F413096

General Info

Members Datasets Scaffolds Average Seq Length
337 161 674 295

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10059192|Ga0213876_100591922
Length 315
Sequence MLSALTKTQQIPFHMHRRAFIKHTGKTAIATSVFGSIRWSNNHFIGDTPTTTDILGPYYRPGAPFRTNINPPGFSGELLHFNGRVLGNGGKTPVQNCLVEIWQCDADQHYDNISEDFRYRGAQKTDASGKYSFVTTQPVAYPIEEGSSIYRPAHIHMRIAGDGQQDLITQIYFKGDSMLEHDGPASAPTAINRILTIGKNDKNEKELRFDIVLADEVKPTDEVFKKLTGIYKMNDKSMIEFYREGDLLFMKLDGQIIEALSYKGKDGFSGGVNSTTTAKFEIMPGKKTKVFLHFYAVQDMTIKELILEGVITFKY

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0.59
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 7.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10059192 3300021384 Bacteria 2022
2 ARcpr5yngRDRAFT_c003930 3300000043 Bacteria 1430
3 Ga0065712_10161904 3300005290 Bacteria 1296
4 Ga0070658_10216899 3300005327 Bacteria 1617
5 Ga0070676_10395877 3300005328 Bacteria 960
6 Ga0070683_100030484 3300005329 Unclassified 4898
7 Ga0070683_100032942 3300005329 Bacteria 4722
8 Ga0070683_100302005 3300005329 Bacteria 1523
9 Ga0070683_100326121 3300005329 Bacteria 1462
10 Ga0070690_100077416 3300005330 Bacteria 2171
11 Ga0070670_100106386 3300005331 Bacteria 2417
12 Ga0070670_100147243 3300005331 Bacteria 2038
13 Ga0070670_100172137 3300005331 Bacteria 1878
14 Ga0070670_100309408 3300005331 Bacteria 1383
15 Ga0070677_10028693 3300005333 Bacteria 2104
16 Ga0068869_100034178 3300005334 Bacteria 3595
17 Ga0068869_100066972 3300005334 Bacteria 2648
18 Ga0068869_100131975 3300005334 Bacteria 1921
19 Ga0068869_100135128 3300005334 Bacteria 1899
20 Ga0070666_10013196 3300005335 Bacteria 5238
21 Ga0068868_100006692 3300005338 Bacteria 8175
22 Ga0068868_100008325 3300005338 Bacteria 7423
23 Ga0070660_100043524 3300005339 Bacteria 3431
24 Ga0070660_100134429 3300005339 Unclassified 1981
25 Ga0070660_100378281 3300005339 Bacteria 1169
26 Ga0070689_100010707 3300005340 Bacteria 6545
27 Ga0070689_100012566 3300005340 Bacteria 6105
28 Ga0070689_100065045 3300005340 Bacteria 2839
29 Ga0070661_100021491 3300005344 Bacteria 4610
30 Ga0070668_100014582 3300005347 Bacteria 5874
31 Ga0070668_100244579 3300005347 Bacteria 1487
32 Ga0070675_100026919 3300005354 Bacteria 4617
33 Ga0070675_100060958 3300005354 Bacteria 3114
34 Ga0070675_100295839 3300005354 Bacteria 1425
35 Ga0070671_100135164 3300005355 Bacteria 2079
36 Ga0070674_100020274 3300005356 Bacteria 4242
37 Ga0070674_100287290 3300005356 Bacteria 1306
38 Ga0070673_100053371 3300005364 Unclassified 3175
39 Ga0070673_100225824 3300005364 Bacteria 1623
40 Ga0070688_100078971 3300005365 Bacteria 2124
41 Ga0070659_100237583 3300005366 Bacteria 1507
42 Ga0070667_100018520 3300005367 Bacteria 5776
43 Ga0070678_100244307 3300005456 Bacteria 1502
44 Ga0070662_100014388 3300005457 Bacteria 5285
45 Ga0070662_100038721 3300005457 Bacteria 3387
46 Ga0070662_100117371 3300005457 Bacteria 2035
47 Ga0068867_100008783 3300005459 Bacteria 7135
48 Ga0068867_100026518 3300005459 Bacteria 4162
49 Ga0068867_100055738 3300005459 Bacteria 2923
50 Ga0070698_100004394 3300005471 Bacteria 15489
51 Ga0070698_100006556 3300005471 Bacteria 12626
52 Ga0070698_100024680 3300005471 Bacteria 6271
53 Ga0070679_100194181 3300005530 Bacteria 1998
54 Ga0070679_100278805 3300005530 Bacteria 1625
