F413088

General Info

Members Datasets Scaffolds Average Seq Length
337 247 674 214

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10293860|Ga0182008_102938602
Length 217
Sequence MSDAPIRLLIADDHPVVRDGLSGIFDGDPGFEVLGQAADGAQAVELAERLAPDVVLMDLRMPGMDGLGAIAELARRGSAARVLVLTTYDTDADVLPAIQAGATGYLLKDAPRTELLRAVRAAARGESVLSPSVASRVLGRVRRPVSDEPDDLSPRELEILELVAQGSTNREAAKRLFISEATVKTHLLHIYAKLGVNDRAAAVATGFDRGLLTPKGR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
129 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
134 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2643221616 Leifsonia sp. Root227 Isolate Unclassified
219 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
220 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
221 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
222 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
223 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
224 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
225 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
226 2858882152 Micromonospora noduli MED15 Isolate Nodule
227 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
228 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
229 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
230 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
231 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
232 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
233 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
234 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
235 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
236 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
237 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
238 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
239 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
240 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
241 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
242 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
243 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
244 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
245 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
246 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
247 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 0.3
Isolates 9.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 1.19
Rhizoplane 8.31
Rhizosphere 73.89
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10293860 3300014497 Bacteria 848
2 JGI24740J21852_10003076 3300001979 Bacteria 7371
3 JGI25164J39214_1000373 3300002772 Bacteria 26703
4 JGI25165J46597_1000014 3300003214 Bacteria 390383
5 JGI25407J50210_10033110 3300003373 Bacteria 1335
6 Ga0070658_10004085 3300005327 Bacteria 11955
7 Ga0070683_100638361 3300005329 Bacteria 1019
8 Ga0070690_100712001 3300005330 Bacteria 772
9 Ga0070670_100047716 3300005331 Bacteria 3685
10 Ga0068869_100007315 3300005334 Bacteria 7041
11 Ga0070680_100014343 3300005336 Bacteria 6190
12 Ga0070682_100006196 3300005337 Bacteria 6701
13 Ga0070682_100211949 3300005337 Bacteria 1373
14 Ga0068868_100147990 3300005338 Bacteria 1932
15 Ga0070689_100085181 3300005340 Bacteria 2485
16 Ga0070691_10000596 3300005341 Bacteria 13849
17 Ga0070661_100007389 3300005344 Bacteria 7574
18 Ga0070661_100248947 3300005344 Bacteria 1371
19 Ga0070668_100000212 3300005347 Bacteria 37883
20 Ga0070668_100034908 3300005347 Bacteria 3833
