F413140

General Info

Members Datasets Scaffolds Average Seq Length
337 213 674 83

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100709008|Ga0307408_1007090082
Length 92
Sequence MTEPNYPGNMHPMFLPEVEHAEPRGMYAEPIARLRSVGAPVGQIMHLFAFKPDRTDHLSRFTQGVMRGPSPLAPGMRELIAAFTSRRNDCPF

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.75
Rhizosphere 91.99
Stem 0
Stem Tuber 0
Unclassified 16.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100709008 3300031548 Bacteria 905
2 MBSR1b_contig_5758164 2162886012 Unclassified 1259
3 MBSR1b_contig_6134928 2162886012 Bacteria 1892
4 rootH1_10009183 3300003316 Bacteria 1347
5 Ga0065712_10004045 3300005290 Bacteria 5734
6 Ga0065712_10442825 3300005290 Bacteria 688
7 Ga0070658_10004808 3300005327 Bacteria 10996
8 Ga0070658_10013889 3300005327 Bacteria 6464
9 Ga0070658_11879441 3300005327 Bacteria 517
10 Ga0070683_100000013 3300005329 Bacteria 241235
11 Ga0070683_100014153 3300005329 Bacteria 6969
12 Ga0070670_101402412 3300005331 Bacteria 641
13 Ga0070670_101527069 3300005331 Bacteria 613
14 Ga0070682_100050953 3300005337 Bacteria 2586
15 Ga0068868_101830183 3300005338 Bacteria 574
16 Ga0070660_100830932 3300005339 Bacteria 778
17 Ga0070689_100327100 3300005340 Unclassified 1281
18 Ga0070661_100016202 3300005344 Bacteria 5265
19 Ga0070692_10143826 3300005345 Unclassified 1352
20 Ga0070675_101187371 3300005354 Bacteria 702
21 Ga0070671_101172326 3300005355 Bacteria 676
22 Ga0070674_100356920 3300005356 Bacteria 1182
23 Ga0070673_100192478 3300005364 Bacteria 1752
24 Ga0070659_100025166 3300005366 Bacteria 4569
25 Ga0070659_100075597 3300005366 Bacteria 2685
26 Ga0070703_10540374 3300005406 Bacteria 530
27 Ga0070709_10000873 3300005434 Bacteria 16870
28 Ga0070709_10301086 3300005434 Unclassified 1171
29 Ga0070714_100078749 3300005435 Bacteria 2865
30 Ga0070714_100380813 3300005435 Bacteria 1330
31 Ga0070713_100028794 3300005436 Unclassified 4390
32 Ga0070713_100394683 3300005436 Bacteria 1291
33 Ga0070710_10063828 3300005437 Bacteria 2105
34 Ga0070711_100070517 3300005439 Bacteria 2461
35 Ga0070694_100011621 3300005444 Bacteria 5451
36 Ga0070662_101018422 3300005457 Bacteria 709
37 Ga0070681_10129208 3300005458 Bacteria 2459
38 Ga0070707_100281570 3300005468 Bacteria 1616
39 Ga0070699_100708836 3300005518 Bacteria 920
40 Ga0070679_100309490 3300005530 Bacteria 1530
41 Ga0070684_100000015 3300005535 Bacteria 143515
42 Ga0070684_100025714 3300005535 Bacteria 4951
43 Ga0068853_100042511 3300005539 Bacteria 3886
44 Ga0070686_100152530 3300005544 Unclassified 1619
45 Ga0070686_100159552 3300005544 Bacteria 1587
46 Ga0070686_101751992 3300005544 Unclassified 528
47 Ga0070695_100415378 3300005545 Bacteria 1023
48 Ga0070695_100486393 3300005545 Unclassified 952
49 Ga0070696_101752056 3300005546 Bacteria 536
50 Ga0070693_100402131 3300005547 Unclassified 950
51 Ga0070665_100042795 3300005548 Unclassified 4553
52 Ga0070665_100591125 3300005548 Unclassified 1123
53 Ga0070704_100462366 3300005549 Unclassified 1095
54 Ga0070704_100804366 3300005549 Bacteria 840
55 Ga0068855_100035842 3300005563 Bacteria 5908
56 Ga0068855_100229774 3300005563 Bacteria 2078
57 Ga0068855_100978607 3300005563 Bacteria 890
58 Ga0068855_101527777 3300005563 Bacteria 685
