100001242 | Ga0070667_1000012426 | 275 |
| 161 | 3300005544 | Ga0070686_100007793 | Ga0070686_1000077934 | 275 |
| 162 | 3300005548 | Ga0070665_100059150 | Ga0070665_1000591502 | 275 |
| 163 | 3300005564 | Ga0070664_100411800 | Ga0070664_1004118002 | 275 |
| 164 | 3300005617 | Ga0068859_100000896 | Ga0068859_10000089625 | 275 |
| 165 | 3300005719 | Ga0068861_100118529 | Ga0068861_1001185293 | 275 |
| 166 | 3300005841 | Ga0068863_100001326 | Ga0068863_10000132617 | 275 |
| 167 | 3300005842 | Ga0068858_100000111 | Ga0068858_10000011112 | 275 |
| 168 | 3300006931 | Ga0097620_100000896 | Ga0097620_10000089625 | 275 |
| 169 | 3300009092 | Ga0105250_10025906 | Ga0105250_100259062 | 275 |
| 170 | 3300009101 | Ga0105247_10001088 | Ga0105247_100010888 | 275 |
| 171 | 3300009177 | Ga0105248_10021386 | Ga0105248_100213864 | 275 |
| 172 | 3300009553 | Ga0105249_10015929 | Ga0105249_100159292 | 275 |
| 173 | 3300013306 | Ga0163162_10153100 | Ga0163162_101531002 | 275 |
| 174 | 3300014325 | Ga0163163_10068802 | Ga0163163_100688022 | 275 |
| 175 | 3300014968 | Ga0157379_10016289 | Ga0157379_100162892 | 275 |
| 176 | 3300025900 | Ga0207710_10000159 | Ga0207710_1000015953 | 275 |
| 177 | 3300025903 | Ga0207680_10035844 | Ga0207680_100358444 | 275 |
| 178 | 3300025931 | Ga0207644_10002989 | Ga0207644_100029896 | 275 |
| 179 | 3300025936 | Ga0207670_10092771 | Ga0207670_100927712 | 275 |
| 180 | 3300025960 | Ga0207651_10068114 | Ga0207651_100681143 | 275 |
| 181 | 3300025961 | Ga0207712_10021136 | Ga0207712_100211363 | 275 |
| 182 | 3300026035 | Ga0207703_10010088 | Ga0207703_100100888 | 275 |
| 183 | 3300026088 | Ga0207641_10007413 | Ga0207641_100074136 | 275 |
| 184 | 3300037466 | Ga0395898_0454312 | Ga0395898_0454312_255_1085 | 275 |
| 185 | 3300042530 | Ga0450916_007468 | Ga0450916_007468_414_1241 | 275 |
| 186 | 3300048903 | Ga0496100_0274378 | Ga0496100_0274378_363_1190 | 275 |
| 187 | 3300048905 | Ga0496102_0137645 | Ga0496102_0137645_1006_1833 | 275 |
| 188 | 3300048908 | Ga0496105_0225311 | Ga0496105_0225311_283_1122 | 275 |
| 189 | 3300048910 | Ga0496107_0222229 | Ga0496107_0222229_190_1017 | 275 |
| 190 | 3300048915 | Ga0496112_0014768 | Ga0496112_0014768_1162_1989 | 275 |
| 191 | 3300048924 | Ga0496121_0001213 | Ga0496121_0001213_6260_7087 | 275 |
| 192 | 3300048927 | Ga0496124_0261930 | Ga0496124_0261930_114_941 | 275 |
| 193 | 3300048928 | Ga0496125_0092216 | Ga0496125_0092216_1164_1991 | 275 |
| 194 | iso_pu_bacteria | 2515154137 | 2515754682 | 275 |
| 195 | iso_pu_bacteria | 2862290372 | 2862297076 | 275 |
| 196 | 3300005577 | Ga0068857_100297587 | Ga0068857_1002975872 | 276 |
| 197 | 3300005719 | Ga0068861_100033132 | Ga0068861_1000331323 | 276 |
| 198 | 3300005843 | Ga0068860_100000296 | Ga0068860_10000029635 | 276 |
| 199 | 3300005844 | Ga0068862_100105340 | Ga0068862_1001053403 | 276 |
| 200 | 3300005844 | Ga0068862_100285934 | Ga0068862_1002859342 | 276 |