55 Ga0070684_100002508 3300005535 Bacteria 13526
56 Ga0070684_100345141 3300005535 Bacteria 1369
57 Ga0068853_100109690 3300005539 Bacteria 2450
58 Ga0068853_100118990 3300005539 Bacteria 2354
59 Ga0068853_100317438 3300005539 Bacteria 1444
60 Ga0070672_100120596 3300005543 Bacteria 2146
61 Ga0070672_100278607 3300005543 Bacteria 1413
62 Ga0070672_100330829 3300005543 Bacteria 1296
63 Ga0070665_100049122 3300005548 Bacteria 4233
64 Ga0070665_100489594 3300005548 Bacteria 1241
65 Ga0068855_100047898 3300005563 Bacteria 5047
66 Ga0068855_100321671 3300005563 Unclassified 1710
67 Ga0068855_100348126 3300005563 Unclassified 1633
68 Ga0068855_100374296 3300005563 Bacteria 1565
69 Ga0068855_100495719 3300005563 Bacteria 1328
70 Ga0070664_100260684 3300005564 Bacteria 1560
71 Ga0070664_100388785 3300005564 Unclassified 1274
72 Ga0068857_100021002 3300005577 Bacteria 5745
73 Ga0068857_100241963 3300005577 Bacteria 1652
74 Ga0068854_100098406 3300005578 Unclassified 2189
75 Ga0068856_100434612 3300005614 Bacteria 1333
76 Ga0068852_100046447 3300005616 Bacteria 3700
77 Ga0068852_100110318 3300005616 Bacteria 2500
78 Ga0068852_100177193 3300005616 Bacteria 2002
79 Ga0068852_100219869 3300005616 Bacteria 1806
80 Ga0068859_100045704 3300005617 Bacteria 4399
81 Ga0068859_100103293 3300005617 Bacteria 2908
82 Ga0068859_100120487 3300005617 Bacteria 2691
83 Ga0068864_100003633 3300005618 Bacteria 12754
84 Ga0068864_100281827 3300005618 Bacteria 1551
85 Ga0068864_100316870 3300005618 Bacteria 1464
86 Ga0068864_100472061 3300005618 Bacteria 1203
87 Ga0068866_10063782 3300005718 Bacteria 1922
88 Ga0068861_100029513 3300005719 Bacteria 4013
89 Ga0068861_100084173 3300005719 Bacteria 2497
90 Ga0068861_100111829 3300005719 Bacteria 2189
91 Ga0068861_100289093 3300005719 Bacteria 1415
92 Ga0068870_10020104 3300005840 Bacteria 3247
93 Ga0068863_100122149 3300005841 Bacteria 2484
94 Ga0068863_100165401 3300005841 Bacteria 2121
95 Ga0068858_100060883 3300005842 Bacteria 3490
96 Ga0068860_100004702 3300005843 Bacteria 13930
97 Ga0068860_100069603 3300005843 Bacteria 3345
98 Ga0068862_100235029 3300005844 Bacteria 1664
99 Ga0068862_100266008 3300005844 Bacteria 1567
100 Ga0081539_10023819 3300005985 Bacteria 3995
101 Ga0070715_10215582 3300006163 Bacteria 984
102 Ga0075366_10140667 3300006195 Bacteria 1459
103 Ga0068871_100039948 3300006358 Unclassified 3756
104 Ga0068871_100231289 3300006358 Bacteria 1604
105 Ga0068871_100244436 3300006358 Bacteria 1561
106 Ga0075428_100001878 3300006844 Bacteria 22540
107 Ga0075428_100187610 3300006844 Bacteria 2237
108 Ga0075429_100011304 3300006880 Bacteria 7729
109 Ga0068865_100049678 3300006881 Bacteria 2893
110 Ga0068865_100162773 3300006881 Bacteria 1704
111 Ga0097620_100045705 3300006931 Bacteria 4399
112 Ga0097620_100103294 3300006931 Bacteria 2908
113 Ga0097620_100120487 3300006931 Bacteria 2691
114 Ga0105251_10095747 3300009011 Bacteria 1360
115 Ga0105240_10009461 3300009093 Bacteria 13795
116 Ga0105240_10020225 3300009093 Bacteria 8886
117 Ga0105240_10373810 3300009093 Bacteria 1611
118 Ga0111539_10034373 3300009094 Bacteria 6147
119 Ga0111539_10036138 3300009094 Bacteria 5975
120 Ga0111539_10146771 3300009094 Bacteria 2762
121 Ga0105242_10018324 3300009176 Bacteria 5472
122 Ga0105242_10046447 3300009176 Bacteria 3523