59 Ga0070664_100010746 3300005564 Bacteria 7422
60 Ga0068857_100017524 3300005577 Bacteria 6279
61 Ga0068854_100090719 3300005578 Bacteria 2273
62 Ga0068856_100175663 3300005614 Bacteria 2154
63 Ga0068852_100015094 3300005616 Bacteria 5976
64 Ga0068852_100273263 3300005616 Bacteria 1627
65 Ga0068852_100279736 3300005616 Bacteria 1608
66 Ga0068864_100115275 3300005618 Bacteria 2397
67 Ga0068864_100403470 3300005618 Bacteria 1299
68 Ga0068851_10051944 3300005834 Bacteria 2084
69 Ga0068863_100609999 3300005841 Bacteria 1080
70 Ga0068863_101066047 3300005841 Bacteria 812
71 Ga0068858_100591810 3300005842 Bacteria 1076
72 Ga0075432_10272433 3300006058 Bacteria 694
73 Ga0075432_10272938 3300006058 Unclassified 693
74 Ga0070715_10967721 3300006163 Bacteria 528
75 Ga0070716_100004978 3300006173 Bacteria 6400
76 Ga0070712_100089747 3300006175 Bacteria 2249
77 Ga0097621_100012567 3300006237 Bacteria 6281
78 Ga0097621_100673589 3300006237 Unclassified 951
79 Ga0075428_100902393 3300006844 Bacteria 937
80 Ga0075428_101174445 3300006844 Bacteria 809
81 Ga0075431_101073689 3300006847 Bacteria 770
82 Ga0075433_10000753 3300006852 Bacteria 22237
83 Ga0075433_10055968 3300006852 Bacteria 3445
84 Ga0075433_10425489 3300006852 Bacteria 1171
85 Ga0075433_11921972 3300006852 Bacteria 507
86 Ga0075434_100001078 3300006871 Bacteria 22324
87 Ga0075434_100006256 3300006871 Bacteria 10904
88 Ga0075434_100014137 3300006871 Bacteria 7623
89 Ga0075434_100021126 3300006871 Bacteria 6327
90 Ga0075434_100371116 3300006871 Unclassified 1452
91 Ga0075434_101710253 3300006871 Archaea 637
92 Ga0075429_101011074 3300006880 Bacteria 727
93 Ga0075429_101298176 3300006880 Unclassified 635
94 Ga0068865_100025124 3300006881 Bacteria 3915
95 Ga0075436_100001235 3300006914 Bacteria 17363
96 Ga0075436_100030409 3300006914 Bacteria 3717
97 Ga0075436_100107752 3300006914 Bacteria 1944
98 Ga0075436_100133229 3300006914 Bacteria 1744
99 Ga0075435_100000255 3300007076 Bacteria 33098
100 Ga0075435_100031571 3300007076 Bacteria 4174
101 Ga0075435_100056323 3300007076 Bacteria 3177
102 Ga0075435_101080318 3300007076 Bacteria 701
103 Ga0099795_10052677 3300007788 Bacteria 1487
104 Ga0105251_10014248 3300009011 Bacteria 4409
105 Ga0105240_10077784 3300009093 Bacteria 4087
106 Ga0111539_10034846 3300009094 Bacteria 6098
107 Ga0111539_10132551 3300009094 Unclassified 2918
108 Ga0105245_10066629 3300009098 Bacteria 3260
109 Ga0105245_10536509 3300009098 Unclassified 1190
110 Ga0105247_10506248 3300009101 Bacteria 881
111 Ga0114129_10007964 3300009147 Bacteria 15084
112 Ga0114129_10043263 3300009147 Bacteria 6336
113 Ga0114129_10089658 3300009147 Bacteria 4263
114 Ga0114129_10764022 3300009147 Bacteria 1236
115 Ga0114129_12247286 3300009147 Bacteria 656
116 Ga0105241_11831288 3300009174 Bacteria 593
117 Ga0105242_10016059 3300009176 Bacteria 5816
118 Ga0105242_10322969 3300009176 Unclassified 1416
119 Ga0105248_10081072 3300009177 Unclassified 3648
120 Ga0105248_10130933 3300009177 Bacteria 2830
121 Ga0105238_10427395 3300009551 Bacteria 1320
122 Ga0105249_11891830 3300009553 Bacteria 669
123 Ga0099796_10487325 3300010159 Bacteria 551
124 Ga0105239_10763060 3300010375 Bacteria 1107
125 Ga0157373_10110497 3300013100 Bacteria 1933