21 Ga0070669_100441536 3300005353 Bacteria 1071
22 Ga0070675_100305069 3300005354 Bacteria 1403
23 Ga0070671_100000876 3300005355 Bacteria 22011
24 Ga0070688_100052621 3300005365 Bacteria 2544
25 Ga0070659_100030338 3300005366 Bacteria 4184
26 Ga0070659_100220876 3300005366 Bacteria 1564
27 Ga0070659_100461737 3300005366 Bacteria 1078
28 Ga0070705_100091738 3300005440 Bacteria 1894
29 Ga0070663_100000655 3300005455 Bacteria 18579
30 Ga0070663_100032017 3300005455 Bacteria 3620
31 Ga0070678_100000520 3300005456 Bacteria 18660
32 Ga0070681_10054073 3300005458 Bacteria 4000
33 Ga0070681_10265979 3300005458 Bacteria 1626
34 Ga0070699_100437525 3300005518 Bacteria 1185
35 Ga0070684_100266578 3300005535 Bacteria 1567
36 Ga0070684_100779527 3300005535 Bacteria 893
37 Ga0068853_100176861 3300005539 Bacteria 1933
38 Ga0070696_100164191 3300005546 Bacteria 1638
39 Ga0070693_100000789 3300005547 Bacteria 13968
40 Ga0070665_100084999 3300005548 Bacteria 3169
41 Ga0068855_100032975 3300005563 Bacteria 6183
42 Ga0070664_100233664 3300005564 Bacteria 1649
43 Ga0070664_100329711 3300005564 Bacteria 1384
44 Ga0068856_100040890 3300005614 Bacteria 4554
45 Ga0068856_100429242 3300005614 Bacteria 1342
46 Ga0068852_100347487 3300005616 Bacteria 1447
47 Ga0068859_100059547 3300005617 Bacteria 3847
48 Ga0068859_100567516 3300005617 Bacteria 1229
49 Ga0068851_10013325 3300005834 Bacteria 3892
50 Ga0068870_10000251 3300005840 Bacteria 19876
51 Ga0068863_100001355 3300005841 Bacteria 24371
52 Ga0068858_100082065 3300005842 Bacteria 2996
53 Ga0068860_100537280 3300005843 Bacteria 1170
54 Ga0068862_100057704 3300005844 Bacteria 3330
55 Ga0081538_10013669 3300005981 Bacteria 6417
56 Ga0081540_1004201 3300005983 Bacteria 11070
57 Ga0081540_1120567 3300005983 Bacteria 1089
58 Ga0081539_10000775 3300005985 Bacteria 62812
59 Ga0070717_10317095 3300006028 Bacteria 1388
60 Ga0075432_10106556 3300006058 Bacteria 1041
61 Ga0070715_10002074 3300006163 Bacteria 6049
62 Ga0070716_100011918 3300006173 Bacteria 4392
63 Ga0075428_100000079 3300006844 Bacteria 80383
64 Ga0075430_100012533 3300006846 Bacteria 7216
65 Ga0075430_100303414 3300006846 Bacteria 1321
66 Ga0075431_100001460 3300006847 Bacteria 21806
67 Ga0075431_100441801 3300006847 Bacteria 1298
68 Ga0075431_100750365 3300006847 Bacteria 951
69 Ga0075433_10018042 3300006852 Bacteria 5858
70 Ga0075433_10027330 3300006852 Bacteria 4837
71 Ga0075434_100027720 3300006871 Bacteria 5562
72 Ga0075434_100055970 3300006871 Bacteria 3919
73 Ga0075429_100027360 3300006880 Bacteria 4949
74 Ga0097620_100059546 3300006931 Bacteria 3847
75 Ga0097620_100567385 3300006931 Bacteria 1229
76 Ga0075435_100010037 3300007076 Bacteria 6904
77 Ga0105240_10175338 3300009093 Bacteria 2535
78 Ga0111539_10199565 3300009094 Bacteria 2333
79 Ga0105245_10010526 3300009098 Bacteria 8048
80 Ga0105245_10051260 3300009098 Bacteria 3700
81 Ga0114129_10012286 3300009147 Bacteria 12184
82 Ga0114129_10145396 3300009147 Bacteria 3248
83 Ga0114129_10200367 3300009147 Bacteria 2704
84 Ga0114129_10602839 3300009147 Bacteria 1423
85 Ga0105243_10483582 3300009148 Bacteria 1169
86 Ga0105248_10008589 3300009177 Bacteria 11217
87 Ga0105248_10035613 3300009177 Bacteria 5569
88 Ga0105238_10057551 3300009551 Bacteria 3898
89 Ga0105246_10012415 3300011119 Bacteria 5315
90 Ga0157373_10063172 3300013100 Bacteria 2622
91 Ga0157369_10055672 3300013105 Bacteria 4269
92 Ga0157369_10451959 3300013105 Bacteria 1330