| 201 | 3300009098 | Ga0105245_10115973 | Ga0105245_101159732 | 276 |
| 202 | 3300009177 | Ga0105248_10544332 | Ga0105248_105443322 | 276 |
| 203 | 3300009545 | Ga0105237_10225255 | Ga0105237_102252551 | 276 |
| 204 | 3300009545 | Ga0105237_10494382 | Ga0105237_104943822 | 276 |
| 205 | 3300010375 | Ga0105239_10046080 | Ga0105239_100460803 | 276 |
| 206 | 3300013102 | Ga0157371_10317161 | Ga0157371_103171611 | 276 |
| 207 | 3300013306 | Ga0163162_10061356 | Ga0163162_100613563 | 276 |
| 208 | 3300013307 | Ga0157372_10072676 | Ga0157372_100726762 | 276 |
| 209 | 3300013308 | Ga0157375_10201189 | Ga0157375_102011892 | 276 |
| 210 | 3300025961 | Ga0207712_10120916 | Ga0207712_101209162 | 276 |
| 211 | 3300026118 | Ga0207675_100209719 | Ga0207675_1002097192 | 276 |
| 212 | 3300028380 | Ga0268265_10396055 | Ga0268265_103960552 | 276 |
| 213 | 3300028381 | Ga0268264_10000088 | Ga0268264_1000008879 | 276 |
| 214 | 3300031456 | Ga0307513_10032762 | Ga0307513_100327625 | 276 |
| 215 | 3300044658 | Ga0466972_0068550 | Ga0466972_0068550_632_1462 | 276 |
| 216 | 3300044901 | Ga0466960_0209533 | Ga0466960_0209533_120_950 | 276 |
| 217 | 3300048912 | Ga0496109_0156857 | Ga0496109_0156857_1257_2087 | 276 |
| 218 | 3300048916 | Ga0496113_0149529 | Ga0496113_0149529_406_1236 | 276 |
| 219 | 3300005339 | Ga0070660_100518145 | Ga0070660_1005181451 | 277 |
| 220 | 3300005456 | Ga0070678_100254868 | Ga0070678_1002548682 | 277 |
| 221 | 3300005459 | Ga0068867_100021412 | Ga0068867_1000214123 | 277 |
| 222 | 3300005544 | Ga0070686_100488856 | Ga0070686_1004888561 | 277 |
| 223 | 3300005564 | Ga0070664_100216144 | Ga0070664_1002161442 | 277 |
| 224 | 3300005841 | Ga0068863_100675731 | Ga0068863_1006757311 | 277 |
| 225 | 3300006038 | Ga0075365_10012915 | Ga0075365_100129154 | 277 |
| 226 | 3300006038 | Ga0075365_10109241 | Ga0075365_101092413 | 277 |
| 227 | 3300006038 | Ga0075365_10275991 | Ga0075365_102759912 | 277 |
| 228 | 3300006844 | Ga0075428_100046992 | Ga0075428_1000469923 | 277 |
| 229 | 3300006846 | Ga0075430_100044932 | Ga0075430_1000449323 | 277 |
| 230 | 3300006847 | Ga0075431_100031179 | Ga0075431_1000311793 | 277 |
| 231 | 3300006880 | Ga0075429_100155849 | Ga0075429_1001558492 | 277 |
| 232 | 3300009098 | Ga0105245_10036518 | Ga0105245_100365184 | 277 |
| 233 | 3300014968 | Ga0157379_10116722 | Ga0157379_101167222 | 277 |
| 234 | 3300025945 | Ga0207679_10120728 | Ga0207679_101207281 | 277 |
| 235 | 3300025972 | Ga0207668_10156909 | Ga0207668_101569093 | 277 |
| 236 | 3300026088 | Ga0207641_10530381 | Ga0207641_105303811 | 277 |
| 237 | 3300026089 | Ga0207648_10026877 | Ga0207648_100268773 | 277 |
| 238 | 3300026089 | Ga0207648_10165208 | Ga0207648_101652082 | 277 |
| 239 | 3300026121 | Ga0207683_10086370 | Ga0207683_100863703 | 277 |
| 240 | 3300026142 | Ga0207698_10177646 | Ga0207698_101776462 | 277 |
