F413183

General Info

Members Datasets Scaffolds Average Seq Length
337 232 674 354

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0052410|Ga0439449_0052410_274_1449
Length 391
Sequence MKNARMKIAQISPMYEAVPPKLYGGTERVVAHLCDALVHAGHEVTLFAAGDAQTLATLSPMRDQAIRLDPTPLKSDLAAHLAMLDEVRQRADEFDILHFHIDLLHFPFFQETPWRTLTTLHGRLDMKDLPQAYACWPQFPLASISDHQRRPLPAANWAGTVYHGVPTELYEYSPTPRGGYLAFLGRISPEKRVDRAIEIARRAGLPLRIAAKVDAVDRAYFHDEIEPLLAQPGVEYIGEINDEQKSEFLGGAVALLFPIDWPEPFGLVMIEAMACGTPVIAWNRGSVPEVLDYGHTGLIVDDMGEAVEAVHTVARFDRGRIRARFEQRYSSAAMARRYVELYWRVLEQGGSRVRLTACPTAAHRPRPRTDTTGHGSRRSRHVVFQLRPQGR

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
101 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
198 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
199 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
200 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
201 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
202 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
203 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
204 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
205 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
206 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
207 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
208 2643221583 Caulobacter sp. Root655 Isolate Unclassified
209 2643221584 Caulobacter sp. Root656 Isolate Unclassified
210 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
211 2643221640 Caulobacter sp. Root342 Isolate Unclassified
212 2643221642 Caulobacter sp. Root343 Isolate Unclassified
213 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
214 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
215 2643221672 Variovorax sp. Root434 Isolate Unclassified
216 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
217 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
218 2818991435 Caulobacter henricii 536 Isolate Unclassified
219 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
220 2842677519 Variovorax sp. R-72495 Isolate Unclassified
221 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
222 2849560528 Caulobacter zeae 410 Isolate Unclassified
223 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
224 2851153111 Caulobacter radicis 736 Isolate Unclassified
225 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
226 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
227 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
228 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
229 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
230 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
231 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
232 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.91
Metatranscriptomes 0
Isolates 10.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.36
Nodule 0
Rhizoplane 4.15
Rhizosphere 65.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0052410 3300042007 Bacteria 1509
2 rootL2_10118206 3300003322 Bacteria 7975
3 JGI25160J50197_1007158 3300003354 Bacteria 4398
4 Ga0055526_1026478 3300003771 Bacteria 1826
5 Ga0055524_1005944 3300003775 Bacteria 5370
6 Ga0055524_1006286 3300003775 Bacteria 5167
7 Ga0055536_1000488 3300003781 Bacteria 27544
8 Ga0055536_1000811 3300003781 Bacteria 20673
9 Ga0055530_10009783 3300003791 Bacteria 3628
10 Ga0055530_10014442 3300003791 Bacteria 2630
11 Ga0055540_1000174 3300003792 Bacteria 63200
12 Ga0055531_10000217 3300003794 Bacteria 63200
13 Ga0055531_10001409 3300003794 Bacteria 17754
14 Ga0055531_10006593 3300003794 Bacteria 6551
15 Ga0055531_10007422 3300003794 Bacteria 5991
16 Ga0055531_10009739 3300003794 Bacteria 4876
17 Ga0055531_10011641 3300003794 Bacteria 4218
18 Ga0065165_1001879 3300005262 Bacteria 20314