93 Ga0157374_10007043 3300013296 Bacteria 9571
94 Ga0157372_10084570 3300013307 Bacteria 3597
95 Ga0163163_10137408 3300014325 Bacteria 2485
96 Ga0163163_10951392 3300014325 Bacteria 922
97 Ga0157377_10046608 3300014745 Bacteria 2425
98 Ga0157379_10023764 3300014968 Bacteria 5441
99 Ga0157376_10211075 3300014969 Bacteria 1792
100 Ga0206350_11631020 3300020080 Bacteria 1232
101 Ga0207427_100041 3300025231 Bacteria 263659
102 Ga0209437_100554 3300025233 Bacteria 24966
103 Ga0209233_1000014 3300025261 Bacteria 996641
104 Ga0207656_10063971 3300025321 Bacteria 1620
105 Ga0207692_10207878 3300025898 Bacteria 1154
106 Ga0207688_10011324 3300025901 Bacteria 4855
107 Ga0207645_10046213 3300025907 Bacteria 2781
108 Ga0207643_10000039 3300025908 Bacteria 86154
109 Ga0207705_10002100 3300025909 Bacteria 15493
110 Ga0207705_10022004 3300025909 Bacteria 4550
111 Ga0207654_10010252 3300025911 Bacteria 4770
112 Ga0207654_10516641 3300025911 Bacteria 845
113 Ga0207707_10046950 3300025912 Bacteria 3761
114 Ga0207707_10090655 3300025912 Bacteria 2672
115 Ga0207693_10012710 3300025915 Bacteria 6800
116 Ga0207660_10009192 3300025917 Bacteria 6395
117 Ga0207662_10168735 3300025918 Bacteria 1402
118 Ga0207657_10013561 3300025919 Bacteria 7994
119 Ga0207649_10038451 3300025920 Bacteria 2897
120 Ga0207649_10057981 3300025920 Bacteria 2423
121 Ga0207652_10027907 3300025921 Bacteria 4708
122 Ga0207681_10399848 3300025923 Bacteria 1109
123 Ga0207694_10529159 3300025924 Bacteria 988
124 Ga0207650_10007952 3300025925 Bacteria 7228
125 Ga0207687_10040362 3300025927 Bacteria 3199
126 Ga0207687_10061954 3300025927 Bacteria 2643
127 Ga0207664_10900999 3300025929 Bacteria 794
128 Ga0207644_10066917 3300025931 Bacteria 2617
129 Ga0207690_10403747 3300025932 Bacteria 1090
130 Ga0207706_10024908 3300025933 Bacteria 5364
131 Ga0207670_10303882 3300025936 Bacteria 1250
132 Ga0207665_10001565 3300025939 Bacteria 15426
133 Ga0207691_10394645 3300025940 Bacteria 1180
134 Ga0207711_10034096 3300025941 Bacteria 4311
135 Ga0207711_10171268 3300025941 Bacteria 1970
136 Ga0207689_10001021 3300025942 Bacteria 26898
137 Ga0207689_10452865 3300025942 Bacteria 1073
138 Ga0207661_10002908 3300025944 Bacteria 11841
139 Ga0207661_10018735 3300025944 Bacteria 5148
140 Ga0207661_10451753 3300025944 Bacteria 1170
141 Ga0207679_10003686 3300025945 Bacteria 9494
142 Ga0207667_10382515 3300025949 Bacteria 1434
143 Ga0207651_10123644 3300025960 Bacteria 1967
144 Ga0207668_10000202 3300025972 Bacteria 40372
145 Ga0207668_10311737 3300025972 Bacteria 1302
146 Ga0207668_10386859 3300025972 Bacteria 1179
147 Ga0207640_10033158 3300025981 Bacteria 3210
148 Ga0207677_10004646 3300026023 Bacteria 7394
149 Ga0207678_10000435 3300026067 Bacteria 37869
150 Ga0207678_10002386 3300026067 Bacteria 17063
151 Ga0207708_10958341 3300026075 Bacteria 742
152 Ga0207702_10004388 3300026078 Bacteria 12564
153 Ga0207702_10015325 3300026078 Bacteria 6354
154 Ga0207702_10099380 3300026078 Bacteria 2565
155 Ga0207702_10443431 3300026078 Bacteria 1258
156 Ga0207641_10022527 3300026088 Bacteria 5184
157 Ga0207676_10450878 3300026095 Bacteria 1213
158 Ga0207674_10027761 3300026116 Bacteria 5981
159 Ga0207674_10079517 3300026116 Bacteria 3283
160 Ga0207675_100125154 3300026118 Bacteria 2435
161 Ga0207675_100233899 3300026118 Bacteria 1774
162 Ga0207683_10000897 3300026121 Bacteria 27402
163 Ga0207698_10021987 3300026142 Bacteria 4422