| 241 | 3300048911 | Ga0496108_0159220 | Ga0496108_0159220_232_1098 | 277 |
| 242 | 3300050491 | nmdc:mga00v17_233820_c1 | nmdc:mga00v17_233820_c1_236_1069 | 277 |
| 243 | 3300050492 | nmdc:mga0yw44_234535_c1 | nmdc:mga0yw44_234535_c1_74_952 | 277 |
| 244 | iso_pu_bacteria | 2738543024 | 2739310207 | 277 |
| 245 | iso_pu_bacteria | 2919119836 | 2919121087 | 277 |
| 246 | iso_pu_bacteria | 8002285264 | 8002290464 | 277 |
| 247 | 3300005366 | Ga0070659_100322064 | Ga0070659_1003220642 | 278 |
| 248 | 3300005981 | Ga0081538_10000173 | Ga0081538_1000017315 | 278 |
| 249 | 3300009176 | Ga0105242_10661823 | Ga0105242_106618231 | 278 |
| 250 | 3300025913 | Ga0207695_10008820 | Ga0207695_100088206 | 278 |
| 251 | 3300025934 | Ga0207686_10379483 | Ga0207686_103794831 | 278 |
| 252 | 3300025937 | Ga0207669_10183716 | Ga0207669_101837162 | 278 |
| 253 | 3300025944 | Ga0207661_10213180 | Ga0207661_102131801 | 278 |
| 254 | 3300025949 | Ga0207667_10005671 | Ga0207667_1000567111 | 278 |
| 255 | 3300035724 | Ga0373933_0340896 | Ga0373933_0340896_23_910 | 278 |
| 256 | 3300044901 | Ga0466960_0187277 | Ga0466960_0187277_130_966 | 278 |
| 257 | 3300046519 | Ga0495632_0031795 | Ga0495632_0031795_1134_1985 | 278 |
| 258 | 3300048907 | Ga0496104_0041004 | Ga0496104_0041004_2883_3731 | 278 |
| 259 | 3300048915 | Ga0496112_0153277 | Ga0496112_0153277_471_1319 | 278 |
| 260 | 3300050510 | nmdc:mga06r32_164147_c1 | nmdc:mga06r32_164147_c1_918_1772 | 278 |
| 261 | 3300005434 | Ga0070709_10066302 | Ga0070709_100663023 | 279 |
| 262 | 3300005435 | Ga0070714_100085843 | Ga0070714_1000858434 | 279 |
| 263 | 3300005435 | Ga0070714_100246174 | Ga0070714_1002461742 | 279 |
| 264 | 3300005981 | Ga0081538_10001042 | Ga0081538_1000104231 | 279 |
| 265 | 3300006038 | Ga0075365_10002257 | Ga0075365_100022579 | 279 |
| 266 | 3300006051 | Ga0075364_10000398 | Ga0075364_100003989 | 279 |
| 267 | 3300006177 | Ga0075362_10005795 | Ga0075362_100057954 | 279 |
| 268 | 3300006178 | Ga0075367_10150227 | Ga0075367_101502272 | 279 |
| 269 | 3300006186 | Ga0075369_10020606 | Ga0075369_100206062 | 279 |
| 270 | 3300006844 | Ga0075428_100045649 | Ga0075428_1000456492 | 279 |
| 271 | 3300006846 | Ga0075430_100006226 | Ga0075430_10000622611 | 279 |
| 272 | 3300006847 | Ga0075431_100034006 | Ga0075431_1000340064 | 279 |
| 273 | 3300009147 | Ga0114129_10036402 | Ga0114129_100364028 | 279 |
| 274 | 3300025906 | Ga0207699_10222782 | Ga0207699_102227822 | 279 |
| 275 | 3300025929 | Ga0207664_10021989 | Ga0207664_100219891 | 279 |
| 276 | 3300031911 | Ga0307412_10075091 | Ga0307412_100750911 | 279 |
| 277 | 3300037466 | Ga0395898_0128633 | Ga0395898_0128633_313_1170 | 279 |
| 278 | 3300046543 | Ga0495645_0028162 | Ga0495645_0028162_2185_3024 | 279 |
| 279 | 3300048904 | Ga0496101_0105756 | Ga0496101_0105756_262_1101 | 279 |
| 280 | 3300048907 | Ga0496104_0045546 | Ga0496104_0045546_1133_1972 | 279 |