123 Ga0105242_10081917 3300009176 Bacteria 2699
124 Ga0105242_10104406 3300009176 Bacteria 2405
125 Ga0105242_10154324 3300009176 Bacteria 2005
126 Ga0105248_10191315 3300009177 Bacteria 2306
127 Ga0105248_10326008 3300009177 Bacteria 1730
128 Ga0105248_10647134 3300009177 Bacteria 1193
129 Ga0105237_10002155 3300009545 Bacteria 24769
130 Ga0105249_10000611 3300009553 Bacteria 32583
131 Ga0105249_10001968 3300009553 Bacteria 17825
132 Ga0105249_10017860 3300009553 Bacteria 6303
133 Ga0105249_10045632 3300009553 Bacteria 3987
134 Ga0105249_10739119 3300009553 Bacteria 1046
135 Ga0105239_10002568 3300010375 Bacteria 23031
136 Ga0105239_10065290 3300010375 Bacteria 3996
137 Ga0105246_10052790 3300011119 Bacteria 2795
138 Ga0105246_10126484 3300011119 Bacteria 1902
139 Ga0157373_10028080 3300013100 Bacteria 4060
140 Ga0157373_10028773 3300013100 Bacteria 4007
141 Ga0157373_10267500 3300013100 Bacteria 1210
142 Ga0157373_10272879 3300013100 Bacteria 1197
143 Ga0157371_10030636 3300013102 Bacteria 3880
144 Ga0157371_10102260 3300013102 Unclassified 2033
145 Ga0157370_10481833 3300013104 Bacteria 1140
146 Ga0157370_10674561 3300013104 Unclassified 944
147 Ga0157369_10057001 3300013105 Bacteria 4216
148 Ga0157369_10208325 3300013105 Bacteria 2050
149 Ga0157369_10243556 3300013105 Bacteria 1878
150 Ga0157374_10001852 3300013296 Bacteria 17789
151 Ga0157374_10006784 3300013296 Bacteria 9735
152 Ga0157374_10027661 3300013296 Bacteria 5119
153 Ga0157374_10234013 3300013296 Bacteria 1805
154 Ga0157374_10300777 3300013296 Bacteria 1587
155 Ga0157378_10159934 3300013297 Bacteria 2106
156 Ga0157378_10401318 3300013297 Bacteria 1351
157 Ga0163162_10003191 3300013306 Bacteria 15680
158 Ga0163162_10004465 3300013306 Bacteria 13479
159 Ga0163162_10010052 3300013306 Bacteria 9201
160 Ga0163162_10036395 3300013306 Bacteria 4906
161 Ga0163162_10113758 3300013306 Bacteria 2805
162 Ga0163162_10343152 3300013306 Bacteria 1626
163 Ga0163162_10467049 3300013306 Bacteria 1393
164 Ga0157372_10022934 3300013307 Bacteria 6761
165 Ga0157372_10056172 3300013307 Bacteria 4399
166 Ga0157372_10284595 3300013307 Bacteria 1922
167 Ga0157372_10336222 3300013307 Bacteria 1759
168 Ga0157372_10654031 3300013307 Bacteria 1224
169 Ga0157372_10840316 3300013307 Bacteria 1066
170 Ga0157375_10029398 3300013308 Bacteria 5167
171 Ga0157375_10048721 3300013308 Bacteria 4146
172 Ga0157375_10131394 3300013308 Unclassified 2623
173 Ga0157375_10140438 3300013308 Unclassified 2542
174 Ga0157375_10146621 3300013308 Bacteria 2491
175 Ga0157375_10361407 3300013308 Bacteria 1618
176 Ga0163163_10000348 3300014325 Bacteria 44508
177 Ga0157380_10183451 3300014326 Bacteria 1841
178 Ga0157380_10244757 3300014326 Unclassified 1619
179 Ga0157380_10587250 3300014326 Bacteria 1100
180 Ga0157377_10043687 3300014745 Bacteria 2495
181 Ga0157377_10047096 3300014745 Bacteria 2414
182 Ga0157379_10069044 3300014968 Unclassified 3160
183 Ga0157379_10081421 3300014968 Bacteria 2900
184 Ga0157379_10097330 3300014968 Bacteria 2642
185 Ga0157379_10172839 3300014968 Bacteria 1950
186 Ga0157379_10356657 3300014968 Bacteria 1340
187 Ga0157376_10571304 3300014969 Bacteria 1122
188 Ga0157376_10800017 3300014969 Unclassified 955
189 Ga0163161_10035001 3300017792 Bacteria 3593
190 Ga0163161_10075241 3300017792 Bacteria 2477