164 Ga0207428_10003557 3300027907 Bacteria 15060
165 Ga0268265_10047525 3300028380 Bacteria 3216
166 Ga0268264_10186880 3300028381 Bacteria 1886
167 Ga0307517_10153173 3300028786 Bacteria 1574
168 Ga0307515_10002730 3300028794 Bacteria 37752
169 Ga0307515_10011201 3300028794 Bacteria 17047
170 Ga0307515_10050529 3300028794 Bacteria 6224
171 Ga0307515_10146187 3300028794 Bacteria 2502
172 Ga0307511_10141908 3300030521 Bacteria 1408
173 Ga0307512_10019774 3300030522 Bacteria 6122
174 Ga0307512_10099752 3300030522 Bacteria 1974
175 Ga0314311_1262403 3300030733 Bacteria 947
176 Ga0307513_10003586 3300031456 Bacteria 20986
177 Ga0307513_10034710 3300031456 Bacteria 5655
178 Ga0307513_10112459 3300031456 Bacteria 2713
179 Ga0307513_10725611 3300031456 Bacteria 699
180 Ga0307509_10020069 3300031507 Bacteria 7597
181 Ga0307509_10094304 3300031507 Bacteria 3052
182 Ga0307508_10117979 3300031616 Bacteria 2255
183 Ga0316575_10020554 3300031665 Bacteria 2534
184 Ga0316579_10020609 3300031691 Unclassified 2928
185 Ga0316576_10028854 3300031727 Unclassified 3916
186 Ga0316578_10034009 3300031728 Unclassified 2924
187 Ga0307516_10000364 3300031730 Bacteria 59025
188 Ga0307516_10008159 3300031730 Bacteria 11894
189 Ga0307516_10211235 3300031730 Bacteria 1655
190 Ga0307405_10000620 3300031731 Bacteria 13632
191 Ga0316577_10005881 3300031733 Bacteria 6456
192 Ga0307413_10033621 3300031824 Bacteria 2922
193 Ga0307410_10024537 3300031852 Bacteria 3768
194 Ga0307406_10030998 3300031901 Bacteria 3252
195 Ga0307412_10371430 3300031911 Bacteria 1155
196 Ga0307409_100002059 3300031995 Bacteria 10333
197 Ga0307409_100475088 3300031995 Bacteria 1212
198 Ga0307409_100567046 3300031995 Bacteria 1117
199 Ga0307416_100000769 3300032002 Bacteria 16825
200 Ga0307415_100000167 3300032126 Bacteria 29155
201 Ga0316583_10071459 3300032133 Bacteria 1214
202 Ga0307507_10393958 3300033179 Bacteria 791
203 Ga0373951_0000184 3300035091 Bacteria 22487
204 Ga0316574_0003515 3300035398 Bacteria 8086
205 Ga0316582_0080383 3300036647 Bacteria 2127
206 Ga0316584_0000730 3300036712 Bacteria 18269
207 Ga0395900_0027548 3300037418 Bacteria 5822
208 Ga0395900_0399954 3300037418 Bacteria 1338
209 Ga0395898_0004528 3300037466 Bacteria 15175
210 Ga0395898_0157950 3300037466 Bacteria 2169
211 Ga0316581_0005908 3300037588 Unclassified 3217
212 Ga0395901_0002737 3300038443 Bacteria 17780
213 Ga0451791_0568111 3300041451 Bacteria 1560
214 Ga0439463_026530 3300042016 Bacteria 1455
215 Ga0439458_0021840 3300042157 Bacteria 1484
216 Ga0466969_0007433 3300044656 Bacteria 5818
217 Ga0466966_0005783 3300044684 Bacteria 8149
218 Ga0466961_0038817 3300044693 Bacteria 3054
219 Ga0466961_0114658 3300044693 Bacteria 1694
220 Ga0466970_0000223 3300044765 Bacteria 27940
221 Ga0466959_0001909 3300045049 Bacteria 13109
222 Ga0466967_0771206 3300045976 Bacteria 954
223 Ga0495662_0031398 3300046476 Bacteria 2566
224 Ga0495632_0027444 3300046519 Bacteria 2983
225 Ga0495676_0266434 3300047321 Bacteria 1164
226 Ga0496100_0040327 3300048903 Bacteria 2970
227 Ga0496100_0771521 3300048903 Bacteria 752
228 Ga0496101_0097591 3300048904 Bacteria 2195
229 Ga0496102_0032940 3300048905 Bacteria 4657
230 Ga0496102_0080219 3300048905 Bacteria 3006
231 Ga0496102_0340730 3300048905 Bacteria 1412
232 Ga0496104_0005849 3300048907 Bacteria 10773
233 Ga0496104_0009038 3300048907 Bacteria 8860
234 Ga0496104_0524470 3300048907 Bacteria 1096