19 Ga0070658_10084228 3300005327 Bacteria 2614
20 Ga0070680_100023914 3300005336 Bacteria 4877
21 Ga0070660_100026650 3300005339 Bacteria 4306
22 Ga0070668_100001805 3300005347 Bacteria 15563
23 Ga0070669_100022412 3300005353 Bacteria 4514
24 Ga0070675_100132156 3300005354 Bacteria 2128
25 Ga0070671_100026309 3300005355 Bacteria 4780
26 Ga0070673_100152506 3300005364 Bacteria 1958
27 Ga0070659_100002674 3300005366 Bacteria 12677
28 Ga0070678_100096180 3300005456 Bacteria 2284
29 Ga0070662_100153574 3300005457 Bacteria 1795
30 Ga0070681_10286579 3300005458 Bacteria 1557
31 Ga0070679_100051212 3300005530 Bacteria 4112
32 Ga0068853_100033330 3300005539 Bacteria 4369
33 Ga0070665_100000058 3300005548 Bacteria 225040
34 Ga0070665_100237428 3300005548 Bacteria 1823
35 Ga0068855_100019460 3300005563 Bacteria 8157
36 Ga0068855_100027760 3300005563 Bacteria 6772
37 Ga0068855_100055382 3300005563 Bacteria 4658
38 Ga0070664_100069235 3300005564 Bacteria 3019
39 Ga0068852_100210444 3300005616 Bacteria 1844
40 Ga0068859_100338742 3300005617 Bacteria 1598
41 Ga0068864_100003810 3300005618 Bacteria 12433
42 Ga0068863_100077418 3300005841 Bacteria 3148
43 Ga0068860_100000027 3300005843 Bacteria 267207
44 Ga0068862_100073860 3300005844 Bacteria 2947
45 Ga0068862_100319029 3300005844 Bacteria 1434
46 Ga0075432_10004827 3300006058 Bacteria 4587
47 Ga0075362_10013007 3300006177 Bacteria 3320
48 Ga0075369_10004355 3300006186 Bacteria 5222
49 Ga0075370_10039827 3300006353 Bacteria 2649
50 Ga0075428_100106269 3300006844 Bacteria 3060
51 Ga0075431_100012629 3300006847 Bacteria 8528
52 Ga0075434_100088216 3300006871 Bacteria 3103
53 Ga0068865_100000811 3300006881 Bacteria 17577
54 Ga0097620_100338717 3300006931 Bacteria 1598
55 Ga0075435_100077404 3300007076 Bacteria 2727
56 Ga0105240_10030448 3300009093 Bacteria 7015
57 Ga0105240_10046771 3300009093 Bacteria 5480
58 Ga0105240_10304854 3300009093 Bacteria 1821
59 Ga0111539_10012723 3300009094 Bacteria 10539
60 Ga0111539_10057480 3300009094 Bacteria 4619
61 Ga0114129_10026112 3300009147 Bacteria 8272
62 Ga0105241_10116894 3300009174 Bacteria 2142
63 Ga0105248_10000176 3300009177 Bacteria 74521
64 Ga0105237_10293478 3300009545 Bacteria 1629
65 Ga0105238_10005419 3300009551 Bacteria 12608
66 Ga0105249_10008864 3300009553 Bacteria 8786
67 Ga0157371_10007263 3300013102 Bacteria 8999
68 Ga0157370_10107437 3300013104 Bacteria 2610
69 Ga0157369_10131314 3300013105 Bacteria 2654
70 Ga0163162_10080928 3300013306 Bacteria 3317
71 Ga0157372_10065906 3300013307 Bacteria 4068
72 Ga0163163_10146448 3300014325 Bacteria 2406
73 Ga0163163_10263020 3300014325 Bacteria 1776
74 Ga0182008_10003280 3300014497 Bacteria 9846
75 Ga0163161_10012312 3300017792 Bacteria 5938
76 Ga0209673_1013204 3300025273 Bacteria 3275
77 Ga0209673_1019494 3300025273 Bacteria 2433
78 Ga0209130_1000313 3300025284 Bacteria 57104
79 Ga0209130_1007910 3300025284 Bacteria 3209
80 Ga0209675_1014043 3300025291 Bacteria 2461
81 Ga0209676_1000152 3300025292 Bacteria 166700
82 Ga0209676_1000299 3300025292 Bacteria 100419
83 Ga0209676_1001104 3300025292 Bacteria 29955
84 Ga0209676_1003589 3300025292 Bacteria 9357
85 Ga0209676_1003785 3300025292 Bacteria 8961
86 Ga0209676_1008424 3300025292 Bacteria 4598
87 Ga0209025_1000850 3300025294 Bacteria 48320
88 Ga0209564_1019953 3300025295 Bacteria 2480
89 Ga0209758_1020784 3300025297 Bacteria 3089
90 Ga0209050_1000210 3300025298 Bacteria 129834
91 Ga0209050_1002112 3300025298 Bacteria 18133
92 Ga0209050_1005825 3300025298 Bacteria 7555
93 Ga0209050_1024323 3300025298 Bacteria 2100
94 Ga0209256_1000539 3300025299 Bacteria 54888
95 Ga0209256_1001162 3300025299 Bacteria 29719
96 Ga0209256_1001462 3300025299 Bacteria 24254
97 Ga0209256_1003411 3300025299 Bacteria 11198
98 Ga0209256_1014291 3300025299 Bacteria 2867
99 Ga0207426_1000065 3300025302 Bacteria 353625
100 Ga0209051_1000074 3300025303 Bacteria 208667
101 Ga0209257_1000072 3300025304 Bacteria 332791
102 Ga0209257_1000133 3300025304 Bacteria 208808
103 Ga0209257_1000362 3300025304 Bacteria 92009
104 Ga0209257_1000373 3300025304 Bacteria 90001
105 Ga0209257_1001099 3300025304 Bacteria 35228
106 Ga0209257_1002415 3300025304 Bacteria 18677
107 Ga0209257_1005620 3300025304 Bacteria 8681
108 Ga0207713_1015427 3300025735 Bacteria 3921
109 Ga0207705_10019402 3300025909 Bacteria 4861
110 Ga0207695_10001258 3300025913 Bacteria 43155
111 Ga0207695_10003676 3300025913 Bacteria 21385
112 Ga0207671_10245158 3300025914 Bacteria 1408
113 Ga0207660_10003378 3300025917 Bacteria 10406
114 Ga0207657_10008829 3300025919 Bacteria 10195
115 Ga0207657_10026726 3300025919 Bacteria 5297
116 Ga0207652_10010779 3300025921 Bacteria 7362
117 Ga0207681_10011930 3300025923 Bacteria 5351
118 Ga0207694_10074036 3300025924 Bacteria 2665
119 Ga0207644_10033699 3300025931 Bacteria 3582
120 Ga0207690_10014637 3300025932 Bacteria 4741
121 Ga0207686_10141381 3300025934 Bacteria 1664
122 Ga0207704_10003237 3300025938 Bacteria 7378
123 Ga0207704_10295954 3300025938 Bacteria 1237
124 Ga0207711_10000088 3300025941 Bacteria 98086
125 Ga0207667_10023478 3300025949 Bacteria 6791
126 Ga0207667_10030625 3300025949 Bacteria 5818
127 Ga0207651_10055835 3300025960 Bacteria 2715
128 Ga0207712_10085263 3300025961 Bacteria 2311
129 Ga0207658_10046938 3300025986 Bacteria 3158
130 Ga0207658_10108375 3300025986 Bacteria 2191
131 Ga0207677_10316360 3300026023 Bacteria 1295
132 Ga0207641_10051285 3300026088 Bacteria 3494
133 Ga0207676_10041021 3300026095 Bacteria 3550
134 Ga0207428_10022398 3300027907 Bacteria 5333
135 Ga0268266_10000005 3300028379 Bacteria 1448194
136 Ga0268266_10156744 3300028379 Bacteria 2057
137 Ga0268265_10000884 3300028380 Bacteria 28025
138 Ga0268265_10166312 3300028380 Bacteria 1880
139 Ga0268264_10000014 3300028381 Bacteria 509962
140 Ga0307515_10057858 3300028794 Bacteria 5600
141 Ga0307515_10205385 3300028794 Bacteria 1832
142 Ga0316176_1125790 3300030732 Bacteria 3856
143 Ga0314311_1023428 3300030733 Bacteria 2660
144 Ga0316180_1033476 3300030736 Bacteria 2072
145 Ga0316183_1086914 3300030742 Bacteria 14011
146 Ga0265327_10001877 3300031251 Bacteria 24307
147 Ga0265327_10002357 3300031251 Bacteria 20132
148 Ga0307513_10000127 3300031456 Bacteria 107100
149 Ga0307513_10007988 3300031456 Bacteria 13598
150 Ga0307408_100022053 3300031548 Bacteria 4320
151 Ga0307405_10029761 3300031731 Bacteria 3194
152 Ga0307413_10057512 3300031824 Bacteria 2379
153 Ga0307412_10224749 3300031911 Bacteria 1441
154 Ga0307409_100113028 3300031995 Bacteria 2282
155 Ga0307414_10234234 3300032004 Bacteria 1516
156 Ga0307411_10076455 3300032005 Bacteria 2289
157 Ga0307411_10263307 3300032005 Bacteria 1363
158 Ga0373936_0000754 3300035113 Bacteria 11359
159 Ga0373925_0085568 3300037068 Bacteria 2404
160 Ga0395898_0034438 3300037466 Bacteria 5048
161 Ga0395905_0025137 3300037471 Bacteria 5617
162 Ga0439436_0025386 3300041404 Bacteria 1740
163 Ga0439465_0000543 3300041413 Bacteria 11305
164 Ga0451853_1034999 3300041512 Bacteria 1696
165 Ga0439452_000612 3300042010 Bacteria 18067
166 Ga0450893_0006707 3300042532 Bacteria 1865
167 Ga0495627_000185 3300046453 Bacteria 69533
168 Ga0495590_0002775 3300046457 Bacteria 7226
169 Ga0495590_0005773 3300046457 Bacteria 4863
170 Ga0495638_0000838 3300046460 Bacteria 32241
171 Ga0495638_0000849 3300046460 Bacteria 31864
172 Ga0495638_0001745 3300046460 Bacteria 19048
173 Ga0495638_0002643 3300046460 Bacteria 14424
174 Ga0495638_0019226 3300046460 Bacteria 4520
175 Ga0495638_0106426 3300046460 Bacteria 1671
176 Ga0495650_0014245 3300046471 Bacteria 4150
177 Ga0495650_0037128 3300046471 Bacteria 2124
178 Ga0495605_0006759 3300046474 Bacteria 6555
179 Ga0495584_0004311 3300046491 Bacteria 7663
180 Ga0495585_0136894 3300046492 Bacteria 1285
181 Ga0495594_0000115 3300046499 Bacteria 37216
182 Ga0495596_0000837 3300046500 Bacteria 18600
183 Ga0495607_0005090 3300046501 Bacteria 9514
184 Ga0495607_0045794 3300046501 Bacteria 2571
185 Ga0495583_0000029 3300046506 Bacteria 255536
186 Ga0495583_0027325 3300046506 Bacteria 2817
187 Ga0495610_0000176 3300046512 Bacteria 71110
188 Ga0495610_0006991 3300046512 Bacteria 7633
189 Ga0495610_0010552 3300046512 Bacteria 5727
190 Ga0495616_0000476 3300046513 Bacteria 30434
191 Ga0495616_0057956 3300046513 Bacteria 1908
192 Ga0495631_0000095 3300046518 Bacteria 58760
193 Ga0495631_0002670 3300046518 Bacteria 9929
194 Ga0495632_0002145 3300046519 Bacteria 15320
195 Ga0495632_0004887 3300046519 Bacteria 8984
196 Ga0495632_0011093 3300046519 Bacteria 5280
197 Ga0495637_0001076 3300046520 Bacteria 16973
198 Ga0495637_0015715 3300046520 Bacteria 3548
199 Ga0495637_0027870 3300046520 Bacteria 2524
200 Ga0495644_0000098 3300046523 Bacteria 42137
201 Ga0495644_0000805 3300046523 Bacteria 12933
202 Ga0495648_0000029 3300046524 Bacteria 223499
203 Ga0495648_0032269 3300046524 Bacteria 3439
204 Ga0495654_0000012 3300046530 Bacteria 328997
205 Ga0495654_0001976 3300046530 Bacteria 13499
206 Ga0495654_0004261 3300046530 Bacteria 8548
207 Ga0495654_0035875 3300046530 Bacteria 2494
208 Ga0495597_0002437 3300046542 Bacteria 11800
209 Ga0495668_0003951 3300046616 Bacteria 10817
210 Ga0495668_0062344 3300046616 Bacteria 2054
211 Ga0495668_0073434 3300046616 Bacteria 1879
212 Ga0495611_0003779 3300046648 Bacteria 6609
213 Ga0495625_0000011 3300046660 Bacteria 377120
214 Ga0495625_0003489 3300046660 Bacteria 15596
215 Ga0495625_0009933 3300046660 Bacteria 7914
216 Ga0495625_0020651 3300046660 Bacteria 5079
217 Ga0495625_0063051 3300046660 Bacteria 2618
218 Ga0495625_0073255 3300046660 Bacteria 2401
219 Ga0495625_0106061 3300046660 Bacteria 1924
220 Ga0495661_0005940 3300046665 Bacteria 8623
221 Ga0495669_0000002 3300046684 Bacteria 282777
222 Ga0495669_0004126 3300046684 Bacteria 5975
223 Ga0495671_0002222 3300046692 Bacteria 12342
224 Ga0495671_0002925 3300046692 Bacteria 10645
225 Ga0495671_0127285 3300046692 Bacteria 1242
226 Ga0495649_0001099 3300046694 Bacteria 21118
227 Ga0495649_0020248 3300046694 Bacteria 3732
228 Ga0495589_0002985 3300046794 Bacteria 9322
229 Ga0495589_0013124 3300046794 Bacteria 4277
230 Ga0495660_0022791 3300046810 Bacteria 3573
231 Ga0495672_0001237 3300047320 Bacteria 25663
232 Ga0495672_0001385 3300047320 Bacteria 23871
233 Ga0495683_0000176 3300047323 Bacteria 62784
234 Ga0495683_0006957 3300047323 Bacteria 6138
235 Ga0495683_0072947 3300047323 Bacteria 1684
236 Ga0495679_014407 3300047446 Bacteria 2931
237 Ga0495673_0000056 3300047469 Bacteria 245918
238 Ga0495673_0000990 3300047469 Bacteria 25377
239 Ga0495673_0001202 3300047469 Bacteria 21580
240 Ga0495673_0005401 3300047469 Bacteria 7735
241 Ga0495673_0011548 3300047469 Bacteria 4743
242 Ga0495681_0004667 3300047470 Bacteria 9287
243 Ga0495686_0002001 3300047472 Bacteria 20201
244 Ga0495686_0002660 3300047472 Bacteria 16456
245 Ga0495686_0055335 3300047472 Bacteria 2481
246 Ga0495626_0002693 3300048091 Bacteria 12011
247 Ga0496101_0048344 3300048904 Bacteria 3057
248 Ga0496101_0117117 3300048904 Bacteria 2011
249 Ga0496102_0048920 3300048905 Bacteria 3845
250 Ga0496106_0023228 3300048909 Bacteria 4607
251 Ga0496107_0000515 3300048910 Bacteria 21514
252 Ga0496108_0105400 3300048911 Bacteria 2407
253 Ga0496109_0086137 3300048912 Bacteria 2901
254 Ga0496110_0006380 3300048913 Bacteria 9327
255 Ga0496110_0169018 3300048913 Bacteria 1983
256 Ga0496110_0191010 3300048913 Bacteria 1860
257 Ga0496113_0101356 3300048916 Bacteria 2232
258 Ga0496115_0000361 3300048918 Bacteria 38010
259 Ga0496115_0006875 3300048918 Bacteria 8353
260 Ga0496115_0201933 3300048918 Bacteria 1642
261 Ga0496121_0102538 3300048924 Bacteria 2204
262 Ga0496124_0006416 3300048927 Bacteria 12823
263 Ga0496124_0020436 3300048927 Bacteria 6117
264 Ga0496124_0192322 3300048927 Bacteria 1560
265 Ga0496126_0248195 3300048929 Bacteria 1484
266 Ga0495678_000191 3300049459 Bacteria 71862
267 Ga0495678_005150 3300049459 Bacteria 7331
268 Ga0501043_0001116 3300049579 Bacteria 23576
269 Ga0501047_0030265 3300049581 Bacteria 5220
270 Ga0501047_0092734 3300049581 Bacteria 2899
271 Ga0501047_0109902 3300049581 Bacteria 2640
272 Ga0501249_002659 3300049679 Bacteria 3599
273 Ga0501262_000102 3300049759 Bacteria 10495
274 Ga0501044_0437564 3300049823 Bacteria 1216
275 nmdc:mga03683_8951_c1 3300050489 Bacteria 3542
276 nmdc:mga03n38_78045_c1 3300050490 Bacteria 1549
277 nmdc:mga06z11_165801_c1 3300050494 Bacteria 1265
278 nmdc:mga05p37_10147_c1 3300050507 Bacteria 11180
279 nmdc:mga09592_25044_c1 3300050508 Bacteria 4936
280 nmdc:mga06r32_13143_c1 3300050510 Bacteria 7497
281 nmdc:mga08y16_13010_c1 3300050511 Bacteria 8757
282 nmdc:mga08y16_79734_c1 3300050511 Bacteria 3413
283 nmdc:mga0n895_87051_c1 3300050512 Bacteria 3121
284 nmdc:mga0rr50_92114_c1 3300050513 Bacteria 2362
285 nmdc:mga0a205_388122_c1 3300050515 Bacteria 1261
286 Ga0500578_0000008 3300053086 Bacteria 223557
287 Ga0500644_0000028 3300053088 Bacteria 92405
288 Ga0500641_0055836 3300053096 Bacteria 1635
289 Ga0500556_0000835 3300053104 Bacteria 17687
290 Ga0500562_000207 3300053108 Bacteria 15912
291 Ga0500562_009196 3300053108 Bacteria 2498
292 Ga0500562_018656 3300053108 Bacteria 1791
293 Ga0500594_0000015 3300053118 Bacteria 67180
294 Ga0500595_002175 3300053119 Bacteria 9957
295 Ga0500618_000024 3300053125 Bacteria 152149
296 Ga0500658_0002125 3300053134 Bacteria 7712
297 Ga0500559_0000145 3300053136 Bacteria 55410
298 Ga0500559_0011293 3300053136 Bacteria 3817
299 Ga0500564_000007 3300053138 Bacteria 84097
300 Ga0500616_0016841 3300053153 Bacteria 4154
301 Ga0500622_0000105 3300053156 Bacteria 85855
302 Ga0500611_005930 3300053727 Bacteria 1749
303 Ga0500609_000074 3300053731 Bacteria 12861
304 2511124392 2510917020 Bacteria 5657507
305 2513229025 2513020051 Bacteria 6053213
306 2572255046 2571042365 Bacteria 3289345
307 2585148605 2582581279 Bacteria 4980720
308 2585153605 2582581280 Bacteria 5994497
309 2585197409 2582581293 Bacteria 5907401
310 2587918878 2585428106 Bacteria 5179711
311 2643751604 2643221545 Bacteria 5083237
312 2643780175 2643221552 Bacteria 5708754
313 2643926106 2643221583 Bacteria 5218014
314 2643928627 2643221584 Bacteria 5511711
315 2644087884 2643221614 Bacteria 4260023
316 2644225522 2643221640 Bacteria 5258820
317 2644232832 2643221642 Bacteria 5357871
318 2644345489 2643221661 Bacteria 4267604
319 2644367240 2643221666 Bacteria 4265935
320 2644401814 2643221672 Bacteria 6322190
321 2644511363 2643221691 Bacteria 5093099
322 2792459706 2791355048 Bacteria 5832535
323 2819536729 2818991435 Bacteria 5433759
324 2819645890 2818991454 Bacteria 5563326
325 2842681429 2842677519 Bacteria 5615038
326 2843747362 2843744320 Bacteria 5659202
327 2849563258 2849560528 Bacteria 5393480
328 2849576811 2849573788 Bacteria 5421256
329 2851157958 2851153111 Bacteria 5542585
330 2857508818 2857504554 Bacteria 5369913
331 2884964558 2884960567 Bacteria 5437054
332 2898333754 2898329390 Bacteria 5168154
333 2919467914 2919462493 Bacteria 5817112
334 2928535576 2928531327 Bacteria 5101314
335 2945950008 2945945610 Bacteria 5951079
336 2954767922 2954767861 Bacteria 5535784
337 8003016463 8003014200 Bacteria 4059994
338 Ga0439449_0052410
339 rootL2_10118206
340 JGI25160J50197_1007158
341 Ga0055526_1026478
342 Ga0055524_1005944
343 Ga0055524_1006286
344 Ga0055536_1000488
345 Ga0055536_1000811
346 Ga0055530_10009783
347 Ga0055530_10014442
348 Ga0055540_1000174
349 Ga0055531_10000217
350 Ga0055531_10001409
351 Ga0055531_10006593
352 Ga0055531_10007422
353 Ga0055531_10009739
354 Ga0055531_10011641
355 Ga0065165_1001879
356 Ga0070658_10084228
357 Ga0070680_100023914
358 Ga0070660_100026650
359 Ga0070668_100001805
360 Ga0070669_100022412
361 Ga0070675_100132156
362 Ga0070671_100026309
363 Ga0070673_100152506
364 Ga0070659_100002674
365 Ga0070678_100096180
366 Ga0070662_100153574
367 Ga0070681_10286579
368 Ga0070679_100051212
369 Ga0068853_100033330
370 Ga0070665_100000058
371 Ga0070665_100237428
372 Ga0068855_100019460
373 Ga0068855_100027760
374 Ga0068855_100055382
375 Ga0070664_100069235
376 Ga0068852_100210444
377 Ga0068859_100338742
378 Ga0068864_100003810
379 Ga0068863_100077418
380 Ga0068860_100000027
381 Ga0068862_100073860
382 Ga0068862_100319029
383 Ga0075432_10004827
384 Ga0075362_10013007
385 Ga0075369_10004355
386 Ga0075370_10039827
387 Ga0075428_100106269
388 Ga0075431_100012629
389 Ga0075434_100088216
390 Ga0068865_100000811
391 Ga0097620_100338717
392 Ga0075435_100077404
393 Ga0105240_10030448
394 Ga0105240_10046771
395 Ga0105240_10304854
396 Ga0111539_10012723
397 Ga0111539_10057480
398 Ga0114129_10026112
399 Ga0105241_10116894
400 Ga0105248_10000176
401 Ga0105237_10293478
402 Ga0105238_10005419
403 Ga0105249_10008864
404 Ga0157371_10007263
405 Ga0157370_10107437
406 Ga0157369_10131314
407 Ga0163162_10080928
408 Ga0157372_10065906
409 Ga0163163_10146448
410 Ga0163163_10263020
411 Ga0182008_10003280
412 Ga0163161_10012312
413 Ga0209673_1013204
414 Ga0209673_1019494
415 Ga0209130_1000313
416 Ga0209130_1007910
417 Ga0209675_1014043
418 Ga0209676_1000152
419 Ga0209676_1000299
420 Ga0209676_1001104
421 Ga0209676_1003589
422 Ga0209676_1003785
423 Ga0209676_1008424
424 Ga0209025_1000850
425 Ga0209564_1019953
426 Ga0209758_1020784
427 Ga0209050_1000210
428 Ga0209050_1002112
429 Ga0209050_1005825
430 Ga0209050_1024323
431 Ga0209256_1000539
432 Ga0209256_1001162
433 Ga0209256_1001462
434 Ga0209256_1003411
435 Ga0209256_1014291
436 Ga0207426_1000065
437 Ga0209051_1000074
438 Ga0209257_1000072
439 Ga0209257_1000133
440 Ga0209257_1000362
441 Ga0209257_1000373
442 Ga0209257_1001099
443 Ga0209257_1002415
444 Ga0209257_1005620
445 Ga0207713_1015427
446 Ga0207705_10019402
447 Ga0207695_10001258
448 Ga0207695_10003676
449 Ga0207671_10245158
450 Ga0207660_10003378
451 Ga0207657_10008829
452 Ga0207657_10026726
453 Ga0207652_10010779
454 Ga0207681_10011930
455 Ga0207694_10074036
456 Ga0207644_10033699
457 Ga0207690_10014637
458 Ga0207686_10141381
459 Ga0207704_10003237
460 Ga0207704_10295954
461 Ga0207711_10000088
462 Ga0207667_10023478
463 Ga0207667_10030625
464 Ga0207651_10055835
465 Ga0207712_10085263
466 Ga0207658_10046938
467 Ga0207658_10108375
468 Ga0207677_10316360
469 Ga0207641_10051285
470 Ga0207676_10041021
471 Ga0207428_10022398
472 Ga0268266_10000005
473 Ga0268266_10156744
474 Ga0268265_10000884
475 Ga0268265_10166312
476 Ga0268264_10000014
477 Ga0307515_10057858
478 Ga0307515_10205385
479 Ga0316176_1125790
480 Ga0314311_1023428
481 Ga0316180_1033476
482 Ga0316183_1086914
483 Ga0265327_10001877
484 Ga0265327_10002357
485 Ga0307513_10000127
486 Ga0307513_10007988
487 Ga0307408_100022053
488 Ga0307405_10029761
489 Ga0307413_10057512
490 Ga0307412_10224749
491 Ga0307409_100113028
492 Ga0307414_10234234
493 Ga0307411_10076455
494 Ga0307411_10263307
495 Ga0373936_0000754
496 Ga0373925_0085568
497 Ga0395898_0034438
498 Ga0395905_0025137
499 Ga0439436_0025386
500 Ga0439465_0000543
501 Ga0451853_1034999
502 Ga0439452_000612
503 Ga0450893_0006707
504 Ga0495627_000185
505 Ga0495590_0002775
506 Ga0495590_0005773
507 Ga0495638_0000838
508 Ga0495638_0000849
509 Ga0495638_0001745
510 Ga0495638_0002643
511 Ga0495638_0019226
512 Ga0495638_0106426
513 Ga0495650_0014245
514 Ga0495650_0037128
515 Ga0495605_0006759
516 Ga0495584_0004311
517 Ga0495585_0136894
518 Ga0495594_0000115
519 Ga0495596_0000837
520 Ga0495607_0005090
521 Ga0495607_0045794
522 Ga0495583_0000029
523 Ga0495583_0027325
524 Ga0495610_0000176
525 Ga0495610_0006991
526 Ga0495610_0010552
527 Ga0495616_0000476
528 Ga0495616_0057956
529 Ga0495631_0000095
530 Ga0495631_0002670
531 Ga0495632_0002145
532 Ga0495632_0004887
533 Ga0495632_0011093
534 Ga0495637_0001076
535 Ga0495637_0015715
536 Ga0495637_0027870
537 Ga0495644_0000098
538 Ga0495644_0000805
539 Ga0495648_0000029
540 Ga0495648_0032269
541 Ga0495654_0000012
542 Ga0495654_0001976
543 Ga0495654_0004261
544 Ga0495654_0035875
545 Ga0495597_0002437
546 Ga0495668_0003951
547 Ga0495668_0062344
548 Ga0495668_0073434
549 Ga0495611_0003779
550 Ga0495625_0000011
551 Ga0495625_0003489
552 Ga0495625_0009933
553 Ga0495625_0020651
554 Ga0495625_0063051
555 Ga0495625_0073255
556 Ga0495625_0106061
557 Ga0495661_0005940
558 Ga0495669_0000002
559 Ga0495669_0004126
560 Ga0495671_0002222
561 Ga0495671_0002925
562 Ga0495671_0127285
563 Ga0495649_0001099
564 Ga0495649_0020248
565 Ga0495589_0002985
566 Ga0495589_0013124
567 Ga0495660_0022791
568 Ga0495672_0001237
569 Ga0495672_0001385
570 Ga0495683_0000176
571 Ga0495683_0006957
572 Ga0495683_0072947
573 Ga0495679_014407
574 Ga0495673_0000056
575 Ga0495673_0000990
576 Ga0495673_0001202
577 Ga0495673_0005401
578 Ga0495673_0011548
579 Ga0495681_0004667
580 Ga0495686_0002001
581 Ga0495686_0002660
582 Ga0495686_0055335
583 Ga0495626_0002693
584 Ga0496101_0048344
585 Ga0496101_0117117
586 Ga0496102_0048920
587 Ga0496106_0023228
588 Ga0496107_0000515
589 Ga0496108_0105400
590 Ga0496109_0086137
591 Ga0496110_0006380
592 Ga0496110_0169018
593 Ga0496110_0191010
594 Ga0496113_0101356
595 Ga0496115_0000361
596 Ga0496115_0006875
597 Ga0496115_0201933
598 Ga0496121_0102538
599 Ga0496124_0006416
600 Ga0496124_0020436
601 Ga0496124_0192322
602 Ga0496126_0248195
603 Ga0495678_000191
604 Ga0495678_005150
605 Ga0501043_0001116
606 Ga0501047_0030265
607 Ga0501047_0092734
608 Ga0501047_0109902
609 Ga0501249_002659
610 Ga0501262_000102
611 Ga0501044_0437564
612 nmdc:mga03683_8951_c1
613 nmdc:mga03n38_78045_c1
614 nmdc:mga06z11_165801_c1
615 nmdc:mga05p37_10147_c1
616 nmdc:mga09592_25044_c1
617 nmdc:mga06r32_13143_c1
618 nmdc:mga08y16_13010_c1
619 nmdc:mga08y16_79734_c1
620 nmdc:mga0n895_87051_c1
621 nmdc:mga0rr50_92114_c1
622 nmdc:mga0a205_388122_c1
623 Ga0500578_0000008
624 Ga0500644_0000028
625 Ga0500641_0055836
626 Ga0500556_0000835
627 Ga0500562_000207
628 Ga0500562_009196
629 Ga0500562_018656
630 Ga0500594_0000015
631 Ga0500595_002175
632 Ga0500618_000024
633 Ga0500658_0002125
634 Ga0500559_0000145
635 Ga0500559_0011293
636 Ga0500564_000007
637 Ga0500616_0016841
638 Ga0500622_0000105
639 Ga0500611_005930
640 Ga0500609_000074
641 2511124392
642 2513229025
643 2572255046
644 2585148605
645 2585153605
646 2585197409
647 2587918878
648 2643751604
649 2643780175
650 2643926106
651 2643928627
652 2644087884
653 2644225522
654 2644232832
655 2644345489
656 2644367240
657 2644401814
658 2644511363
659 2792459706
660 2819536729
661 2819645890
662 2842681429
663 2843747362
664 2849563258
665 2849576811
666 2851157958
667 2857508818
668 2884964558
669 2898333754
670 2919467914
671 2928535576
672 2945950008
673 2954767922
674 8003016463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

174

331

0.88

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

23

181

0.85

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

178

315

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fg9-assembly1.cif.gz_B-2 alpha-1,2-glucosyltransferase_udp_tll1591 0.9274 1 341
7fg9-assembly1.cif.gz_B-2 alpha-1,2-glucosyltransferase_udp_tll1591 0.9196 1 341
7vfk-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.8043 78 343
3mbo-assembly3.cif.gz_F crystal structure of the glycosyltransferase babsha bound with udp and l-malate 0.8002 2 339
2f9f-assembly1.cif.gz_A crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a. 0.7978 160 331
ID Description Score Start End Superfamily
af_Q9VZU8_216_412_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8883 172 339 3.40.50.2000
af_Q7KWM5_214_420_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8617 172 338 3.40.50.2000
af_Q9H553_211_399_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8325 160 324 3.40.50.2000
af_G5ECB6_188_358_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8295 168 309 3.40.50.2000
2iv3B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8286 159 321 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V5R2V1-F1-model_v4 Glycosyl transferase 0.9875 164 348 GO:0016757
AF-A0A537PI28-F1-model_v4 Glycosyltransferase family 4 protein 0.9873 165 342 GO:0016757
AF-A0A538S0A8-F1-model_v4 Glycosyltransferase family 4 protein 0.9869 1 340 GO:0016757
AF-A0A3M3SH19-F1-model_v4 deleted 0.9866 185 345
AF-A0A7V4UWJ4-F1-model_v4 Glycosyltransferase family 4 protein 0.9861 26 341 GO:0016757

Map