191 Ga0163161_10087082 3300017792 Bacteria 2306
192 Ga0209257_1000007 3300025304 Bacteria 1564415
193 Ga0207682_10024251 3300025893 Bacteria 2400
194 Ga0207642_10195524 3300025899 Bacteria 1113
195 Ga0207688_10078609 3300025901 Bacteria 1880
196 Ga0207680_10010443 3300025903 Bacteria 4644
197 Ga0207647_10050122 3300025904 Bacteria 2587
198 Ga0207645_10002157 3300025907 Bacteria 15725
199 Ga0207645_10012167 3300025907 Bacteria 5845
200 Ga0207643_10005289 3300025908 Bacteria 6906
201 Ga0207705_10062487 3300025909 Bacteria 2690
202 Ga0207705_10138294 3300025909 Bacteria 1817
203 Ga0207654_10107876 3300025911 Bacteria 1727
204 Ga0207707_10169494 3300025912 Bacteria 1908
205 Ga0207695_10015688 3300025913 Bacteria 8912
206 Ga0207695_10021935 3300025913 Bacteria 7268
207 Ga0207671_10002836 3300025914 Bacteria 18020
208 Ga0207662_10055179 3300025918 Bacteria 2371
209 Ga0207657_10054917 3300025919 Bacteria 3442
210 Ga0207657_10188889 3300025919 Bacteria 1663
211 Ga0207657_10262005 3300025919 Unclassified 1376
212 Ga0207649_10158974 3300025920 Bacteria 1564
213 Ga0207649_10179892 3300025920 Bacteria 1479
214 Ga0207652_10152633 3300025921 Bacteria 2068
215 Ga0207650_10046118 3300025925 Bacteria 3209
216 Ga0207659_10009756 3300025926 Bacteria 6005
217 Ga0207659_10013174 3300025926 Bacteria 5290
218 Ga0207659_10127105 3300025926 Bacteria 1962
219 Ga0207659_10277990 3300025926 Bacteria 1368
220 Ga0207659_10395104 3300025926 Bacteria 1155
221 Ga0207706_10009835 3300025933 Bacteria 8773
222 Ga0207706_10175461 3300025933 Bacteria 1883
223 Ga0207706_10331753 3300025933 Bacteria 1323
224 Ga0207686_10000367 3300025934 Bacteria 31650
225 Ga0207686_10211735 3300025934 Bacteria 1394
226 Ga0207686_10214120 3300025934 Bacteria 1387
227 Ga0207670_10009415 3300025936 Bacteria 5576
228 Ga0207670_10010246 3300025936 Bacteria 5392
229 Ga0207670_10016822 3300025936 Bacteria 4406
230 Ga0207670_10022966 3300025936 Unclassified 3874
231 Ga0207704_10077143 3300025938 Bacteria 2138
232 Ga0207704_10155549 3300025938 Bacteria 1620
233 Ga0207691_10011633 3300025940 Bacteria 8447
234 Ga0207691_10046509 3300025940 Bacteria 3987
235 Ga0207691_10049425 3300025940 Bacteria 3853
236 Ga0207711_10315224 3300025941 Bacteria 1444
237 Ga0207689_10001523 3300025942 Bacteria 22061
238 Ga0207689_10011441 3300025942 Bacteria 7605
239 Ga0207689_10085760 3300025942 Bacteria 2588
240 Ga0207689_10122525 3300025942 Bacteria 2138
241 Ga0207689_10226924 3300025942 Bacteria 1544
242 Ga0207689_10338176 3300025942 Bacteria 1250
243 Ga0207661_10145303 3300025944 Bacteria 2045
244 Ga0207679_10003751 3300025945 Bacteria 9418
245 Ga0207679_10116678 3300025945 Bacteria 2117
246 Ga0207667_10078033 3300025949 Bacteria 3433
247 Ga0207667_10366770 3300025949 Bacteria 1468
248 Ga0207651_10113363 3300025960 Bacteria 2040
249 Ga0207651_10547290 3300025960 Bacteria 1006
250 Ga0207712_10002156 3300025961 Bacteria 12855
251 Ga0207712_10003748 3300025961 Bacteria 9593
252 Ga0207712_10006746 3300025961 Bacteria 7242
253 Ga0207658_10066768 3300025986 Bacteria 2707
254 Ga0207677_10003862 3300026023 Bacteria 7982
255 Ga0207677_10173546 3300026023 Bacteria 1688
256 Ga0207677_10334130 3300026023 Bacteria 1264
257 Ga0207703_10584677 3300026035 Bacteria 1055
258 Ga0207639_10088345 3300026041 Bacteria 2473