| 281 | 3300048908 | Ga0496105_0386859 | Ga0496105_0386859_131_970 | 279 |
| 282 | 3300048913 | Ga0496110_0322681 | Ga0496110_0322681_528_1367 | 279 |
| 283 | 3300049572 | Ga0501036_0175260 | Ga0501036_0175260_12_851 | 279 |
| 284 | 3300049575 | Ga0501039_0015920 | Ga0501039_0015920_4887_5726 | 279 |
| 285 | 3300049582 | Ga0501048_0300792 | Ga0501048_0300792_184_1023 | 279 |
| 286 | 3300049588 | Ga0501072_0009270 | Ga0501072_0009270_333_1172 | 279 |
| 287 | 3300049592 | Ga0501076_0036445 | Ga0501076_0036445_1407_2246 | 279 |
| 288 | 3300050490 | nmdc:mga03n38_16009_c1 | nmdc:mga03n38_16009_c1_908_1747 | 279 |
| 289 | 3300050491 | nmdc:mga00v17_1652_c1 | nmdc:mga00v17_1652_c1_3052_3891 | 279 |
| 290 | 3300050507 | nmdc:mga05p37_259253_c1 | nmdc:mga05p37_259253_c1_646_1500 | 279 |
| 291 | 3300050508 | nmdc:mga09592_277848_c1 | nmdc:mga09592_277848_c1_482_1336 | 279 |
| 292 | 3300050509 | nmdc:mga0qj67_37481_c1 | nmdc:mga0qj67_37481_c1_2065_2919 | 279 |
| 293 | 3300050509 | nmdc:mga0qj67_6464_c1 | nmdc:mga0qj67_6464_c1_4527_5366 | 279 |
| 294 | 3300050510 | nmdc:mga06r32_41210_c1 | nmdc:mga06r32_41210_c1_778_1632 | 279 |
| 295 | iso_pu_bacteria | 8025478263 | 8025478577 | 279 |
| 296 | 3300005548 | Ga0070665_100390406 | Ga0070665_1003904062 | 280 |
| 297 | 3300005937 | Ga0081455_10012544 | Ga0081455_100125448 | 280 |
| 298 | 3300005981 | Ga0081538_10025650 | Ga0081538_100256502 | 280 |
| 299 | 3300005981 | Ga0081538_10027159 | Ga0081538_100271592 | 280 |
| 300 | 3300009094 | Ga0111539_10912249 | Ga0111539_109122491 | 280 |
| 301 | 3300028379 | Ga0268266_10490049 | Ga0268266_104900491 | 280 |
| 302 | 3300031507 | Ga0307509_10000028 | Ga0307509_10000028145 | 280 |
| 303 | 3300038443 | Ga0395901_0166090 | Ga0395901_0166090_1140_1994 | 280 |
| 304 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_297718_298566 | 280 |
| 305 | 3300050511 | nmdc:mga08y16_367722_c1 | nmdc:mga08y16_367722_c1_540_1403 | 280 |
| 306 | 3300005539 | Ga0068853_100009794 | Ga0068853_1000097942 | 281 |
| 307 | 3300009093 | Ga0105240_10084100 | Ga0105240_100841004 | 281 |
| 308 | 3300009545 | Ga0105237_10074857 | Ga0105237_100748574 | 281 |
| 309 | 3300009551 | Ga0105238_10092565 | Ga0105238_100925654 | 281 |
| 310 | 3300010375 | Ga0105239_10099429 | Ga0105239_100994292 | 281 |
| 311 | 3300025924 | Ga0207694_10005781 | Ga0207694_100057813 | 281 |
| 312 | 3300048905 | Ga0496102_0251380 | Ga0496102_0251380_549_1403 | 281 |
| 313 | 3300050491 | nmdc:mga00v17_47010_c1 | nmdc:mga00v17_47010_c1_810_1715 | 281 |
| 314 | 3300005981 | Ga0081538_10000065 | Ga0081538_1000006575 | 282 |
| 315 | 3300006038 | Ga0075365_10003395 | Ga0075365_100033959 | 282 |
| 316 | 3300006048 | Ga0075363_100002562 | Ga0075363_1000025625 | 282 |
| 317 | 3300031731 | Ga0307405_10000766 | Ga0307405_100007666 | 282 |
| 318 | 3300031995 | Ga0307409_100044844 | Ga0307409_1000448444 | 282 |
| 319 | 3300032004 | Ga0307414_10246346 | Ga0307414_102463462 | 282 |