126 Ga0157371_10555352 3300013102 Bacteria 851
127 Ga0157369_10379197 3300013105 Bacteria 1468
128 Ga0157374_10963438 3300013296 Bacteria 872
129 Ga0157374_11145395 3300013296 Bacteria 799
130 Ga0157378_10176587 3300013297 Bacteria 2007
131 Ga0163162_13056833 3300013306 Bacteria 537
132 Ga0157372_10013734 3300013307 Bacteria 8654
133 Ga0157372_10722439 3300013307 Bacteria 1159
134 Ga0157375_10560171 3300013308 Bacteria 1304
135 Ga0157375_11057851 3300013308 Bacteria 949
136 Ga0157375_12679023 3300013308 Bacteria 596
137 Ga0163163_10507025 3300014325 Bacteria 1268
138 Ga0157380_11333870 3300014326 Bacteria 766
139 Ga0157379_10434155 3300014968 Bacteria 1211
140 Ga0157379_11606688 3300014968 Bacteria 635
141 Ga0206353_11314072 3300020082 Bacteria 976
142 Ga0213876_10022910 3300021384 Bacteria 3300
143 Ga0213875_10041011 3300021388 Unclassified 2178
144 Ga0213875_10057290 3300021388 Bacteria 1825
145 Ga0207656_10042900 3300025321 Bacteria 1927
146 Ga0207692_10047720 3300025898 Bacteria 2152
147 Ga0207642_10228741 3300025899 Bacteria 1043
148 Ga0207710_10010650 3300025900 Plasmid 3872
149 Ga0207699_10931867 3300025906 Bacteria 641
150 Ga0207705_10062105 3300025909 Bacteria 2698
151 Ga0207705_10402766 3300025909 Bacteria 1058
152 Ga0207695_10143718 3300025913 Unclassified 2332
153 Ga0207693_10134175 3300025915 Bacteria 1946
154 Ga0207663_10098397 3300025916 Bacteria 1958
155 Ga0207660_10103308 3300025917 Unclassified 2132
156 Ga0207657_10221203 3300025919 Bacteria 1517
157 Ga0207649_10015342 3300025920 Bacteria 4306
158 Ga0207652_10521110 3300025921 Bacteria 1069
159 Ga0207652_10592047 3300025921 Unclassified 995
160 Ga0207652_11128990 3300025921 Unclassified 685
161 Ga0207646_10520263 3300025922 Bacteria 1071
162 Ga0207694_10738239 3300025924 Bacteria 831
163 Ga0207687_10112413 3300025927 Bacteria 2024
164 Ga0207700_10535757 3300025928 Bacteria 1038
165 Ga0207664_11172517 3300025929 Bacteria 686
166 Ga0207690_10202287 3300025932 Bacteria 1509
167 Ga0207690_10891917 3300025932 Bacteria 737
168 Ga0207706_10216398 3300025933 Bacteria 1678
169 Ga0207686_10094039 3300025934 Bacteria 1986
170 Ga0207686_10574959 3300025934 Bacteria 884
171 Ga0207709_10547145 3300025935 Unclassified 910
172 Ga0207669_10401089 3300025937 Bacteria 1074
173 Ga0207665_10017785 3300025939 Bacteria 4672
174 Ga0207711_10015487 3300025941 Bacteria 6329
175 Ga0207711_10060116 3300025941 Bacteria 3274
176 Ga0207689_10821381 3300025942 Unclassified 785
177 Ga0207661_10000018 3300025944 Bacteria 242506
178 Ga0207661_10417371 3300025944 Bacteria 1218
179 Ga0207679_10199728 3300025945 Bacteria 1669
180 Ga0207667_10008236 3300025949 Bacteria 12406
181 Ga0207667_10872148 3300025949 Bacteria 893
182 Ga0207667_11233343 3300025949 Bacteria 726
183 Ga0207651_10434643 3300025960 Bacteria 1123
184 Ga0207712_10913085 3300025961 Bacteria 776
185 Ga0207640_10325244 3300025981 Bacteria 1226
186 Ga0207640_10583836 3300025981 Unclassified 944
187 Ga0207640_10649233 3300025981 Unclassified 899
188 Ga0207658_10886854 3300025986 Bacteria 812
189 Ga0207677_11506054 3300026023 Bacteria 621
190 Ga0207703_10650787 3300026035 Bacteria 1000
191 Ga0207639_10325324 3300026041 Bacteria 1366
192 Ga0207702_10125481 3300026078 Bacteria 2304