235 Ga0496105_0001713 3300048908 Bacteria 15661
236 Ga0496105_0038623 3300048908 Bacteria 3933
237 Ga0496106_0002112 3300048909 Bacteria 14854
238 Ga0496108_0027208 3300048911 Bacteria 4720
239 Ga0496108_0047726 3300048911 Bacteria 3579
240 Ga0496109_0002709 3300048912 Bacteria 14846
241 Ga0496109_0390109 3300048912 Bacteria 1315
242 Ga0496109_0503910 3300048912 Bacteria 1143
243 Ga0496110_0002171 3300048913 Bacteria 14648
244 Ga0496110_0500884 3300048913 Bacteria 1106
245 Ga0496111_0002374 3300048914 Bacteria 11343
246 Ga0496112_0001492 3300048915 Bacteria 18026
247 Ga0496112_0214094 3300048915 Bacteria 1883
248 Ga0496113_0083401 3300048916 Bacteria 2452
249 Ga0496114_0206717 3300048917 Bacteria 1721
250 Ga0496114_0239433 3300048917 Bacteria 1595
251 Ga0496115_0115605 3300048918 Bacteria 2206
252 Ga0496115_0181729 3300048918 Bacteria 1738
253 Ga0496117_0146341 3300048920 Bacteria 1406
254 Ga0496118_0073560 3300048921 Bacteria 2447
255 Ga0496119_0006977 3300048922 Bacteria 10298
256 Ga0496120_0000655 3300048923 Bacteria 50898
257 Ga0496120_0006873 3300048923 Bacteria 8596
258 Ga0496121_0005374 3300048924 Bacteria 16460
259 Ga0501032_0550610 3300049569 Bacteria 735
260 Ga0501034_0579850 3300049571 Bacteria 1029
261 Ga0501036_0147117 3300049572 Bacteria 1987
262 Ga0501036_0770909 3300049572 Bacteria 793
263 Ga0501038_0080459 3300049574 Bacteria 2746
264 Ga0501039_0128365 3300049575 Bacteria 1989
265 Ga0501039_0748127 3300049575 Bacteria 763
266 Ga0501040_0001531 3300049576 Bacteria 14700
267 Ga0501041_0019605 3300049577 Bacteria 4040
268 Ga0501046_0073952 3300049580 Bacteria 2644
269 Ga0501046_0400450 3300049580 Bacteria 992
270 Ga0501071_0145012 3300049587 Bacteria 1769
271 Ga0501072_0017297 3300049588 Bacteria 5541
272 Ga0501072_0112941 3300049588 Bacteria 2163
273 Ga0501072_0395329 3300049588 Bacteria 1096
274 Ga0501073_0028813 3300049589 Bacteria 3968
275 Ga0501075_0105302 3300049591 Bacteria 2144
276 Ga0501076_0001615 3300049592 Bacteria 15198
277 Ga0501076_0020982 3300049592 Bacteria 5005
278 Ga0501079_0004667 3300049741 Bacteria 10150
279 Ga0501081_0000545 3300049743 Bacteria 21349
280 Ga0501044_0182958 3300049823 Bacteria 2062
281 Ga0501044_0708035 3300049823 Bacteria 892
282 Ga0501045_0030825 3300049824 Bacteria 3882
283 Ga0501045_0138569 3300049824 Bacteria 1809
284 nmdc:mga05p37_113288_c1 3300050507 Bacteria 3335
285 nmdc:mga05p37_39272_c1 3300050507 Bacteria 5810
286 nmdc:mga05p37_692277_c1 3300050507 Bacteria 1134
287 nmdc:mga09592_5948_c1 3300050508 Bacteria 9946
288 nmdc:mga0qj67_111987_c1 3300050509 Bacteria 2204
289 nmdc:mga0qj67_75844_c1 3300050509 Bacteria 2688
290 nmdc:mga06r32_140145_c1 3300050510 Bacteria 2394
291 nmdc:mga06r32_221092_c1 3300050510 Bacteria 1882
292 nmdc:mga06r32_436462_c1 3300050510 Bacteria 1290
293 nmdc:mga06r32_56298_c1 3300050510 Bacteria 3775
294 nmdc:mga08y16_53965_c1 3300050511 Bacteria 4201
295 nmdc:mga0n895_11240_c1 3300050512 Bacteria 7975
296 nmdc:mga0n895_4694_c1 3300050512 Bacteria 11273
297 nmdc:mga08x19_7485_c1 3300050514 Bacteria 6486
298 nmdc:mga0a205_12443_c1 3300050515 Bacteria 7870
299 nmdc:mga0a205_19677_c1 3300050515 Bacteria 6369
300 nmdc:mga0sz30_346960_c1 3300050516 Bacteria 663
301 Ga0500644_0018088 3300053088 Bacteria 2058
302 Ga0500644_0096541 3300053088 Bacteria 1116
303 Ga0500630_139761 3300053159 Bacteria 1044
304 Ga0501082_0066448 3300060353 Bacteria 3106
305 Ga0501082_0265455 3300060353 Bacteria 1494