259 Ga0207639_10265498 3300026041 Bacteria 1503
260 Ga0207639_10483064 3300026041 Bacteria 1129
261 Ga0207678_10043390 3300026067 Bacteria 3892
262 Ga0207708_10023750 3300026075 Bacteria 4635
263 Ga0207708_10145566 3300026075 Bacteria 1862
264 Ga0207641_10000873 3300026088 Bacteria 31566
265 Ga0207641_10041046 3300026088 Bacteria 3877
266 Ga0207641_10045529 3300026088 Bacteria 3695
267 Ga0207641_10163412 3300026088 Bacteria 2026
268 Ga0207648_10009922 3300026089 Bacteria 9077
269 Ga0207648_10073942 3300026089 Bacteria 2970
270 Ga0207676_10001245 3300026095 Bacteria 18955
271 Ga0207676_10039993 3300026095 Bacteria 3591
272 Ga0207676_10140265 3300026095 Bacteria 2068
273 Ga0207676_10600327 3300026095 Bacteria 1057
274 Ga0207674_10033039 3300026116 Bacteria 5420
275 Ga0207674_10077067 3300026116 Bacteria 3340
276 Ga0207674_10167080 3300026116 Unclassified 2154
277 Ga0207675_100059330 3300026118 Bacteria 3570
278 Ga0207675_100104055 3300026118 Bacteria 2675
279 Ga0207675_100148459 3300026118 Bacteria 2230
280 Ga0207675_100301401 3300026118 Bacteria 1561
281 Ga0207683_10000737 3300026121 Bacteria 29767
282 Ga0207683_10299399 3300026121 Unclassified 1471
283 Ga0207698_10050711 3300026142 Bacteria 3168
284 Ga0207698_10052102 3300026142 Bacteria 3133
285 Ga0207698_10066383 3300026142 Bacteria 2840
286 Ga0207698_10108187 3300026142 Bacteria 2323
287 Ga0207428_10137301 3300027907 Bacteria 1869
288 Ga0207428_10285451 3300027907 Unclassified 1224
289 Ga0268266_10066246 3300028379 Bacteria 3123
290 Ga0268265_10092317 3300028380 Unclassified 2423
291 Ga0268265_10121467 3300028380 Bacteria 2153
292 Ga0268265_10328192 3300028380 Bacteria 1389
293 Ga0268264_10005567 3300028381 Bacteria 10668
294 Ga0268264_10110609 3300028381 Bacteria 2406
295 Ga0268264_10154649 3300028381 Bacteria 2060
296 Ga0307515_10000024 3300028794 Bacteria 393119
297 Ga0316576_10212186 3300031727 Bacteria 1457
298 Ga0373943_0064695 3300035170 Bacteria 1837
299 Ga0373955_0012007 3300035172 Bacteria 4152
300 Ga0316574_0310863 3300035398 Bacteria 1001
301 Ga0373937_0238457 3300036401 Bacteria 1713
302 Ga0316584_0305654 3300036712 Bacteria 1151
303 Ga0395899_0078641 3300037312 Bacteria 2404
304 Ga0395900_0164370 3300037418 Bacteria 2262
305 Ga0395898_0023029 3300037466 Bacteria 6297
306 Ga0395898_0210402 3300037466 Bacteria 1855
307 Ga0395905_0110186 3300037471 Bacteria 2585
308 Ga0395901_0035860 3300038443 Bacteria 5125
309 Ga0436365_1398823 3300039437 Bacteria 37103
310 Ga0436365_1597568 3300039437 Bacteria 12609
311 Ga0451800_1585672 3300041459 Bacteria 1097
312 Ga0439462_0022618 3300042015 Bacteria 1646
313 Ga0450923_005502 3300042125 Bacteria 2050
314 Ga0439446_0051860 3300042156 Bacteria 1227
315 Ga0451577_0007617 3300042876 Bacteria 10620
316 Ga0453683_0029467 3300044673 Bacteria 3470
317 Ga0453684_0015052 3300044712 Bacteria 12276
318 Ga0451576_0076706 3300045051 Bacteria 3478
319 Ga0451576_0104387 3300045051 Bacteria 2948
320 Ga0451576_0123040 3300045051 Bacteria 2702
321 Ga0466967_0082000 3300045976 Bacteria 2914
322 Ga0495630_0119069 3300046517 Unclassified 2003
323 Ga0495621_0026922 3300046539 Bacteria 1944
324 Ga0495646_0158602 3300046680 Bacteria 1254
325 Ga0496112_0289278 3300048915 Bacteria 1585
326 Ga0501217_006456 3300049661 Bacteria 2492
327 Ga0501217_013920 3300049661 Bacteria 1810
328 Ga0501227_055736 3300049665 Bacteria 1005
329 Ga0501221_005785 3300049704 Bacteria 2076
330 Ga0501225_0025718 3300049705 Bacteria 1619
331 Ga0501234_001818 3300049707 Bacteria 3369
332 nmdc:mga09592_390850_c1 3300050508 Unclassified 1202
333 nmdc:mga09592_823_c1 3300050508 Bacteria 24005
334 nmdc:mga06r32_388759_c1 3300050510 Bacteria 1377
335 nmdc:mga08y16_46514_c1 3300050511 Bacteria 4543
336 nmdc:mga08y16_49539_c1 3300050511 Bacteria 4396
337 nmdc:mga08y16_499746_c1 3300050511 Unclassified 1236
338 Ga0213876_10059192
339 ARcpr5yngRDRAFT_c003930
340 Ga0065712_10161904
341 Ga0070658_10216899
342 Ga0070676_10395877
343 Ga0070683_100030484
344 Ga0070683_100032942
345 Ga0070683_100302005
346 Ga0070683_100326121
347 Ga0070690_100077416
348 Ga0070670_100106386
349 Ga0070670_100147243
350 Ga0070670_100172137
351 Ga0070670_100309408
352 Ga0070677_10028693
353 Ga0068869_100034178
354 Ga0068869_100066972
355 Ga0068869_100131975
356 Ga0068869_100135128
357 Ga0070666_10013196
358 Ga0068868_100006692
359 Ga0068868_100008325
360 Ga0070660_100043524
361 Ga0070660_100134429
362 Ga0070660_100378281
363 Ga0070689_100010707
364 Ga0070689_100012566
365 Ga0070689_100065045
366 Ga0070661_100021491
367 Ga0070668_100014582
368 Ga0070668_100244579
369 Ga0070675_100026919
370 Ga0070675_100060958
371 Ga0070675_100295839
372 Ga0070671_100135164
373 Ga0070674_100020274
374 Ga0070674_100287290
375 Ga0070673_100053371
376 Ga0070673_100225824
377 Ga0070688_100078971
378 Ga0070659_100237583
379 Ga0070667_100018520
380 Ga0070678_100244307
381 Ga0070662_100014388
382 Ga0070662_100038721
383 Ga0070662_100117371
384 Ga0068867_100008783
385 Ga0068867_100026518
386 Ga0068867_100055738
387 Ga0070698_100004394
388 Ga0070698_100006556
389 Ga0070698_100024680
390 Ga0070679_100194181
391 Ga0070679_100278805
392 Ga0070684_100002508
393 Ga0070684_100345141
394 Ga0068853_100109690
395 Ga0068853_100118990
396 Ga0068853_100317438
397 Ga0070672_100120596
398 Ga0070672_100278607
399 Ga0070672_100330829
400 Ga0070665_100049122
401 Ga0070665_100489594
402 Ga0068855_100047898
403 Ga0068855_100321671
404 Ga0068855_100348126
405 Ga0068855_100374296
406 Ga0068855_100495719
407 Ga0070664_100260684
408 Ga0070664_100388785
409 Ga0068857_100021002
410 Ga0068857_100241963
411 Ga0068854_100098406
412 Ga0068856_100434612
413 Ga0068852_100046447
414 Ga0068852_100110318
415 Ga0068852_100177193
416 Ga0068852_100219869
417 Ga0068859_100045704
418 Ga0068859_100103293
419 Ga0068859_100120487
420 Ga0068864_100003633
421 Ga0068864_100281827
422 Ga0068864_100316870
423 Ga0068864_100472061
424 Ga0068866_10063782
425 Ga0068861_100029513
426 Ga0068861_100084173
427 Ga0068861_100111829
428 Ga0068861_100289093
429 Ga0068870_10020104
430 Ga0068863_100122149
431 Ga0068863_100165401
432 Ga0068858_100060883
433 Ga0068860_100004702
434 Ga0068860_100069603
435 Ga0068862_100235029
436 Ga0068862_100266008
437 Ga0081539_10023819
438 Ga0070715_10215582
439 Ga0075366_10140667
440 Ga0068871_100039948
441 Ga0068871_100231289
442 Ga0068871_100244436
443 Ga0075428_100001878
444 Ga0075428_100187610
445 Ga0075429_100011304
446 Ga0068865_100049678
447 Ga0068865_100162773
448 Ga0097620_100045705
449 Ga0097620_100103294
450 Ga0097620_100120487
451 Ga0105251_10095747
452 Ga0105240_10009461
453 Ga0105240_10020225
454 Ga0105240_10373810
455 Ga0111539_10034373
456 Ga0111539_10036138
457 Ga0111539_10146771
458 Ga0105242_10018324
459 Ga0105242_10046447
460 Ga0105242_10081917
461 Ga0105242_10104406
462 Ga0105242_10154324
463 Ga0105248_10191315
464 Ga0105248_10326008
465 Ga0105248_10647134
466 Ga0105237_10002155
467 Ga0105249_10000611
468 Ga0105249_10001968
469 Ga0105249_10017860
470 Ga0105249_10045632
471 Ga0105249_10739119
472 Ga0105239_10002568
473 Ga0105239_10065290
474 Ga0105246_10052790
475 Ga0105246_10126484
476 Ga0157373_10028080
477 Ga0157373_10028773
478 Ga0157373_10267500
479 Ga0157373_10272879
480 Ga0157371_10030636
481 Ga0157371_10102260
482 Ga0157370_10481833
483 Ga0157370_10674561
484 Ga0157369_10057001
485 Ga0157369_10208325
486 Ga0157369_10243556
487 Ga0157374_10001852
488 Ga0157374_10006784
489 Ga0157374_10027661
490 Ga0157374_10234013
491 Ga0157374_10300777
492 Ga0157378_10159934
493 Ga0157378_10401318
494 Ga0163162_10003191
495 Ga0163162_10004465
496 Ga0163162_10010052
497 Ga0163162_10036395
498 Ga0163162_10113758
499 Ga0163162_10343152
500 Ga0163162_10467049
501 Ga0157372_10022934
502 Ga0157372_10056172
503 Ga0157372_10284595
504 Ga0157372_10336222
505 Ga0157372_10654031
506 Ga0157372_10840316
507 Ga0157375_10029398
508 Ga0157375_10048721
509 Ga0157375_10131394
510 Ga0157375_10140438
511 Ga0157375_10146621
512 Ga0157375_10361407
513 Ga0163163_10000348
514 Ga0157380_10183451
515 Ga0157380_10244757
516 Ga0157380_10587250
517 Ga0157377_10043687
518 Ga0157377_10047096
519 Ga0157379_10069044
520 Ga0157379_10081421
521 Ga0157379_10097330
522 Ga0157379_10172839
523 Ga0157379_10356657
524 Ga0157376_10571304
525 Ga0157376_10800017
526 Ga0163161_10035001
527 Ga0163161_10075241
528 Ga0163161_10087082
529 Ga0209257_1000007
530 Ga0207682_10024251
531 Ga0207642_10195524
532 Ga0207688_10078609
533 Ga0207680_10010443
534 Ga0207647_10050122
535 Ga0207645_10002157
536 Ga0207645_10012167
537 Ga0207643_10005289
538 Ga0207705_10062487
539 Ga0207705_10138294
540 Ga0207654_10107876
541 Ga0207707_10169494
542 Ga0207695_10015688
543 Ga0207695_10021935
544 Ga0207671_10002836
545 Ga0207662_10055179
546 Ga0207657_10054917
547 Ga0207657_10188889
548 Ga0207657_10262005
549 Ga0207649_10158974
550 Ga0207649_10179892
551 Ga0207652_10152633
552 Ga0207650_10046118
553 Ga0207659_10009756
554 Ga0207659_10013174
555 Ga0207659_10127105
556 Ga0207659_10277990
557 Ga0207659_10395104
558 Ga0207706_10009835
559 Ga0207706_10175461
560 Ga0207706_10331753
561 Ga0207686_10000367
562 Ga0207686_10211735
563 Ga0207686_10214120
564 Ga0207670_10009415
565 Ga0207670_10010246
566 Ga0207670_10016822
567 Ga0207670_10022966
568 Ga0207704_10077143
569 Ga0207704_10155549
570 Ga0207691_10011633
571 Ga0207691_10046509
572 Ga0207691_10049425
573 Ga0207711_10315224
574 Ga0207689_10001523
575 Ga0207689_10011441
576 Ga0207689_10085760
577 Ga0207689_10122525
578 Ga0207689_10226924
579 Ga0207689_10338176
580 Ga0207661_10145303
581 Ga0207679_10003751
582 Ga0207679_10116678
583 Ga0207667_10078033
584 Ga0207667_10366770
585 Ga0207651_10113363
586 Ga0207651_10547290
587 Ga0207712_10002156
588 Ga0207712_10003748
589 Ga0207712_10006746
590 Ga0207658_10066768
591 Ga0207677_10003862
592 Ga0207677_10173546
593 Ga0207677_10334130