| 320 | 3300032005 | Ga0307411_10003330 | Ga0307411_100033302 | 282 |
| 321 | 3300050492 | nmdc:mga0yw44_178529_c1 | nmdc:mga0yw44_178529_c1_250_1098 | 282 |
| 322 | iso_pu_bacteria | 2643221623 | 2644131283 | 282 |
| 323 | 3300006846 | Ga0075430_100121603 | Ga0075430_1001216032 | 283 |
| 324 | 3300006847 | Ga0075431_100088579 | Ga0075431_1000885795 | 283 |
| 325 | 3300011119 | Ga0105246_10044280 | Ga0105246_100442802 | 283 |
| 326 | 3300038726 | Ga0400490_37622 | Ga0400490_37622_14614_15477 | 283 |
| 327 | 3300038727 | Ga0400491_17412 | Ga0400491_17412_2786_3649 | 283 |
| 328 | 3300045049 | Ga0466959_0002963 | Ga0466959_0002963_3113_4105 | 283 |
| 329 | 3300048920 | Ga0496117_0017367 | Ga0496117_0017367_161_1042 | 283 |
| 330 | 3300048921 | Ga0496118_0007929 | Ga0496118_0007929_157_1038 | 283 |
| 331 | 3300050510 | nmdc:mga06r32_178234_c1 | nmdc:mga06r32_178234_c1_1114_1992 | 283 |
| 332 | 3300060353 | Ga0501082_0487860 | Ga0501082_0487860_109_1023 | 283 |
| 333 | iso_pu_bacteria | 2883821847 | 2883823619 | 283 |
| 334 | iso_pu_bacteria | 2904541872 | 2904544834 | 286 |
| 335 | iso_pu_bacteria | 2929160207 | 2929163494 | 286 |
| 336 | 3300003187 | JGI25151J46595_10009888 | JGI25151J46595_100098882 | 290 |
| 337 | 3300025294 | Ga0209025_1000088 | Ga0209025_1000088222 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r41-assembly1.cif.gz_P | bovine complex i in the presence of im1761092, active class i (composite map) | 0.808 | 13 | 283 |
| 6yj4-assembly1.cif.gz_P | structure of yarrowia lipolytica complex i at 2.7 a | 0.8019 | 15 | 283 |
| 3e48-assembly1.cif.gz_A | crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 | 0.798 | 16 | 277 |
| 5l4l-assembly1.cif.gz_A | polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 | 0.7902 | 17 | 287 |
| 2vrc-assembly1.cif.gz_D | crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) | 0.7867 | 16 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54LW0_12_289_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8737 | 17 | 280 | 3.40.50.720 |
| af_F4JRN8_123_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8622 | 17 | 70 | 3.40.50.720 |
| af_Q54LW0_12_289_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8298 | 17 | 280 | 3.40.50.720 |
| af_Q55F90_2_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8247 | 17 | 194 | 3.40.50.720 |
| af_A0A2R8RUA9_55_239_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8247 | 16 | 133 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352H7G5-F1-model_v4 | deleted | 0.9828 | 15 | 112 |
|
| AF-A0A7Y7LG42-F1-model_v4 | deleted | 0.9812 | 8 | 289 |
|
| AF-A0A1I9ZHF8-F1-model_v4 | deleted | 0.9766 | 13 | 290 |
|
| AF-A0A0Q6WER0-F1-model_v4 | NmrA family transcriptional regulator | 0.9755 | 15 | 286 |
|
| AF-A0A8A3NT30-F1-model_v4 | deleted | 0.9748 | 17 | 288 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar