F413162

General Info

Members Datasets Scaffolds Average Seq Length
337 238 337 165

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0286605|Ga0373947_0286605_45_638
Length 197
Sequence MDRLWSPWRLAYVTGSAAGSATPTPSEPGCIFCAAAAALDSDWASASSSQGPLTPADLLIARGATCFVILNLYPYNNGHLMVVPKRHIGSLSAASDDELSEMMRLTRDAELALTEVYQAHGINVGINLGRAAGAGVLDHVHIHLVPRWTGDTNFLSVVGDTRVLPEDLRQTAQRLRPIFERLLSKGHAPAAERHEDR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0
Rhizoplane 5.04
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10150548 3300005290 Bacteria 1368
2 Ga0070690_100131005 3300005330 Bacteria 1693
3 Ga0070670_100610950 3300005331 Bacteria 976
4 Ga0068869_100121057 3300005334 Unclassified 2001
5 Ga0070666_10409948 3300005335 Bacteria 975
6 Ga0070680_100108525 3300005336 Unclassified 2309
7 Ga0068868_100158379 3300005338 Bacteria 1868
8 Ga0068868_100396103 3300005338 Bacteria 1191
9 Ga0068868_101517407 3300005338 Bacteria 628
10 Ga0070660_100148366 3300005339 Bacteria 1885
11 Ga0070689_100003486 3300005340 Bacteria 10472
12 Ga0070689_100016591 3300005340 Bacteria 5391
13 Ga0070689_100494697 3300005340 Bacteria 1047
14 Ga0070691_10062579 3300005341 Bacteria 1792
15 Ga0070687_100083666 3300005343 Unclassified 1748
16 Ga0070668_100304876 3300005347 Bacteria 1337
17 Ga0070669_100303039 3300005353 Bacteria 1286
18 Ga0070675_100039714 3300005354 Unclassified 3841
19 Ga0070675_100083795 3300005354 Bacteria 2662
20 Ga0070671_100100623 3300005355 Bacteria 2425
21 Ga0070674_100021285 3300005356 Bacteria 4159
22 Ga0070674_100100447 3300005356 Bacteria 2106
23 Ga0070673_100129196 3300005364 Bacteria 2117
24 Ga0070688_100050234 3300005365 Bacteria 2597
25 Ga0070688_100226692 3300005365 Unclassified 1320
26 Ga0070667_100113380 3300005367 Bacteria 2353
27 Ga0070667_100201604 3300005367 Bacteria 1766
28 Ga0070713_100056778 3300005436 Bacteria 3257
29 Ga0070701_10010430 3300005438 Bacteria 4109
30 Ga0070711_101287249 3300005439 Bacteria 634
31 Ga0070700_100153455 3300005441 Bacteria 1577
32 Ga0070700_100868067 3300005441 Bacteria 732
33 Ga0070694_100220671 3300005444 Bacteria 1422
34 Ga0070663_100020077 3300005455 Bacteria 4418
35 Ga0070678_100002596 3300005456 Bacteria 9930
36 Ga0070678_100104335 3300005456 Bacteria 2204
37 Ga0070678_100180727 3300005456 Bacteria 1727
38 Ga0070662_100041118 3300005457 Unclassified 3296
39 Ga0070662_100115681 3300005457 Bacteria 2049
40 Ga0070662_100612007 3300005457 Unclassified 917
41 Ga0070681_10003322 3300005458 Bacteria 15032
42 Ga0068867_100572975 3300005459 Bacteria 981
43 Ga0068867_101629670 3300005459 Bacteria 604
44 Ga0070685_10111319 3300005466 Bacteria 1687
45 Ga0070685_10458023 3300005466 Bacteria 895
46 Ga0070707_100559641 3300005468 Bacteria 1106
47 Ga0070698_100016340 3300005471 Bacteria 7836
48 Ga0070699_100537044 3300005518 Unclassified 1064
49 Ga0070679_100192826 3300005530 Bacteria 2006
50 Ga0070684_100336262 3300005535 Bacteria 1388
51 Ga0070684_100832032 3300005535 Bacteria 864
52 Ga0070684_101266514 3300005535 Bacteria 694
53 Ga0070697_100412570 3300005536 Bacteria 1173
54 Ga0070672_100218345 3300005543 Unclassified 1598
55 Ga0070686_100113496 3300005544 Bacteria 1850
56 Ga0070693_100950727 3300005547 Unclassified 647
57 Ga0068855_100007793 3300005563 Bacteria 12935
58 Ga0070664_100041011 3300005564 Bacteria 3905
59 Ga0070664_100043797 3300005564 Bacteria 3778
60 Ga0070664_100087629 3300005564 Bacteria 2692
61 Ga0070664_100556123 3300005564 Bacteria 1061
62 Ga0068857_100587520 3300005577 Bacteria 1052
63 Ga0068857_101580898 3300005577 Bacteria 640
64 Ga0068856_100589516 3300005614 Bacteria 1133
65 Ga0070702_100028232 3300005615 Bacteria 3040
66 Ga0070702_100167858 3300005615 Bacteria 1425
67 Ga0070702_100254041 3300005615 Bacteria 1193
68 Ga0068852_100180836 3300005616 Archaea 1983
69 Ga0068859_100019586 3300005617 Bacteria 6797
70 Ga0068864_101890080 3300005618 Bacteria 603
71 Ga0068861_100079908 3300005719 Bacteria 2557
72 Ga0068870_10018585 3300005840 Bacteria 3358
73 Ga0068863_100074466 3300005841 Bacteria 3212
74 Ga0068858_100049333 3300005842 Bacteria 3898
75 Ga0068860_100047816 3300005843 Bacteria 4077
76 Ga0070717_10947021 3300006028 Bacteria 784
77 Ga0075365_10004957 3300006038 Bacteria 7124
78 Ga0075368_10049518 3300006042 Unclassified 1667
79 Ga0075363_100052627 3300006048 Unclassified 2174
80 Ga0075364_10012948 3300006051 Bacteria 5119
81 Ga0070716_100244653 3300006173 Bacteria 1218
82 Ga0070712_100479264 3300006175 Bacteria 1040
83 Ga0075367_10003320 3300006178 Bacteria 7637
84 Ga0075367_10429404 3300006178 Bacteria 837
85 Ga0075366_10001113 3300006195 Bacteria 13230
86 Ga0097621_100727826 3300006237 Bacteria 915
87 Ga0068871_100001350 3300006358 Bacteria 16430
88 Ga0068871_100129598 3300006358 Bacteria 2138
89 Ga0068871_100293450 3300006358 Bacteria 1425
90 Ga0068871_100836878 3300006358 Unclassified 850
91 Ga0075428_100002024 3300006844 Bacteria 21851
92 Ga0075428_100025169 3300006844 Bacteria 6585
93 Ga0075431_100004914 3300006847 Bacteria 13166
94 Ga0075431_100154643 3300006847 Bacteria 2360
95 Ga0075431_100976456 3300006847 Unclassified 814
96 Ga0075433_10301564 3300006852 Bacteria 1419
97 Ga0075434_100076417 3300006871 Bacteria 3344
98 Ga0075434_100248168 3300006871 Bacteria 1799
99 Ga0075434_101016304 3300006871 Bacteria 843
100 Ga0075429_100027543 3300006880 Bacteria 4933
101 Ga0075429_101000560 3300006880 Bacteria 731
102 Ga0068865_100042529 3300006881 Bacteria 3099
103 Ga0068865_100402006 3300006881 Bacteria 1122
104 Ga0097620_100019586 3300006931 Bacteria 6797
105 Ga0075435_100012316 3300007076 Bacteria 6328
106 Ga0075435_100119681 3300007076 Unclassified 2197
107 Ga0105240_10200773 3300009093 Bacteria 2337
108 Ga0111539_10007017 3300009094 Bacteria 14452
109 Ga0111539_10381891 3300009094 Bacteria 1640
110 Ga0111539_10620086 3300009094 Unclassified 1260
111 Ga0111539_10689402 3300009094 Bacteria 1189
112 Ga0111539_11830927 3300009094 Bacteria 704
113 Ga0105245_10003151 3300009098 Bacteria 14749
114 Ga0105245_10026085 3300009098 Bacteria 5142
115 Ga0114129_10350740 3300009147 Bacteria 1955
116 Ga0105243_10027071 3300009148 Bacteria 4392
117 Ga0105242_10013483 3300009176 Bacteria 6320
118 Ga0105242_10068827 3300009176 Bacteria 2930
119 Ga0105242_10121143 3300009176 Bacteria 2245
120 Ga0105242_10780874 3300009176 Unclassified 943
121 Ga0105248_10055244 3300009177 Bacteria 4453
122 Ga0105248_10256285 3300009177 Bacteria 1969
123 Ga0105248_10728456 3300009177 Unclassified 1119
124 Ga0105248_10775584 3300009177 Bacteria 1082
125 Ga0105238_10118676 3300009551 Bacteria 2625
126 Ga0105249_10119817 3300009553 Unclassified 2500
127 Ga0105239_10307575 3300010375 Bacteria 1786
128 Ga0157374_10255463 3300013296 Unclassified 1725
129 Ga0157374_10451136 3300013296 Bacteria 1287
130 Ga0157378_10701932 3300013297 Bacteria 1031
131 Ga0163162_10119059 3300013306 Unclassified 2743
132 Ga0157375_10026665 3300013308 Bacteria 5390
133 Ga0157375_11009248 3300013308 Archaea 972
134 Ga0157380_10054401 3300014326 Bacteria 3176
135 Ga0157377_10142170 3300014745 Bacteria 1476
136 Ga0157379_10344847 3300014968 Bacteria 1363
137 Ga0157376_10009007 3300014969 Bacteria 7228
138 Ga0157376_10493774 3300014969 Bacteria 1202
139 Ga0157376_11074688 3300014969 Archaea 830
140 Ga0163161_10107901 3300017792 Bacteria 2078
141 Ga0207697_10044156 3300025315 Bacteria 1833
142 Ga0207642_10293423 3300025899 Bacteria 940
143 Ga0207680_10400826 3300025903 Unclassified 969
144 Ga0207699_10015628 3300025906 Bacteria 3947
145 Ga0207699_10041773 3300025906 Bacteria 2651
146 Ga0207643_10022777 3300025908 Bacteria 3452
147 Ga0207707_10035789 3300025912 Bacteria 4342
148 Ga0207662_10008526 3300025918 Bacteria 5616
149 Ga0207657_10030344 3300025919 Bacteria 4908
150 Ga0207657_10097530 3300025919 Bacteria 2444
151 Ga0207649_10192416 3300025920 Bacteria 1436
152 Ga0207681_10044269 3300025923 Unclassified 2983
153 Ga0207694_10135389 3300025924 Bacteria 1978
154 Ga0207694_10254126 3300025924 Bacteria 1439
155 Ga0207687_10032872 3300025927 Bacteria 3516
156 Ga0207700_10208059 3300025928 Bacteria 1652
157 Ga0207644_10171339 3300025931 Unclassified 1695
158 Ga0207690_10344074 3300025932 Bacteria 1178
159 Ga0207706_10043393 3300025933 Bacteria 3984
160 Ga0207686_10053866 3300025934 Unclassified 2518
161 Ga0207709_10099007 3300025935 Bacteria 1924
162 Ga0207670_10095666 3300025936 Bacteria 2110
163 Ga0207669_10031646 3300025937 Bacteria 2959
164 Ga0207669_10232312 3300025937 Unclassified 1361
165 Ga0207704_10010510 3300025938 Bacteria 4520
166 Ga0207691_10016964 3300025940 Bacteria 6910
167 Ga0207691_10167197 3300025940 Bacteria 1927
168 Ga0207691_10262471 3300025940 Bacteria 1489
169 Ga0207691_10445825 3300025940 Bacteria 1102
170 Ga0207711_10008767 3300025941 Bacteria 8459
171 Ga0207711_11335825 3300025941 Bacteria 659
172 Ga0207689_10241913 3300025942 Bacteria 1492
173 Ga0207661_10786432 3300025944 Bacteria 876
174 Ga0207667_10183648 3300025949 Bacteria 2147
175 Ga0207651_10301237 3300025960 Bacteria 1333
176 Ga0207651_10333433 3300025960 Unclassified 1272
177 Ga0207712_10048107 3300025961 Bacteria 2965
178 Ga0207658_10197236 3300025986 Bacteria 1678
179 Ga0207677_10084564 3300026023 Bacteria 2287
180 Ga0207703_10143114 3300026035 Bacteria 2077
181 Ga0207639_10351902 3300026041 Bacteria 1316
182 Ga0207678_10017074 3300026067 Bacteria 6373
183 Ga0207708_10024662 3300026075 Bacteria 4549
184 Ga0207641_10220293 3300026088 Bacteria 1759
185 Ga0207648_10037875 3300026089 Bacteria 4245
186 Ga0207648_10327735 3300026089 Bacteria 1377
187 Ga0207676_10165504 3300026095 Bacteria 1921
188 Ga0207674_10088058 3300026116 Bacteria 3098
189 Ga0207675_100009916 3300026118 Bacteria 8915
190 Ga0207675_100013696 3300026118 Bacteria 7570
191 Ga0207675_100026510 3300026118 Bacteria 5395
192 Ga0207683_10037377 3300026121 Bacteria 4227
193 Ga0207683_10045377 3300026121 Bacteria 3843
194 Ga0207683_10329789 3300026121 Bacteria 1399
195 Ga0207698_10514215 3300026142 Unclassified 1167
196 Ga0209971_1042058 3300027682 Bacteria 1100
197 Ga0209998_10013104 3300027717 Bacteria 1724
198 Ga0209813_10061825 3300027866 Unclassified 1197
199 Ga0209974_10077337 3300027876 Archaea 1141
200 Ga0207428_10000076 3300027907 Bacteria 137126
201 Ga0268265_10314020 3300028380 Unclassified 1416
202 Ga0268265_11177112 3300028380 Bacteria 763
203 Ga0268264_10033119 3300028381 Bacteria 4243
204 Ga0265338_10006402 3300028800 Bacteria 15013
205 Ga0265324_10035227 3300029957 Bacteria 1743
206 Ga0265320_10015731 3300031240 Bacteria 4266
207 Ga0265339_10194575 3300031249 Bacteria 1003
208 Ga0265327_10001666 3300031251 Bacteria 26718
209 Ga0265316_10141480 3300031344 Bacteria 1807
210 Ga0307408_101618444 3300031548 Bacteria 615
211 Ga0265313_10055480 3300031595 Bacteria 1877
212 Ga0265314_10186741 3300031711 Bacteria 1237
213 Ga0307413_10139647 3300031824 Bacteria 1672
214 Ga0307416_100365970 3300032002 Bacteria 1466
215 Ga0307414_10627932 3300032004 Bacteria 966
216 Ga0307411_10184768 3300032005 Bacteria 1586
217 Ga0307411_11074746 3300032005 Archaea 724
218 Ga0307415_100342722 3300032126 Bacteria 1255
219 Ga0373926_0013351 3300035083 Bacteria 2785
220 Ga0373944_0071738 3300035089 Unclassified 1129
221 Ga0373949_0138581 3300035090 Bacteria 695
222 Ga0373945_0094604 3300035116 Bacteria 1162
223 Ga0373956_0052189 3300035119 Bacteria 1839
224 Ga0373943_0049335 3300035170 Bacteria 2066
225 Ga0373943_0086284 3300035170 Archaea 1618
226 Ga0373943_0579924 3300035170 Unclassified 659
227 Ga0373946_0061529 3300035171 Archaea 1599
228 Ga0373955_0200823 3300035172 Bacteria 1187
229 Ga0373935_1046624 3300035692 Unclassified 607
230 Ga0373927_0090454 3300035695 Bacteria 1988
231 Ga0373927_0601103 3300035695 Unclassified 727
232 Ga0373927_1038287 3300035695 Archaea 541
233 Ga0373933_0235172 3300035724 Bacteria 1178
234 Ga0373947_0161935 3300035725 Unclassified 1448
235 Ga0373947_0286605 3300035725 Bacteria 1096
236 Ga0373937_0743045 3300036401 Unclassified 928
237 Ga0439431_0129325 3300041997 Bacteria 708
238 Ga0439445_0072677 3300042004 Unclassified 953
239 Ga0439451_047965 3300042009 Archaea 855
240 Ga0439434_0064682 3300042435 Bacteria 1147
241 Ga0439435_0086644 3300042436 Bacteria 946
242 Ga0439460_0190365 3300042461 Bacteria 696
243 Ga0450893_0026165 3300042532 Bacteria 1025
244 Ga0453684_0081202 3300044712 Bacteria 4044
245 Ga0495629_0249030 3300046459 Unclassified 1223
246 Ga0495580_0098467 3300046472 Bacteria 2034
247 Ga0495639_0170305 3300046475 Bacteria 1057
248 Ga0495664_0759141 3300046477 Unclassified 571
249 Ga0495608_0062505 3300046511 Bacteria 2446
250 Ga0495608_0507707 3300046511 Unclassified 730
251 Ga0495618_0311154 3300046514 Bacteria 977
252 Ga0495628_0090332 3300046516 Archaea 2371
253 Ga0495630_0003567 3300046517 Bacteria 10837
254 Ga0495652_0113073 3300046529 Archaea 2180
255 Ga0495665_0109122 3300046531 Archaea 1452
256 Ga0495640_0152392 3300046533 Bacteria 1485
257 Ga0495586_0237787 3300046535 Bacteria 1038
258 Ga0495645_0008051 3300046543 Bacteria 7342
259 Ga0495667_0022545 3300046559 Bacteria 4242
260 Ga0495656_0076136 3300046615 Unclassified 1503
261 Ga0495647_0056718 3300046681 Unclassified 1536
262 Ga0495658_0121937 3300046683 Unclassified 1577
263 Ga0495658_0208367 3300046683 Bacteria 1221
264 Ga0495658_0433168 3300046683 Unclassified 839
265 Ga0495669_0002793 3300046684 Bacteria 7157
266 Ga0495669_0006222 3300046684 Bacteria 4979
267 Ga0495613_0001592 3300046689 Bacteria 17199
268 Ga0495613_0241224 3300046689 Bacteria 1264
269 Ga0495613_0898773 3300046689 Bacteria 573
270 Ga0495670_0297019 3300046691 Archaea 865
271 Ga0495600_0032589 3300046809 Bacteria 3382
272 Ga0495674_0106227 3300047319 Bacteria 2385
273 Ga0495674_0193692 3300047319 Archaea 1688
274 Ga0495680_0547542 3300047322 Bacteria 780
275 Ga0495684_0005203 3300047471 Bacteria 10139
276 Ga0495684_0060882 3300047471 Bacteria 2873
277 Ga0496100_0014198 3300048903 Bacteria 4618
278 Ga0496101_0001080 3300048904 Bacteria 16146
279 Ga0496104_0092457 3300048907 Bacteria 2892
280 Ga0496104_0562967 3300048907 Bacteria 1050
281 Ga0496105_0093864 3300048908 Bacteria 2478
282 Ga0496106_0201903 3300048909 Bacteria 1582
283 Ga0496106_0421046 3300048909 Bacteria 1073
284 Ga0496106_0813187 3300048909 Bacteria 741
285 Ga0496107_0033631 3300048910 Bacteria 3669
286 Ga0496107_0048886 3300048910 Bacteria 3048
287 Ga0496109_0615254 3300048912 Bacteria 1023
288 Ga0496110_0129514 3300048913 Bacteria 2278
289 Ga0496111_0797074 3300048914 Bacteria 684
290 Ga0496112_0037537 3300048915 Bacteria 4728
291 Ga0496114_0071712 3300048917 Bacteria 2911
292 Ga0496114_0684614 3300048917 Unclassified 900
293 Ga0496115_0070749 3300048918 Bacteria 2829
294 Ga0501042_0200608 3300049578 Bacteria 1438
295 Ga0501048_0037051 3300049582 Bacteria 3503
296 Ga0501074_0128187 3300049590 Bacteria 1816
297 Ga0501075_0008967 3300049591 Bacteria 6978
298 Ga0501076_0017691 3300049592 Bacteria 5419
299 Ga0501076_0900054 3300049592 Bacteria 730
300 Ga0501079_0116188 3300049741 Bacteria 2080
301 Ga0501081_0382691 3300049743 Bacteria 1040
302 Ga0501083_0121099 3300049744 Bacteria 1716
303 Ga0501035_0296952 3300049822 Bacteria 1362
304 Ga0501045_0222134 3300049824 Bacteria 1406
305 nmdc:mga03n38_210270_c1 3300050490 Unclassified 1011
306 nmdc:mga00v17_105904_c1 3300050491 Unclassified 1780
307 nmdc:mga0k408_2606_c1 3300050493 Bacteria 9579
308 nmdc:mga06z11_19128_c1 3300050494 Unclassified 3143
309 nmdc:mga04h51_30549_c1 3300050495 Unclassified 1696
310 nmdc:mga05p37_340209_c1 3300050507 Bacteria 1769
311 nmdc:mga05p37_72853_c1 3300050507 Bacteria 4227
312 nmdc:mga09592_560771_c1 3300050508 Unclassified 981
313 nmdc:mga09592_862176_c1 3300050508 Bacteria 763
314 nmdc:mga0qj67_62926_c1 3300050509 Bacteria 2949
315 nmdc:mga06r32_107000_c1 3300050510 Bacteria 2748
316 nmdc:mga06r32_1278564_c1 3300050510 Unclassified 678
317 nmdc:mga06r32_2663_c1 3300050510 Bacteria 15966
318 nmdc:mga06r32_706876_c1 3300050510 Bacteria 973
319 nmdc:mga08y16_202265_c1 3300050511 Unclassified 2058
320 nmdc:mga08y16_3446_c1 3300050511 Bacteria 16417
321 nmdc:mga0n895_1104294_c1 3300050512 Bacteria 770
322 nmdc:mga0n895_303452_c1 3300050512 Bacteria 1618
323 nmdc:mga0n895_361193_c1 3300050512 Bacteria 1470
324 nmdc:mga0n895_408188_c1 3300050512 Bacteria 1374
325 nmdc:mga0rr50_1403301_c1 3300050513 Bacteria 591
326 nmdc:mga0rr50_314537_c1 3300050513 Unclassified 1312
327 nmdc:mga08x19_1054035_c1 3300050514 Bacteria 577
328 nmdc:mga0a205_181718_c1 3300050515 Bacteria 1997
329 Ga0495601_0002165 3300053077 Bacteria 11057
330 Ga0495601_0123930 3300053077 Bacteria 1680
331 Ga0495601_0269520 3300053077 Bacteria 1111
332 Ga0495619_0022943 3300053085 Bacteria 3995
333 Ga0495619_0252484 3300053085 Unclassified 1222
334 Ga0495619_0291117 3300053085 Bacteria 1131
335 Ga0501084_0577633 3300054114 Unclassified 950
336 Ga0590071_084611 3300059421 Bacteria 790
337 Ga0590077_017277 3300059426 Bacteria 1516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_706876_c1 nmdc:mga06r32_706876_c1_365_853 139
2 3300005340 Ga0070689_100494697 Ga0070689_1004946971 140
3 3300025932 Ga0207690_10344074 Ga0207690_103440742 140
4 3300006847 Ga0075431_100004914 Ga0075431_1000049142 146
5 3300009147 Ga0114129_10350740 Ga0114129_103507402 146
6 3300050507 nmdc:mga05p37_72853_c1 nmdc:mga05p37_72853_c1_3248_3736 146
7 3300050510 nmdc:mga06r32_2663_c1 nmdc:mga06r32_2663_c1_6696_7184 146
8 3300005436 Ga0070713_100056778 Ga0070713_1000567783 150
9 3300005439 Ga0070711_101287249 Ga0070711_1012872491 150
10 3300006173 Ga0070716_100244653 Ga0070716_1002446532 150
11 3300025906 Ga0207699_10015628 Ga0207699_100156284 150
12 3300025928 Ga0207700_10208059 Ga0207700_102080593 150
13 3300035119 Ga0373956_0052189 Ga0373956_0052189_462_947 150
14 3300035170 Ga0373943_0086284 Ga0373943_0086284_1070_1555 150
15 3300035171 Ga0373946_0061529 Ga0373946_0061529_229_714 150
16 3300035692 Ga0373935_1046624 Ga0373935_1046624_34_519 150
17 3300046477 Ga0495664_0759141 Ga0495664_0759141_18_503 150
18 3300046511 Ga0495608_0062505 Ga0495608_0062505_815_1300 150
19 3300046514 Ga0495618_0311154 Ga0495618_0311154_130_615 150
20 3300046516 Ga0495628_0090332 Ga0495628_0090332_201_686 150
21 3300046517 Ga0495630_0003567 Ga0495630_0003567_997_1482 150
22 3300046529 Ga0495652_0113073 Ga0495652_0113073_1151_1636 150
23 3300046531 Ga0495665_0109122 Ga0495665_0109122_618_1103 150
24 3300046559 Ga0495667_0022545 Ga0495667_0022545_1751_2236 150
25 3300046689 Ga0495613_0001592 Ga0495613_0001592_9259_9744 150
26 3300046691 Ga0495670_0297019 Ga0495670_0297019_354_839 150
27 3300046809 Ga0495600_0032589 Ga0495600_0032589_1449_1934 150
28 3300047319 Ga0495674_0193692 Ga0495674_0193692_530_1015 150
29 3300047471 Ga0495684_0005203 Ga0495684_0005203_2438_2923 150
30 3300050510 nmdc:mga06r32_1278564_c1 nmdc:mga06r32_1278564_c1_112_597 150
31 3300053077 Ga0495601_0002165 Ga0495601_0002165_820_1305 150
32 3300053085 Ga0495619_0022943 Ga0495619_0022943_2695_3180 150
33 3300005338 Ga0068868_101517407 Ga0068868_1015174071 152
34 3300006358 Ga0068871_100293450 Ga0068871_1002934502 152
35 3300006881 Ga0068865_100402006 Ga0068865_1004020062 152
36 3300009176 Ga0105242_10121143 Ga0105242_101211433 152
37 3300035116 Ga0373945_0094604 Ga0373945_0094604_21_497 152
38 3300035170 Ga0373943_0579924 Ga0373943_0579924_118_594 152
39 3300035695 Ga0373927_0601103 Ga0373927_0601103_194_670 152
40 3300035695 Ga0373927_1038287 Ga0373927_1038287_34_510 152
41 3300035724 Ga0373933_0235172 Ga0373933_0235172_416_892 152
42 3300046475 Ga0495639_0170305 Ga0495639_0170305_234_710 152
43 3300046681 Ga0495647_0056718 Ga0495647_0056718_729_1205 152
44 3300046683 Ga0495658_0208367 Ga0495658_0208367_320_796 152
45 3300046689 Ga0495613_0241224 Ga0495613_0241224_268_744 152
46 3300048903 Ga0496100_0014198 Ga0496100_0014198_1081_1557 152
47 3300048904 Ga0496101_0001080 Ga0496101_0001080_14283_14759 152
48 3300048907 Ga0496104_0092457 Ga0496104_0092457_136_612 152
49 3300048908 Ga0496105_0093864 Ga0496105_0093864_1747_2223 152
50 3300048909 Ga0496106_0421046 Ga0496106_0421046_228_704 152
51 3300048910 Ga0496107_0033631 Ga0496107_0033631_2993_3469 152
52 3300048917 Ga0496114_0071712 Ga0496114_0071712_2246_2722 152
53 3300048918 Ga0496115_0070749 Ga0496115_0070749_1174_1650 152
54 3300053085 Ga0495619_0252484 Ga0495619_0252484_275_751 152
55 3300041997 Ga0439431_0129325 Ga0439431_0129325_31_513 153
56 3300048914 Ga0496111_0797074 Ga0496111_0797074_163_648 153
57 3300005535 Ga0070684_101266514 Ga0070684_1012665141 157
58 3300031548 Ga0307408_101618444 Ga0307408_1016184441 157
59 3300031824 Ga0307413_10139647 Ga0307413_101396472 157
60 3300032004 Ga0307414_10627932 Ga0307414_106279321 157
61 3300032005 Ga0307411_10184768 Ga0307411_101847682 157
62 3300049743 Ga0501081_0382691 Ga0501081_0382691_292_771 157
63 3300006871 Ga0075434_100076417 Ga0075434_1000764171 158
64 3300029957 Ga0265324_10035227 Ga0265324_100352272 158
65 3300050512 nmdc:mga0n895_361193_c1 nmdc:mga0n895_361193_c1_892_1371 158
66 3300050514 nmdc:mga08x19_1054035_c1 nmdc:mga08x19_1054035_c1_76_555 158
67 3300005330 Ga0070690_100131005 Ga0070690_1001310052 159
68 3300005334 Ga0068869_100121057 Ga0068869_1001210572 159
69 3300005335 Ga0070666_10409948 Ga0070666_104099482 159
70 3300005336 Ga0070680_100108525 Ga0070680_1001085252 159
71 3300005338 Ga0068868_100158379 Ga0068868_1001583792 159
72 3300005338 Ga0068868_100396103 Ga0068868_1003961032 159
73 3300005340 Ga0070689_100016591 Ga0070689_1000165914 159
74 3300005341 Ga0070691_10062579 Ga0070691_100625792 159
75 3300005343 Ga0070687_100083666 Ga0070687_1000836662 159
76 3300005353 Ga0070669_100303039 Ga0070669_1003030392 159
77 3300005354 Ga0070675_100039714 Ga0070675_1000397144 159
78 3300005356 Ga0070674_100021285 Ga0070674_1000212852 159
79 3300005364 Ga0070673_100129196 Ga0070673_1001291962 159
80 3300005365 Ga0070688_100050234 Ga0070688_1000502344 159
81 3300005367 Ga0070667_100113380 Ga0070667_1001133802 159
82 3300005438 Ga0070701_10010430 Ga0070701_100104302 159
83 3300005441 Ga0070700_100153455 Ga0070700_1001534552 159
84 3300005444 Ga0070694_100220671 Ga0070694_1002206712 159
85 3300005455 Ga0070663_100020077 Ga0070663_1000200774 159
86 3300005456 Ga0070678_100104335 Ga0070678_1001043352 159
87 3300005457 Ga0070662_100041118 Ga0070662_1000411184 159
88 3300005459 Ga0068867_101629670 Ga0068867_1016296701 159
89 3300005466 Ga0070685_10111319 Ga0070685_101113192 159
90 3300005468 Ga0070707_100559641 Ga0070707_1005596412 159
91 3300005471 Ga0070698_100016340 Ga0070698_1000163405 159
92 3300005518 Ga0070699_100537044 Ga0070699_1005370442 159
93 3300005536 Ga0070697_100412570 Ga0070697_1004125701 159
94 3300005543 Ga0070672_100218345 Ga0070672_1002183452 159
95 3300005564 Ga0070664_100087629 Ga0070664_1000876293 159
96 3300005577 Ga0068857_101580898 Ga0068857_1015808982 159
97 3300005615 Ga0070702_100028232 Ga0070702_1000282322 159
98 3300005617 Ga0068859_100019586 Ga0068859_1000195864 159
99 3300005618 Ga0068864_101890080 Ga0068864_1018900801 159
100 3300005719 Ga0068861_100079908 Ga0068861_1000799083 159
101 3300005840 Ga0068870_10018585 Ga0068870_100185853 159
102 3300005841 Ga0068863_100074466 Ga0068863_1000744663 159
103 3300005842 Ga0068858_100049333 Ga0068858_1000493334 159
104 3300005843 Ga0068860_100047816 Ga0068860_1000478163 159
105 3300006038 Ga0075365_10004957 Ga0075365_100049572 159
106 3300006042 Ga0075368_10049518 Ga0075368_100495182 159
107 3300006048 Ga0075363_100052627 Ga0075363_1000526272 159
108 3300006051 Ga0075364_10012948 Ga0075364_100129484 159
109 3300006178 Ga0075367_10003320 Ga0075367_100033202 159
110 3300006178 Ga0075367_10429404 Ga0075367_104294041 159
111 3300006195 Ga0075366_10001113 Ga0075366_100011138 159
112 3300006358 Ga0068871_100129598 Ga0068871_1001295982 159
113 3300006852 Ga0075433_10301564 Ga0075433_103015642 159
114 3300006871 Ga0075434_100248168 Ga0075434_1002481682 159
115 3300006880 Ga0075429_100027543 Ga0075429_1000275437 159
116 3300006881 Ga0068865_100042529 Ga0068865_1000425294 159
117 3300006931 Ga0097620_100019586 Ga0097620_1000195864 159
118 3300007076 Ga0075435_100012316 Ga0075435_1000123162 159
119 3300009094 Ga0111539_10007017 Ga0111539_100070174 159
120 3300009098 Ga0105245_10026085 Ga0105245_100260854 159
121 3300009148 Ga0105243_10027071 Ga0105243_100270714 159
122 3300009176 Ga0105242_10013483 Ga0105242_100134835 159
123 3300009177 Ga0105248_10775584 Ga0105248_107755842 159
124 3300009553 Ga0105249_10119817 Ga0105249_101198172 159
125 3300010375 Ga0105239_10307575 Ga0105239_103075752 159
126 3300013296 Ga0157374_10451136 Ga0157374_104511362 159
127 3300013297 Ga0157378_10701932 Ga0157378_107019322 159
128 3300013306 Ga0163162_10119059 Ga0163162_101190592 159
129 3300013308 Ga0157375_10026665 Ga0157375_100266653 159
130 3300014326 Ga0157380_10054401 Ga0157380_100544011 159
131 3300014745 Ga0157377_10142170 Ga0157377_101421702 159
132 3300014968 Ga0157379_10344847 Ga0157379_103448472 159
133 3300017792 Ga0163161_10107901 Ga0163161_101079012 159
134 3300025899 Ga0207642_10293423 Ga0207642_102934232 159
135 3300025903 Ga0207680_10400826 Ga0207680_104008262 159
136 3300025908 Ga0207643_10022777 Ga0207643_100227772 159
137 3300025918 Ga0207662_10008526 Ga0207662_100085263 159
138 3300025923 Ga0207681_10044269 Ga0207681_100442693 159
139 3300025927 Ga0207687_10032872 Ga0207687_100328724 159
140 3300025933 Ga0207706_10043393 Ga0207706_100433934 159
141 3300025934 Ga0207686_10053866 Ga0207686_100538662 159
142 3300025935 Ga0207709_10099007 Ga0207709_100990071 159
143 3300025936 Ga0207670_10095666 Ga0207670_100956662 159
144 3300025937 Ga0207669_10031646 Ga0207669_100316463 159
145 3300025938 Ga0207704_10010510 Ga0207704_100105105 159
146 3300025940 Ga0207691_10016964 Ga0207691_100169644 159
147 3300025941 Ga0207711_10008767 Ga0207711_100087674 159
148 3300025942 Ga0207689_10241913 Ga0207689_102419132 159
149 3300025960 Ga0207651_10301237 Ga0207651_103012372 159
150 3300025961 Ga0207712_10048107 Ga0207712_100481072 159
151 3300026023 Ga0207677_10084564 Ga0207677_100845642 159
152 3300026035 Ga0207703_10143114 Ga0207703_101431142 159
153 3300026041 Ga0207639_10351902 Ga0207639_103519022 159
154 3300026067 Ga0207678_10017074 Ga0207678_100170744 159
155 3300026075 Ga0207708_10024662 Ga0207708_100246622 159
156 3300026088 Ga0207641_10220293 Ga0207641_102202933 159
157 3300026089 Ga0207648_10037875 Ga0207648_100378752 159
158 3300026095 Ga0207676_10165504 Ga0207676_101655042 159
159 3300026116 Ga0207674_10088058 Ga0207674_100880582 159
160 3300026118 Ga0207675_100013696 Ga0207675_1000136962 159
161 3300026121 Ga0207683_10045377 Ga0207683_100453773 159
162 3300026142 Ga0207698_10514215 Ga0207698_105142152 159
163 3300027866 Ga0209813_10061825 Ga0209813_100618251 159
164 3300027907 Ga0207428_10000076 Ga0207428_1000007656 159
165 3300028380 Ga0268265_10314020 Ga0268265_103140201 159
166 3300028381 Ga0268264_10033119 Ga0268264_100331194 159
167 3300035090 Ga0373949_0138581 Ga0373949_0138581_37_525 159
168 3300046615 Ga0495656_0076136 Ga0495656_0076136_400_888 159
169 3300046684 Ga0495669_0006222 Ga0495669_0006222_2885_3373 159
170 3300050490 nmdc:mga03n38_210270_c1 nmdc:mga03n38_210270_c1_370_858 159
171 3300050491 nmdc:mga00v17_105904_c1 nmdc:mga00v17_105904_c1_899_1387 159
172 3300050493 nmdc:mga0k408_2606_c1 nmdc:mga0k408_2606_c1_2884_3372 159
173 3300050494 nmdc:mga06z11_19128_c1 nmdc:mga06z11_19128_c1_2326_2814 159
174 3300050495 nmdc:mga04h51_30549_c1 nmdc:mga04h51_30549_c1_544_1032 159
175 3300050508 nmdc:mga09592_560771_c1 nmdc:mga09592_560771_c1_23_511 159
176 3300050511 nmdc:mga08y16_3446_c1 nmdc:mga08y16_3446_c1_13012_13500 159
177 3300050512 nmdc:mga0n895_408188_c1 nmdc:mga0n895_408188_c1_284_772 159
178 3300050515 nmdc:mga0a205_181718_c1 nmdc:mga0a205_181718_c1_1061_1549 159
179 3300005340 Ga0070689_100003486 Ga0070689_1000034864 160
180 3300009094 Ga0111539_10381891 Ga0111539_103818912 160
181 3300009094 Ga0111539_10689402 Ga0111539_106894021 160
182 3300009176 Ga0105242_10068827 Ga0105242_100688271 160
183 3300031251 Ga0265327_10001666 Ga0265327_100016669 160
184 3300048909 Ga0496106_0201903 Ga0496106_0201903_101_589 160
185 3300048910 Ga0496107_0048886 Ga0496107_0048886_2454_2942 160
186 3300005530 Ga0070679_100192826 Ga0070679_1001928263 161
187 3300005547 Ga0070693_100950727 Ga0070693_1009507271 161
188 3300007076 Ga0075435_100119681 Ga0075435_1001196813 161
189 3300028800 Ga0265338_10006402 Ga0265338_100064027 161
190 3300031240 Ga0265320_10015731 Ga0265320_100157313 161
191 3300031249 Ga0265339_10194575 Ga0265339_101945752 161
192 3300031344 Ga0265316_10141480 Ga0265316_101414802 161
193 3300031595 Ga0265313_10055480 Ga0265313_100554802 161
194 3300031711 Ga0265314_10186741 Ga0265314_101867412 161
195 3300046511 Ga0495608_0507707 Ga0495608_0507707_166_699 161
196 3300046533 Ga0495640_0152392 Ga0495640_0152392_518_1051 161
197 3300046535 Ga0495586_0237787 Ga0495586_0237787_251_784 161
198 3300046543 Ga0495645_0008051 Ga0495645_0008051_50_583 161
199 3300046689 Ga0495613_0898773 Ga0495613_0898773_54_539 161
200 3300047319 Ga0495674_0106227 Ga0495674_0106227_42_575 161
201 3300047322 Ga0495680_0547542 Ga0495680_0547542_103_636 161
202 3300047471 Ga0495684_0060882 Ga0495684_0060882_999_1532 161
203 3300050512 nmdc:mga0n895_303452_c1 nmdc:mga0n895_303452_c1_286_786 161
204 3300050513 nmdc:mga0rr50_1403301_c1 nmdc:mga0rr50_1403301_c1_57_548 161
205 3300050513 nmdc:mga0rr50_314537_c1 nmdc:mga0rr50_314537_c1_162_662 161
206 3300053077 Ga0495601_0123930 Ga0495601_0123930_180_713 161
207 3300053085 Ga0495619_0291117 Ga0495619_0291117_204_737 161
208 3300005347 Ga0070668_100304876 Ga0070668_1003048762 162
209 3300005441 Ga0070700_100868067 Ga0070700_1008680672 162
210 3300005459 Ga0068867_100572975 Ga0068867_1005729751 162
211 3300005535 Ga0070684_100832032 Ga0070684_1008320321 162
212 3300005564 Ga0070664_100041011 Ga0070664_1000410113 162
213 3300005577 Ga0068857_100587520 Ga0068857_1005875201 162
214 3300005615 Ga0070702_100167858 Ga0070702_1001678581 162
215 3300006028 Ga0070717_10947021 Ga0070717_109470211 162
216 3300006358 Ga0068871_100001350 Ga0068871_10000135019 162
217 3300006844 Ga0075428_100025169 Ga0075428_1000251697 162
218 3300006847 Ga0075431_100976456 Ga0075431_1009764561 162
219 3300013296 Ga0157374_10255463 Ga0157374_102554633 162
220 3300013308 Ga0157375_11009248 Ga0157375_110092481 162
221 3300014969 Ga0157376_10493774 Ga0157376_104937741 162
222 3300014969 Ga0157376_11074688 Ga0157376_110746882 162
223 3300025920 Ga0207649_10192416 Ga0207649_101924162 162
224 3300025944 Ga0207661_10786432 Ga0207661_107864322 162
225 3300026089 Ga0207648_10327735 Ga0207648_103277352 162
226 3300026118 Ga0207675_100026510 Ga0207675_1000265103 162
227 3300027876 Ga0209974_10077337 Ga0209974_100773372 162
228 3300032002 Ga0307416_100365970 Ga0307416_1003659702 162
229 3300032005 Ga0307411_11074746 Ga0307411_110747462 162
230 3300032126 Ga0307415_100342722 Ga0307415_1003427222 162
231 3300035172 Ga0373955_0200823 Ga0373955_0200823_541_1038 162
232 3300036401 Ga0373937_0743045 Ga0373937_0743045_104_601 162
233 3300042004 Ga0439445_0072677 Ga0439445_0072677_82_570 162
234 3300042009 Ga0439451_047965 Ga0439451_047965_281_769 162
235 3300042435 Ga0439434_0064682 Ga0439434_0064682_517_1005 162
236 3300042461 Ga0439460_0190365 Ga0439460_0190365_56_544 162
237 3300046472 Ga0495580_0098467 Ga0495580_0098467_308_808 162
238 3300046684 Ga0495669_0002793 Ga0495669_0002793_4343_4861 162
239 3300048917 Ga0496114_0684614 Ga0496114_0684614_374_877 162
240 3300049592 Ga0501076_0900054 Ga0501076_0900054_115_609 162
241 3300049744 Ga0501083_0121099 Ga0501083_0121099_740_1234 162
242 3300050509 nmdc:mga0qj67_62926_c1 nmdc:mga0qj67_62926_c1_959_1456 162
243 3300059421 Ga0590071_084611 Ga0590071_084611_220_723 162
244 3300059426 Ga0590077_017277 Ga0590077_017277_771_1274 162
245 3300006844 Ga0075428_100002024 Ga0075428_10000202411 163
246 3300006847 Ga0075431_100154643 Ga0075431_1001546433 163
247 3300006871 Ga0075434_101016304 Ga0075434_1010163042 163
248 3300009094 Ga0111539_10620086 Ga0111539_106200862 163
249 3300025940 Ga0207691_10262471 Ga0207691_102624712 163
250 3300026118 Ga0207675_100009916 Ga0207675_1000099162 163
251 3300028380 Ga0268265_11177112 Ga0268265_111771121 163
252 3300042532 Ga0450893_0026165 Ga0450893_0026165_521_1012 163
253 3300044712 Ga0453684_0081202 Ga0453684_0081202_2918_3409 163
254 3300049578 Ga0501042_0200608 Ga0501042_0200608_892_1383 163
255 3300049582 Ga0501048_0037051 Ga0501048_0037051_649_1140 163
256 3300049590 Ga0501074_0128187 Ga0501074_0128187_770_1261 163
257 3300049591 Ga0501075_0008967 Ga0501075_0008967_1876_2367 163
258 3300049592 Ga0501076_0017691 Ga0501076_0017691_4548_5039 163
259 3300049741 Ga0501079_0116188 Ga0501079_0116188_422_913 163
260 3300049822 Ga0501035_0296952 Ga0501035_0296952_266_757 163
261 3300049824 Ga0501045_0222134 Ga0501045_0222134_885_1376 163
262 3300050507 nmdc:mga05p37_340209_c1 nmdc:mga05p37_340209_c1_1176_1676 163
263 3300050510 nmdc:mga06r32_107000_c1 nmdc:mga06r32_107000_c1_1081_1572 163
264 3300050511 nmdc:mga08y16_202265_c1 nmdc:mga08y16_202265_c1_207_707 163
265 3300050512 nmdc:mga0n895_1104294_c1 nmdc:mga0n895_1104294_c1_141_656 163
266 3300054114 Ga0501084_0577633 Ga0501084_0577633_257_748 163
267 3300005544 Ga0070686_100113496 Ga0070686_1001134962 164
268 3300005616 Ga0068852_100180836 Ga0068852_1001808363 164
269 3300006880 Ga0075429_101000560 Ga0075429_1010005602 164
270 3300009094 Ga0111539_11830927 Ga0111539_118309271 164
271 3300009098 Ga0105245_10003151 Ga0105245_1000315113 164
272 3300009176 Ga0105242_10780874 Ga0105242_107808742 164
273 3300009177 Ga0105248_10055244 Ga0105248_100552445 164
274 3300009177 Ga0105248_10728456 Ga0105248_107284562 164
275 3300014969 Ga0157376_10009007 Ga0157376_100090075 164
276 3300050508 nmdc:mga09592_862176_c1 nmdc:mga09592_862176_c1_158_667 164
277 3300005331 Ga0070670_100610950 Ga0070670_1006109502 165
278 3300005339 Ga0070660_100148366 Ga0070660_1001483663 165
279 3300005354 Ga0070675_100083795 Ga0070675_1000837952 165
280 3300005355 Ga0070671_100100623 Ga0070671_1001006231 165
281 3300005356 Ga0070674_100100447 Ga0070674_1001004472 165
282 3300005365 Ga0070688_100226692 Ga0070688_1002266922 165
283 3300005367 Ga0070667_100201604 Ga0070667_1002016042 165
284 3300005456 Ga0070678_100002596 Ga0070678_1000025968 165
285 3300005456 Ga0070678_100180727 Ga0070678_1001807273 165
286 3300005457 Ga0070662_100612007 Ga0070662_1006120072 165
287 3300005458 Ga0070681_10003322 Ga0070681_1000332212 165
288 3300005466 Ga0070685_10458023 Ga0070685_104580231 165
289 3300005535 Ga0070684_100336262 Ga0070684_1003362622 165
290 3300005563 Ga0068855_100007793 Ga0068855_10000779313 165
291 3300005564 Ga0070664_100043797 Ga0070664_1000437973 165
292 3300005564 Ga0070664_100556123 Ga0070664_1005561232 165
293 3300005614 Ga0068856_100589516 Ga0068856_1005895162 165
294 3300006175 Ga0070712_100479264 Ga0070712_1004792642 165
295 3300006237 Ga0097621_100727826 Ga0097621_1007278262 165
296 3300006358 Ga0068871_100836878 Ga0068871_1008368781 165
297 3300009093 Ga0105240_10200773 Ga0105240_102007733 165
298 3300009177 Ga0105248_10256285 Ga0105248_102562852 165
299 3300009551 Ga0105238_10118676 Ga0105238_101186762 165
300 3300025315 Ga0207697_10044156 Ga0207697_100441562 165
301 3300025906 Ga0207699_10041773 Ga0207699_100417731 165
302 3300025912 Ga0207707_10035789 Ga0207707_100357892 165
303 3300025919 Ga0207657_10030344 Ga0207657_100303443 165
304 3300025919 Ga0207657_10097530 Ga0207657_100975303 165
305 3300025924 Ga0207694_10135389 Ga0207694_101353891 165
306 3300025924 Ga0207694_10254126 Ga0207694_102541262 165
307 3300025931 Ga0207644_10171339 Ga0207644_101713391 165
308 3300025937 Ga0207669_10232312 Ga0207669_102323122 165
309 3300025940 Ga0207691_10167197 Ga0207691_101671972 165
310 3300025940 Ga0207691_10445825 Ga0207691_104458252 165
311 3300025941 Ga0207711_11335825 Ga0207711_113358251 165
312 3300025949 Ga0207667_10183648 Ga0207667_101836483 165
313 3300025960 Ga0207651_10333433 Ga0207651_103334332 165
314 3300025986 Ga0207658_10197236 Ga0207658_101972361 165
315 3300026121 Ga0207683_10037377 Ga0207683_100373773 165
316 3300026121 Ga0207683_10329789 Ga0207683_103297892 165
317 3300027682 Ga0209971_1042058 Ga0209971_10420582 165
318 3300027717 Ga0209998_10013104 Ga0209998_100131043 165
319 3300035089 Ga0373944_0071738 Ga0373944_0071738_139_636 165
320 3300042436 Ga0439435_0086644 Ga0439435_0086644_34_537 165
321 3300046459 Ga0495629_0249030 Ga0495629_0249030_610_1134 165
322 3300046683 Ga0495658_0121937 Ga0495658_0121937_657_1181 165
323 3300046683 Ga0495658_0433168 Ga0495658_0433168_17_514 165
324 3300048907 Ga0496104_0562967 Ga0496104_0562967_92_646 165
325 3300048909 Ga0496106_0813187 Ga0496106_0813187_164_718 165
326 3300048912 Ga0496109_0615254 Ga0496109_0615254_82_636 165
327 3300048913 Ga0496110_0129514 Ga0496110_0129514_1143_1664 165
328 3300048915 Ga0496112_0037537 Ga0496112_0037537_3743_4297 165
329 3300005290 Ga0065712_10150548 Ga0065712_101505482 166
330 3300005457 Ga0070662_100115681 Ga0070662_1001156812 166
331 3300005615 Ga0070702_100254041 Ga0070702_1002540411 166
332 3300035083 Ga0373926_0013351 Ga0373926_0013351_391_960 166
333 3300035170 Ga0373943_0049335 Ga0373943_0049335_120_689 166
334 3300035695 Ga0373927_0090454 Ga0373927_0090454_1123_1692 166
335 3300035725 Ga0373947_0161935 Ga0373947_0161935_809_1378 166
336 3300035725 Ga0373947_0286605 Ga0373947_0286605_45_638 166
337 3300053077 Ga0495601_0269520 Ga0495601_0269520_180_749 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

55

150

0.93

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

51

152

0.88

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

47

148

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.873 23 162
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8612 23 162
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8543 26 162
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8455 34 158
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8439 32 162
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8874 34 127 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8823 36 131 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8532 34 157 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8456 23 127 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8384 23 134 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A496WVS7-F1-model_v4 DUF3427 domain-containing protein 0.8877 24 132 GO:0003677
GO:0005524
GO:0005829
GO:0016787
AF-A0A7W0LFT2-F1-model_v4 HIT domain-containing protein 0.8822 42 166 GO:0000166
GO:0003824
AF-A0A432I2B3-F1-model_v4 deleted 0.8791 22 132
AF-A0A3N5SMP7-F1-model_v4 deleted 0.8743 40 165
AF-A0A2A2Y5N9-F1-model_v4 HIT domain-containing protein 0.874 37 161 GO:0000166
GO:0003824

Feature Viewer

pLDDT pTM Quality
79.61 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map