306 Ga0530510_0028883 3300061734 Bacteria 3978
307 2644094371 2643221616 Bacteria 4066575
308 2676496633 2675903060 Bacteria 10051191
309 2753073618 2751185734 Bacteria 8863695
310 2795786480 2795385470 Bacteria 8317180
311 2795797842 2795385472 Bacteria 6627535
312 2855674889 2855670206 Bacteria 7120389
313 2855679444 2855676851 Bacteria 7063653
314 2857289480 2857288857 Bacteria 7189066
315 2858888014 2858882152 Bacteria 7230291
316 2858895421 2858888857 Bacteria 7060307
317 2866618318 2866612099 Bacteria 7543886
318 2867317297 2867312974 Bacteria 7058875
319 2867323114 2867319477 Bacteria 7069771
320 2867510714 2867507094 Bacteria 6506033
321 2869054454 2869048445 Bacteria 6875584
322 2869065772 2869061728 Bacteria 7112407
323 2869073500 2869068681 Bacteria 7205615
324 2870725576 2870721527 Bacteria 9689237
325 2880494995 2880489317 Bacteria 7096270
326 2880497336 2880495981 Bacteria 7340502
327 2884703797 2884693830 Bacteria 11273186
328 2895448939 2895442618 Bacteria 11027144
329 2899366336 2899359706 Bacteria 10940472
330 2915774919 2915768154 Bacteria 8424322
331 2917738525 2917736166 Bacteria 9690793
332 2917742769 2917736166 Bacteria 9690793
333 2929225898 2929219909 Bacteria 6984360
334 2929232560 2929226422 Bacteria 7248583
335 3003006190 3002998708 Bacteria 11715108
336 8054704348 8054704163 Bacteria 7247792
337 8054731562 8054727385 Bacteria 7558670
338 Ga0182008_10293860
339 JGI24740J21852_10003076
340 JGI25164J39214_1000373
341 JGI25165J46597_1000014
342 JGI25407J50210_10033110
343 Ga0070658_10004085
344 Ga0070683_100638361
345 Ga0070690_100712001
346 Ga0070670_100047716
347 Ga0068869_100007315
348 Ga0070680_100014343
349 Ga0070682_100006196
350 Ga0070682_100211949
351 Ga0068868_100147990
352 Ga0070689_100085181
353 Ga0070691_10000596
354 Ga0070661_100007389
355 Ga0070661_100248947
356 Ga0070668_100000212
357 Ga0070668_100034908
358 Ga0070669_100441536
359 Ga0070675_100305069
360 Ga0070671_100000876
361 Ga0070688_100052621
362 Ga0070659_100030338
363 Ga0070659_100220876
364 Ga0070659_100461737
365 Ga0070705_100091738
366 Ga0070663_100000655
367 Ga0070663_100032017
368 Ga0070678_100000520
369 Ga0070681_10054073
370 Ga0070681_10265979
371 Ga0070699_100437525
372 Ga0070684_100266578
373 Ga0070684_100779527
374 Ga0068853_100176861
375 Ga0070696_100164191
376 Ga0070693_100000789
377 Ga0070665_100084999
378 Ga0068855_100032975
379 Ga0070664_100233664
380 Ga0070664_100329711
381 Ga0068856_100040890
382 Ga0068856_100429242
383 Ga0068852_100347487
384 Ga0068859_100059547
385 Ga0068859_100567516
386 Ga0068851_10013325
387 Ga0068870_10000251
388 Ga0068863_100001355
389 Ga0068858_100082065
390 Ga0068860_100537280
391 Ga0068862_100057704
392 Ga0081538_10013669
393 Ga0081540_1004201
394 Ga0081540_1120567
395 Ga0081539_10000775
396 Ga0070717_10317095
397 Ga0075432_10106556
398 Ga0070715_10002074
399 Ga0070716_100011918
400 Ga0075428_100000079
401 Ga0075430_100012533
402 Ga0075430_100303414
403 Ga0075431_100001460
404 Ga0075431_100441801
405 Ga0075431_100750365
406 Ga0075433_10018042
407 Ga0075433_10027330
408 Ga0075434_100027720
409 Ga0075434_100055970
410 Ga0075429_100027360
411 Ga0097620_100059546
412 Ga0097620_100567385
413 Ga0075435_100010037
414 Ga0105240_10175338
415 Ga0111539_10199565
416 Ga0105245_10010526
417 Ga0105245_10051260
418 Ga0114129_10012286
419 Ga0114129_10145396
420 Ga0114129_10200367
421 Ga0114129_10602839
422 Ga0105243_10483582
423 Ga0105248_10008589
424 Ga0105248_10035613
425 Ga0105238_10057551
426 Ga0105246_10012415
427 Ga0157373_10063172
428 Ga0157369_10055672
429 Ga0157369_10451959
430 Ga0157374_10007043
431 Ga0157372_10084570
432 Ga0163163_10137408
433 Ga0163163_10951392
434 Ga0157377_10046608
435 Ga0157379_10023764
436 Ga0157376_10211075
437 Ga0206350_11631020
438 Ga0207427_100041
439 Ga0209437_100554
440 Ga0209233_1000014
441 Ga0207656_10063971
442 Ga0207692_10207878
443 Ga0207688_10011324
444 Ga0207645_10046213
445 Ga0207643_10000039
446 Ga0207705_10002100
447 Ga0207705_10022004
448 Ga0207654_10010252
449 Ga0207654_10516641
450 Ga0207707_10046950
451 Ga0207707_10090655
452 Ga0207693_10012710
453 Ga0207660_10009192
454 Ga0207662_10168735
455 Ga0207657_10013561
456 Ga0207649_10038451
457 Ga0207649_10057981
458 Ga0207652_10027907
459 Ga0207681_10399848
460 Ga0207694_10529159
461 Ga0207650_10007952
462 Ga0207687_10040362
463 Ga0207687_10061954
464 Ga0207664_10900999
465 Ga0207644_10066917
466 Ga0207690_10403747
467 Ga0207706_10024908
468 Ga0207670_10303882
469 Ga0207665_10001565
470 Ga0207691_10394645
471 Ga0207711_10034096
472 Ga0207711_10171268
473 Ga0207689_10001021
474 Ga0207689_10452865
475 Ga0207661_10002908
476 Ga0207661_10018735
477 Ga0207661_10451753
478 Ga0207679_10003686
479 Ga0207667_10382515
480 Ga0207651_10123644
481 Ga0207668_10000202
482 Ga0207668_10311737
483 Ga0207668_10386859
484 Ga0207640_10033158
485 Ga0207677_10004646
486 Ga0207678_10000435
487 Ga0207678_10002386
488 Ga0207708_10958341
489 Ga0207702_10004388
490 Ga0207702_10015325
491 Ga0207702_10099380
492 Ga0207702_10443431
493 Ga0207641_10022527
494 Ga0207676_10450878
495 Ga0207674_10027761
496 Ga0207674_10079517
497 Ga0207675_100125154
498 Ga0207675_100233899
499 Ga0207683_10000897
500 Ga0207698_10021987
501 Ga0207428_10003557
502 Ga0268265_10047525
503 Ga0268264_10186880
504 Ga0307517_10153173
505 Ga0307515_10002730
506 Ga0307515_10011201
507 Ga0307515_10050529
508 Ga0307515_10146187
509 Ga0307511_10141908
510 Ga0307512_10019774
511 Ga0307512_10099752
512 Ga0314311_1262403
513 Ga0307513_10003586
514 Ga0307513_10034710
515 Ga0307513_10112459
516 Ga0307513_10725611
517 Ga0307509_10020069
518 Ga0307509_10094304
519 Ga0307508_10117979
520 Ga0316575_10020554
521 Ga0316579_10020609
522 Ga0316576_10028854
523 Ga0316578_10034009
524 Ga0307516_10000364
525 Ga0307516_10008159
526 Ga0307516_10211235
527 Ga0307405_10000620
528 Ga0316577_10005881
529 Ga0307413_10033621
530 Ga0307410_10024537
531 Ga0307406_10030998
532 Ga0307412_10371430
533 Ga0307409_100002059
534 Ga0307409_100475088
535 Ga0307409_100567046
536 Ga0307416_100000769
537 Ga0307415_100000167
538 Ga0316583_10071459
539 Ga0307507_10393958
540 Ga0373951_0000184
541 Ga0316574_0003515
542 Ga0316582_0080383
543 Ga0316584_0000730
544 Ga0395900_0027548
545 Ga0395900_0399954
546 Ga0395898_0004528
547 Ga0395898_0157950
548 Ga0316581_0005908
549 Ga0395901_0002737
550 Ga0451791_0568111
551 Ga0439463_026530
552 Ga0439458_0021840
553 Ga0466969_0007433
554 Ga0466966_0005783
555 Ga0466961_0038817
556 Ga0466961_0114658
557 Ga0466970_0000223
558 Ga0466959_0001909
559 Ga0466967_0771206
560 Ga0495662_0031398
561 Ga0495632_0027444
562 Ga0495676_0266434
563 Ga0496100_0040327
564 Ga0496100_0771521
565 Ga0496101_0097591
566 Ga0496102_0032940
567 Ga0496102_0080219
568 Ga0496102_0340730
569 Ga0496104_0005849
570 Ga0496104_0009038
571 Ga0496104_0524470
572 Ga0496105_0001713
573 Ga0496105_0038623
574 Ga0496106_0002112
575 Ga0496108_0027208
576 Ga0496108_0047726
577 Ga0496109_0002709
578 Ga0496109_0390109
579 Ga0496109_0503910
580 Ga0496110_0002171
581 Ga0496110_0500884
582 Ga0496111_0002374
583 Ga0496112_0001492
584 Ga0496112_0214094
585 Ga0496113_0083401
586 Ga0496114_0206717
587 Ga0496114_0239433
588 Ga0496115_0115605
589 Ga0496115_0181729
590 Ga0496117_0146341
591 Ga0496118_0073560
592 Ga0496119_0006977
593 Ga0496120_0000655
594 Ga0496120_0006873
595 Ga0496121_0005374
596 Ga0501032_0550610
597 Ga0501034_0579850
598 Ga0501036_0147117
599 Ga0501036_0770909
600 Ga0501038_0080459
601 Ga0501039_0128365
602 Ga0501039_0748127
603 Ga0501040_0001531
604 Ga0501041_0019605
605 Ga0501046_0073952
606 Ga0501046_0400450
607 Ga0501071_0145012
608 Ga0501072_0017297
609 Ga0501072_0112941
610 Ga0501072_0395329
611 Ga0501073_0028813
612 Ga0501075_0105302
613 Ga0501076_0001615
614 Ga0501076_0020982
615 Ga0501079_0004667
616 Ga0501081_0000545
617 Ga0501044_0182958
618 Ga0501044_0708035
619 Ga0501045_0030825
620 Ga0501045_0138569
621 nmdc:mga05p37_113288_c1
622 nmdc:mga05p37_39272_c1
623 nmdc:mga05p37_692277_c1
624 nmdc:mga09592_5948_c1
625 nmdc:mga0qj67_111987_c1
626 nmdc:mga0qj67_75844_c1
627 nmdc:mga06r32_140145_c1
628 nmdc:mga06r32_221092_c1
629 nmdc:mga06r32_436462_c1
630 nmdc:mga06r32_56298_c1
631 nmdc:mga08y16_53965_c1
632 nmdc:mga0n895_11240_c1
633 nmdc:mga0n895_4694_c1
634 nmdc:mga08x19_7485_c1
635 nmdc:mga0a205_12443_c1
636 nmdc:mga0a205_19677_c1
637 nmdc:mga0sz30_346960_c1
638 Ga0500644_0018088
639 Ga0500644_0096541
640 Ga0500630_139761
641 Ga0501082_0066448
642 Ga0501082_0265455
643 Ga0530510_0028883
644 2644094371
645 2676496633
646 2753073618
647 2795786480
648 2795797842
649 2855674889
650 2855679444
651 2857289480
652 2858888014
653 2858895421
654 2866618318
655 2867317297
656 2867323114
657 2867510714
658 2869054454
659 2869065772
660 2869073500
661 2870725576
662 2880494995
663 2880497336
664 2884703797
665 2895448939
666 2899366336
667 2915774919
668 2917738525
669 2917742769
670 2929225898
671 2929232560
672 3003006190
673 8054704348
674 8054731562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

120

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

150

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9898 147 202
7r3e-assembly1.cif.gz_A fusion construct of pqse and rhlr in complex with the synthetic antagonist mbtl 0.9807 147 206
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.98 147 208
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9788 146 208
1fse-assembly1.cif.gz_A crystal structure of the bacillus subtilis regulatory protein gere 0.9743 147 208
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9898 147 202 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9882 146 203 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9866 147 205 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9831 146 202 1.10.10.10
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9788 146 208 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4V3GZ27-F1-model_v4 deleted 0.9734 4 141
AF-A0A7V1M7U5-F1-model_v4 Response regulator transcription factor 0.9715 2 132 GO:0000160
GO:0003677
AF-A0A2S8L796-F1-model_v4 deleted 0.9713 3 137
AF-A0A4Q5SB66-F1-model_v4 Response regulator transcription factor 0.9704 1 128 GO:0000160
GO:0003677
AF-A0A6G4U7M6-F1-model_v4 Response regulator transcription factor 0.9625 1 141 GO:0000160
GO:0003677

Map