193 Ga0207702_10127341 3300026078 Bacteria 2288
194 Ga0207702_11965896 3300026078 Bacteria 575
195 Ga0207641_10620373 3300026088 Bacteria 1060
196 Ga0207676_10430567 3300026095 Bacteria 1239
197 Ga0207676_11309079 3300026095 Bacteria 719
198 Ga0207674_10001896 3300026116 Bacteria 26620
199 Ga0207683_10876410 3300026121 Bacteria 833
200 Ga0207698_10012819 3300026142 Bacteria 5505
201 Ga0207428_10141540 3300027907 Unclassified 1835
202 Ga0207428_10858563 3300027907 Bacteria 643
203 Ga0268266_10153583 3300028379 Bacteria 2077
204 Ga0268264_12645657 3300028381 Bacteria 506
205 Ga0307408_101729303 3300031548 Bacteria 596
206 Ga0307405_10033737 3300031731 Bacteria 3039
207 Ga0307413_10073662 3300031824 Bacteria 2160
208 Ga0307410_10077202 3300031852 Bacteria 2328
209 Ga0307410_10568390 3300031852 Bacteria 942
210 Ga0307410_10788233 3300031852 Bacteria 807
211 Ga0307406_10088479 3300031901 Bacteria 2078
212 Ga0307406_10474485 3300031901 Bacteria 1009
213 Ga0307407_10006461 3300031903 Bacteria 5212
214 Ga0307407_11451858 3300031903 Bacteria 541
215 Ga0307412_10050837 3300031911 Bacteria 2737
216 Ga0307409_100096660 3300031995 Bacteria 2437
217 Ga0307409_100115291 3300031995 Bacteria 2262
218 Ga0307409_100801891 3300031995 Bacteria 949
219 Ga0307414_10326105 3300032004 Bacteria 1309
220 Ga0307414_10630871 3300032004 Bacteria 964
221 Ga0307414_11753621 3300032004 Bacteria 579
222 Ga0307411_10000637 3300032005 Bacteria 12718
223 Ga0307411_10519957 3300032005 Bacteria 1010
224 Ga0307415_100012765 3300032126 Bacteria 4871
225 Ga0373958_0027504 3300034819 Bacteria 1096
226 Ga0373959_0143449 3300034820 Bacteria 599
227 Ga0373928_0181928 3300035084 Bacteria 598
228 Ga0373949_0097197 3300035090 Bacteria 803
229 Ga0373951_0251660 3300035091 Bacteria 531
230 Ga0373932_0433617 3300035112 Unclassified 513
231 Ga0373960_0013149 3300035121 Bacteria 2071
232 Ga0373943_0492177 3300035170 Bacteria 716
233 Ga0373942_0017060 3300035207 Bacteria 1787
234 Ga0373961_0015890 3300035241 Bacteria 1932
235 Ga0373961_0028642 3300035241 Bacteria 1537
236 Ga0373961_0333079 3300035241 Bacteria 569
237 Ga0373931_0318804 3300035691 Bacteria 965
238 Ga0373935_0381201 3300035692 Bacteria 1010
239 Ga0373935_0476278 3300035692 Bacteria 904
240 Ga0373933_0958689 3300035724 Unclassified 563
241 Ga0373947_0178862 3300035725 Bacteria 1380
242 Ga0373947_0237374 3300035725 Unclassified 1202
243 Ga0373925_0419133 3300037068 Bacteria 1094
244 Ga0395900_0454432 3300037418 Bacteria 1237
245 Ga0395905_0952488 3300037471 Bacteria 761
246 Ga0436364_0402751 3300037853 Unclassified 2302
247 Ga0436364_0430876 3300037853 Bacteria 854
248 Ga0436365_0520457 3300039437 Unclassified 608
249 Ga0436365_1004487 3300039437 Bacteria 13825
250 Ga0436365_1556280 3300039437 Bacteria 1090
251 Ga0436362_0190586 3300039453 Unclassified 739
252 Ga0439453_0071095 3300041408 Bacteria 736
253 Ga0451802_0137506 3300041460 Unclassified 577
254 Ga0451853_0430864 3300041512 Bacteria 997
255 Ga0451853_2691129 3300041512 Unclassified 751
256 Ga0439435_0006071 3300042436 Bacteria 2696
257 Ga0451577_0002145 3300042876 Bacteria 24152
258 Ga0453683_0114734 3300044673 Unclassified 1694
259 Ga0453683_0583019 3300044673 Unclassified 729
260 Ga0466961_0450772 3300044693 Bacteria 779
261 Ga0453684_0000887 3300044712 Bacteria 100019
262 Ga0466970_0651461 3300044765 Bacteria 613
263 Ga0451576_0003611 3300045051 Bacteria 21037
264 Ga0495629_0564149 3300046459 Bacteria 763
265 Ga0495582_0208458 3300046473 Bacteria 1117
266 Ga0495630_1203250 3300046517 Unclassified 573
267 Ga0495598_0254067 3300046537 Bacteria 652
268 Ga0495622_0432803 3300046557 Bacteria 565
269 Ga0495658_0062687 3300046683 Bacteria 2138
270 Ga0495658_0579955 3300046683 Bacteria 718
271 Ga0496101_1299933 3300048904 Bacteria 569
272 Ga0496107_1341664 3300048910 Unclassified 511
273 Ga0496108_0058571 3300048911 Unclassified 3238
274 Ga0496108_1440807 3300048911 Bacteria 575
275 Ga0496108_1544167 3300048911 Unclassified 551
276 Ga0496108_1625027 3300048911 Bacteria 534
277 Ga0496109_0509316 3300048912 Archaea 1136
278 Ga0496109_0561442 3300048912 Bacteria 1076
279 Ga0496110_1434911 3300048913 Bacteria 600
280 Ga0496111_0091223 3300048914 Bacteria 2233
281 Ga0496112_0003866 3300048915 Bacteria 12515
282 Ga0496112_0006617 3300048915 Bacteria 10203
283 Ga0496112_0142400 3300048915 Bacteria 2367
284 Ga0496113_0025503 3300048916 Bacteria 4214
285 Ga0496113_0390323 3300048916 Bacteria 1117
286 Ga0501034_0004717 3300049571 Bacteria 15089
287 Ga0501034_0286309 3300049571 Unclassified 1587
288 Ga0501036_1126072 3300049572 Bacteria 641
289 Ga0501042_0967597 3300049578 Unclassified 620
290 Ga0501043_1163772 3300049579 Bacteria 543
291 Ga0501047_0194338 3300049581 Bacteria 1892
292 Ga0501068_0510763 3300049584 Unclassified 780
293 Ga0501073_0363038 3300049589 Bacteria 1000
294 Ga0501075_0219344 3300049591 Bacteria 1451
295 Ga0501075_0350378 3300049591 Bacteria 1125
296 Ga0501075_0889300 3300049591 Unclassified 677
297 Ga0501077_0053428 3300049593 Bacteria 2565
298 Ga0501077_0206934 3300049593 Bacteria 1247
299 Ga0501249_149457 3300049679 Bacteria 587
300 Ga0501080_0164081 3300049742 Bacteria 2051
301 Ga0501080_1185368 3300049742 Bacteria 657
302 Ga0501081_1192720 3300049743 Unclassified 577
303 nmdc:mga05p37_11332_c1 3300050507 Bacteria 10606
304 nmdc:mga05p37_3860_c1 3300050507 Bacteria 17532
305 nmdc:mga05p37_545471_c1 3300050507 Unclassified 1321
306 nmdc:mga05p37_858953_c1 3300050507 Unclassified 984
307 nmdc:mga09592_1106439_c1 3300050508 Unclassified 658
308 nmdc:mga09592_689738_c1 3300050508 Bacteria 870
309 nmdc:mga06r32_1323584_c1 3300050510 Bacteria 664
310 nmdc:mga08y16_110992_c1 3300050511 Unclassified 2855
311 nmdc:mga08y16_54743_c1 3300050511 Unclassified 4169
312 nmdc:mga0n895_122986_c1 3300050512 Bacteria 2617
313 nmdc:mga0n895_1418874_c1 3300050512 Bacteria 662
314 nmdc:mga0n895_37096_c1 3300050512 Bacteria 4713
315 nmdc:mga0n895_69_c1 3300050512 Bacteria 59717
316 nmdc:mga0n895_73087_c1 3300050512 Bacteria 3404
317 nmdc:mga0n895_809461_c1 3300050512 Archaea 927
318 nmdc:mga0rr50_37698_c1 3300050513 Bacteria 3492
319 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
320 nmdc:mga0rr50_73352_c1 3300050513 Bacteria 2617
321 nmdc:mga0rr50_843999_c1 3300050513 Bacteria 781
322 nmdc:mga08x19_1007_c1 3300050514 Bacteria 17598
323 nmdc:mga08x19_125325_c1 3300050514 Bacteria 1724
324 nmdc:mga08x19_146992_c1 3300050514 Unclassified 1595
325 nmdc:mga08x19_95591_c1 3300050514 Bacteria 1966
326 nmdc:mga0a205_13664_c1 3300050515 Bacteria 7565
327 nmdc:mga0a205_255720_c1 3300050515 Bacteria 1630
328 nmdc:mga0a205_436090_c1 3300050515 Bacteria 1171
329 Ga0501084_0271917 3300054114 Bacteria 1431
330 Ga0501084_1707197 3300054114 Unclassified 526
331 Ga0590071_030549 3300059421 Bacteria 1283
332 Ga0590071_038962 3300059421 Bacteria 1142
333 Ga0590077_078923 3300059426 Bacteria 757
334 Ga0501082_1038227 3300060353 Bacteria 717
335 Ga0501082_1479019 3300060353 Bacteria 593
336 Ga0530510_0834120 3300061734 Bacteria 704
337 Ga0530510_0886730 3300061734 Bacteria 682
338 Ga0307408_100709008
339 MBSR1b_contig_5758164
340 MBSR1b_contig_6134928
341 rootH1_10009183
342 Ga0065712_10004045
343 Ga0065712_10442825
344 Ga0070658_10004808
345 Ga0070658_10013889
346 Ga0070658_11879441
347 Ga0070683_100000013
348 Ga0070683_100014153
349 Ga0070670_101402412
350 Ga0070670_101527069
351 Ga0070682_100050953
352 Ga0068868_101830183
353 Ga0070660_100830932
354 Ga0070689_100327100
355 Ga0070661_100016202
356 Ga0070692_10143826
357 Ga0070675_101187371
358 Ga0070671_101172326
359 Ga0070674_100356920
360 Ga0070673_100192478
361 Ga0070659_100025166
362 Ga0070659_100075597
363 Ga0070703_10540374
364 Ga0070709_10000873
365 Ga0070709_10301086
366 Ga0070714_100078749
367 Ga0070714_100380813
368 Ga0070713_100028794
369 Ga0070713_100394683
370 Ga0070710_10063828
371 Ga0070711_100070517
372 Ga0070694_100011621
373 Ga0070662_101018422
374 Ga0070681_10129208
375 Ga0070707_100281570
376 Ga0070699_100708836
377 Ga0070679_100309490
378 Ga0070684_100000015
379 Ga0070684_100025714
380 Ga0068853_100042511
381 Ga0070686_100152530
382 Ga0070686_100159552
383 Ga0070686_101751992
384 Ga0070695_100415378
385 Ga0070695_100486393
386 Ga0070696_101752056
387 Ga0070693_100402131
388 Ga0070665_100042795
389 Ga0070665_100591125
390 Ga0070704_100462366
391 Ga0070704_100804366
392 Ga0068855_100035842
393 Ga0068855_100229774
394 Ga0068855_100978607
395 Ga0068855_101527777
396 Ga0070664_100010746
397 Ga0068857_100017524
398 Ga0068854_100090719
399 Ga0068856_100175663
400 Ga0068852_100015094
401 Ga0068852_100273263
402 Ga0068852_100279736
403 Ga0068864_100115275
404 Ga0068864_100403470
405 Ga0068851_10051944
406 Ga0068863_100609999
407 Ga0068863_101066047
408 Ga0068858_100591810
409 Ga0075432_10272433
410 Ga0075432_10272938
411 Ga0070715_10967721
412 Ga0070716_100004978
413 Ga0070712_100089747
414 Ga0097621_100012567
415 Ga0097621_100673589
416 Ga0075428_100902393
417 Ga0075428_101174445
418 Ga0075431_101073689
419 Ga0075433_10000753
420 Ga0075433_10055968
421 Ga0075433_10425489
422 Ga0075433_11921972
423 Ga0075434_100001078
424 Ga0075434_100006256
425 Ga0075434_100014137
426 Ga0075434_100021126
427 Ga0075434_100371116
428 Ga0075434_101710253
429 Ga0075429_101011074
430 Ga0075429_101298176
431 Ga0068865_100025124
432 Ga0075436_100001235
433 Ga0075436_100030409
434 Ga0075436_100107752
435 Ga0075436_100133229
436 Ga0075435_100000255
437 Ga0075435_100031571
438 Ga0075435_100056323
439 Ga0075435_101080318
440 Ga0099795_10052677
441 Ga0105251_10014248
442 Ga0105240_10077784
443 Ga0111539_10034846
444 Ga0111539_10132551
445 Ga0105245_10066629
446 Ga0105245_10536509
447 Ga0105247_10506248
448 Ga0114129_10007964
449 Ga0114129_10043263
450 Ga0114129_10089658
451 Ga0114129_10764022
452 Ga0114129_12247286
453 Ga0105241_11831288
454 Ga0105242_10016059
455 Ga0105242_10322969
456 Ga0105248_10081072
457 Ga0105248_10130933
458 Ga0105238_10427395
459 Ga0105249_11891830
460 Ga0099796_10487325
461 Ga0105239_10763060
462 Ga0157373_10110497
463 Ga0157371_10555352
464 Ga0157369_10379197
465 Ga0157374_10963438
466 Ga0157374_11145395
467 Ga0157378_10176587
468 Ga0163162_13056833
469 Ga0157372_10013734
470 Ga0157372_10722439
471 Ga0157375_10560171
472 Ga0157375_11057851
473 Ga0157375_12679023
474 Ga0163163_10507025
475 Ga0157380_11333870
476 Ga0157379_10434155
477 Ga0157379_11606688
478 Ga0206353_11314072
479 Ga0213876_10022910
480 Ga0213875_10041011
481 Ga0213875_10057290
482 Ga0207656_10042900
483 Ga0207692_10047720
484 Ga0207642_10228741
485 Ga0207710_10010650
486 Ga0207699_10931867
487 Ga0207705_10062105
488 Ga0207705_10402766
489 Ga0207695_10143718
490 Ga0207693_10134175
491 Ga0207663_10098397
492 Ga0207660_10103308
493 Ga0207657_10221203
494 Ga0207649_10015342
495 Ga0207652_10521110
496 Ga0207652_10592047
497 Ga0207652_11128990
498 Ga0207646_10520263
499 Ga0207694_10738239
500 Ga0207687_10112413
501 Ga0207700_10535757
502 Ga0207664_11172517
503 Ga0207690_10202287
504 Ga0207690_10891917
505 Ga0207706_10216398
506 Ga0207686_10094039
507 Ga0207686_10574959
508 Ga0207709_10547145
509 Ga0207669_10401089
510 Ga0207665_10017785
511 Ga0207711_10015487
512 Ga0207711_10060116
513 Ga0207689_10821381
514 Ga0207661_10000018
515 Ga0207661_10417371
516 Ga0207679_10199728
517 Ga0207667_10008236
518 Ga0207667_10872148
519 Ga0207667_11233343
520 Ga0207651_10434643
521 Ga0207712_10913085
522 Ga0207640_10325244
523 Ga0207640_10583836
524 Ga0207640_10649233
525 Ga0207658_10886854
526 Ga0207677_11506054
527 Ga0207703_10650787
528 Ga0207639_10325324
529 Ga0207702_10125481
530 Ga0207702_10127341
531 Ga0207702_11965896
532 Ga0207641_10620373
533 Ga0207676_10430567
534 Ga0207676_11309079
535 Ga0207674_10001896
536 Ga0207683_10876410
537 Ga0207698_10012819
538 Ga0207428_10141540
539 Ga0207428_10858563
540 Ga0268266_10153583
541 Ga0268264_12645657
542 Ga0307408_101729303
543 Ga0307405_10033737
544 Ga0307413_10073662
545 Ga0307410_10077202
546 Ga0307410_10568390
547 Ga0307410_10788233
548 Ga0307406_10088479
549 Ga0307406_10474485
550 Ga0307407_10006461
551 Ga0307407_11451858
552 Ga0307412_10050837
553 Ga0307409_100096660
554 Ga0307409_100115291
555 Ga0307409_100801891
556 Ga0307414_10326105
557 Ga0307414_10630871
558 Ga0307414_11753621
559 Ga0307411_10000637
560 Ga0307411_10519957
561 Ga0307415_100012765
562 Ga0373958_0027504
563 Ga0373959_0143449
564 Ga0373928_0181928
565 Ga0373949_0097197
566 Ga0373951_0251660
567 Ga0373932_0433617
568 Ga0373960_0013149
569 Ga0373943_0492177
570 Ga0373942_0017060
571 Ga0373961_0015890
572 Ga0373961_0028642
573 Ga0373961_0333079
574 Ga0373931_0318804
575 Ga0373935_0381201
576 Ga0373935_0476278
577 Ga0373933_0958689
578 Ga0373947_0178862
579 Ga0373947_0237374
580 Ga0373925_0419133
581 Ga0395900_0454432
582 Ga0395905_0952488
583 Ga0436364_0402751
584 Ga0436364_0430876
585 Ga0436365_0520457
586 Ga0436365_1004487
587 Ga0436365_1556280
588 Ga0436362_0190586
589 Ga0439453_0071095
590 Ga0451802_0137506
591 Ga0451853_0430864
592 Ga0451853_2691129
593 Ga0439435_0006071
594 Ga0451577_0002145
595 Ga0453683_0114734
596 Ga0453683_0583019
597 Ga0466961_0450772
598 Ga0453684_0000887
599 Ga0466970_0651461
600 Ga0451576_0003611
601 Ga0495629_0564149
602 Ga0495582_0208458
603 Ga0495630_1203250
604 Ga0495598_0254067
605 Ga0495622_0432803
606 Ga0495658_0062687
607 Ga0495658_0579955
608 Ga0496101_1299933
609 Ga0496107_1341664
610 Ga0496108_0058571
611 Ga0496108_1440807
612 Ga0496108_1544167
613 Ga0496108_1625027
614 Ga0496109_0509316
615 Ga0496109_0561442
616 Ga0496110_1434911
617 Ga0496111_0091223
618 Ga0496112_0003866
619 Ga0496112_0006617
620 Ga0496112_0142400
621 Ga0496113_0025503
622 Ga0496113_0390323
623 Ga0501034_0004717
624 Ga0501034_0286309
625 Ga0501036_1126072
626 Ga0501042_0967597
627 Ga0501043_1163772
628 Ga0501047_0194338
629 Ga0501068_0510763
630 Ga0501073_0363038
631 Ga0501075_0219344
632 Ga0501075_0350378
633 Ga0501075_0889300
634 Ga0501077_0053428
635 Ga0501077_0206934
636 Ga0501249_149457
637 Ga0501080_0164081
638 Ga0501080_1185368
639 Ga0501081_1192720
640 nmdc:mga05p37_11332_c1
641 nmdc:mga05p37_3860_c1
642 nmdc:mga05p37_545471_c1
643 nmdc:mga05p37_858953_c1
644 nmdc:mga09592_1106439_c1
645 nmdc:mga09592_689738_c1
646 nmdc:mga06r32_1323584_c1
647 nmdc:mga08y16_110992_c1
648 nmdc:mga08y16_54743_c1
649 nmdc:mga0n895_122986_c1
650 nmdc:mga0n895_1418874_c1
651 nmdc:mga0n895_37096_c1
652 nmdc:mga0n895_69_c1
653 nmdc:mga0n895_73087_c1
654 nmdc:mga0n895_809461_c1
655 nmdc:mga0rr50_37698_c1
656 nmdc:mga0rr50_4_c1
657 nmdc:mga0rr50_73352_c1
658 nmdc:mga0rr50_843999_c1
659 nmdc:mga08x19_1007_c1
660 nmdc:mga08x19_125325_c1
661 nmdc:mga08x19_146992_c1
662 nmdc:mga08x19_95591_c1
663 nmdc:mga0a205_13664_c1
664 nmdc:mga0a205_255720_c1
665 nmdc:mga0a205_436090_c1
666 Ga0501084_0271917
667 Ga0501084_1707197
668 Ga0590071_030549
669 Ga0590071_038962
670 Ga0590077_078923
671 Ga0501082_1038227
672 Ga0501082_1479019
673 Ga0530510_0834120
674 Ga0530510_0886730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lvy-assembly3.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.4759 9 65
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.4435 9 64
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.4347 9 83
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.3896 9 83
6od5-assembly2.cif.gz_C human tcf4 c-terminal bhlh domain in complex with 12-bp oligonucleotide containing e-box sequence with 5-carboxylcytosines 0.3587 15 80
ID Description Score Start End Superfamily
af_Q5TCS8_1409_1601_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6003 8 44 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.447 8 48 3.40.50.300
6od5C00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.3587 15 80 4.10.280.10
af_Q2FWL2_134_291_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.3469 19 79 3.30.420.40
6od5C00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.342 15 80 4.10.280.10
ID Description Score Start End GO Terms
AF-A0A2V8D3F8-F1-model_v4 Peroxidase 0.8318 1 54 GO:0004601
AF-A0A2V8D3F8-F1-model_v4 Peroxidase 0.8062 1 54 GO:0004601
AF-A0A2V8T7C7-F1-model_v4 Peroxidase 0.794 4 46 GO:0004601
AF-A0A2V8T7C7-F1-model_v4 Peroxidase 0.7667 4 46 GO:0004601
AF-A0A831T0V6-F1-model_v4 Uncharacterized protein 0.6925 1 63

Map