594 Ga0207703_10584677
595 Ga0207639_10088345
596 Ga0207639_10265498
597 Ga0207639_10483064
598 Ga0207678_10043390
599 Ga0207708_10023750
600 Ga0207708_10145566
601 Ga0207641_10000873
602 Ga0207641_10041046
603 Ga0207641_10045529
604 Ga0207641_10163412
605 Ga0207648_10009922
606 Ga0207648_10073942
607 Ga0207676_10001245
608 Ga0207676_10039993
609 Ga0207676_10140265
610 Ga0207676_10600327
611 Ga0207674_10033039
612 Ga0207674_10077067
613 Ga0207674_10167080
614 Ga0207675_100059330
615 Ga0207675_100104055
616 Ga0207675_100148459
617 Ga0207675_100301401
618 Ga0207683_10000737
619 Ga0207683_10299399
620 Ga0207698_10050711
621 Ga0207698_10052102
622 Ga0207698_10066383
623 Ga0207698_10108187
624 Ga0207428_10137301
625 Ga0207428_10285451
626 Ga0268266_10066246
627 Ga0268265_10092317
628 Ga0268265_10121467
629 Ga0268265_10328192
630 Ga0268264_10005567
631 Ga0268264_10110609
632 Ga0268264_10154649
633 Ga0307515_10000024
634 Ga0316576_10212186
635 Ga0373943_0064695
636 Ga0373955_0012007
637 Ga0316574_0310863
638 Ga0373937_0238457
639 Ga0316584_0305654
640 Ga0395899_0078641
641 Ga0395900_0164370
642 Ga0395898_0023029
643 Ga0395898_0210402
644 Ga0395905_0110186
645 Ga0395901_0035860
646 Ga0436365_1398823
647 Ga0436365_1597568
648 Ga0451800_1585672
649 Ga0439462_0022618
650 Ga0450923_005502
651 Ga0439446_0051860
652 Ga0451577_0007617
653 Ga0453683_0029467
654 Ga0453684_0015052
655 Ga0451576_0076706
656 Ga0451576_0104387
657 Ga0451576_0123040
658 Ga0466967_0082000
659 Ga0495630_0119069
660 Ga0495621_0026922
661 Ga0495646_0158602
662 Ga0496112_0289278
663 Ga0501217_006456
664 Ga0501217_013920
665 Ga0501227_055736
666 Ga0501221_005785
667 Ga0501225_0025718
668 Ga0501234_001818
669 nmdc:mga09592_390850_c1
670 nmdc:mga09592_823_c1
671 nmdc:mga06r32_388759_c1
672 nmdc:mga08y16_46514_c1
673 nmdc:mga08y16_49539_c1
674 nmdc:mga08y16_499746_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

54

215

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8918 34 202
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8864 34 202
3hgi-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp 0.8491 33 202
2boy-assembly4.cif.gz_D crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp 0.8432 34 202
2xsu-assembly1.cif.gz_A-2 crystal structure of the a72g mutant of acinetobacter radioresistens catechol 1,2 dioxygenase 0.8383 33 203
ID Description Score Start End Superfamily
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8979 34 202 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8925 34 202 2.60.130.10
af_P86029_1_299_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8535 33 202 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8479 34 202 2.60.130.10
af_Q59Z18_7_293_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8428 31 199 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A2A4QQ87-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9188 33 202 GO:0008199
GO:0016702
AF-A0A2G8TBZ3-F1-model_v4 Uncharacterized protein 0.9072 201 296
AF-A0A3C2D0X7-F1-model_v4 Catechol 1,2-dioxygenase 0.9068 52 296 GO:0008199
GO:0016702
AF-A0A2S9YGD8-F1-model_v4 Catechol 1,2-dioxygenase 2 (EC 1.13.11.1) 0.9059 34 200 GO:0008199
GO:0018576
AF-A0A2E7CLG0-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.8965 34 200 GO:0008199
GO:0016702

Map